4S2TP

Crystal structure of x-prolyl aminopeptidase from caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
617
structure length
615
Chain Sequence
HMTALEKLAKLRSLFHSERVLALTSSKPMVAYLLPSTDAHHSEYLADYDFRVKFLSGFSGSNAYVVVTDREALLWTDGRYFTQAGNQLDSNSWKLMKQGQPDSITVVDWLVRELERGSVIGFDPTLSTFDAGSKTFKRLKAAGLQPVSIPGNLVDEFWTDRPRLAGEPVVVLDVEDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLGESGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHGTGHGVGHYLNVHEGPIGIGHRPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEAVVMSKAQNFLTFKSLTLVPIQTSIVDKSLLIEEEINWLNQYHARVLKEVGEHLQKRGKTDELKWLAEACKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Protein APP-1
total genus 211
structure length 615
sequence length 617
chains with identical sequence Q
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00557 Peptidase_M24 Metallopeptidase family M24
P PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
P PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
P PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP01
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4s2tP03
1C24A 4Z7MA 4U73A 3IU7A 1WL6A 3BITA 2GU7A 4ZWPA 1JAWA 4S01A 2GTXA 1QXZA 5D6EA 3RVAA 2DFIA 2GG0A 2BWYA 4MATA 2V3ZA 4IU6A 4IKRA 4OOKA 2EVMA 2GG7A 1N51A 2B3KA 5JHUA 4R60A 2GU4A 5CIKA 3IG4A 2EA4A 2GGBA 2GA2A 2NQ6A 2Q94A 2MATA 4S2TP 2GU5A 2NQ7A 4PV4A 3PKDA 4HXXA 1CHMA 1W2MA 1QXWA 1YW8A 4FUKA 4ZNGA 3CB5A 5CDLA 2G6PA 3Q6DA 2GG8A 3MX6A 4FLLA 5E2CA 2P9AA 1XGOA 4U1BA 5CNXA 3IU9A 4PNCA 3L7GA 4FO7A 1A16A 3IL0A 2EA2A 4QR8A 2P98A 4FLJA 4IDYA 2BHBA 1BN5A 1BOAA 2BWSA 2OAZA 4IKSA 2P99A 3IU8A 4JUQA 2Q95A 3TAVA 1WL9A 1XNZA 1XGMA 3MATA 1KP0A 2GG2A 3O5VA 2EVCA 1MATA 4FKCA 1B59A 3CTZA 1B6AA 5D6FA 2B3HA 2Q96A 4U6WA 2GZ5A 5JI6A 2GG5A 4U75A 2BWWA 1WKMA 2BWUA 2BWTA 4KM3A 3PKEA 3TB5A 5FCFA 2BHAA 2GG3A 5CLSA 3FMRA 5CDVA 4ZWUA 2BHDA 2HOWA 1C23A 2Q8KA 1YJ3A 2GG9A 2V6CA 3OOOA 1KQ9A 4U69A 1C27A 4S2RP 4ZWOA 1WN1A 3PEBA 1WY2A 3QOCA 1WLRA 2B3LA 4S00A 3CB6A 2IW2A 1C22A 1QXYA 1R58A 4IECA 1C21A 4U6EA 4U6JA 1YVMA 2BWVA 3PKCA 4U6CA 3D27A 1XGNA 1YW9A 4U6ZA 3RORA 2BHCA 1R5HA 3L24A 4A6VA 3I7MA 2Q92A 3PN9A 3OVKA 3FMQA 1PV9A 1R5GA 2V3YA 5E5BA 2Q93A 5FCHA 3FM3A 5CE6A 1W7VA 2ZSGA 3BIQA 3MR1A 4RZYA 4A6WA 4RGZ1 4U71A 4IKUA 2V3XA 3BIPA 1KQ0A 4FLIA 1YW7A 2BN7A 3PKBA 1QZYA 1Y1NA 2BWXA 4IF7A 4EGEA 5JFRA 1WBQA 4RZZA 2GGCA 2GU6A 4FO8A 4U70A 4U76A 3S6BA 3PKAA 4FLKA 4IPAA 2ADUA 1O0XA 4IKTA 2EVOA 2OKNA 5CDEA 1M35A 2BH3A 4B28A 1XGSA 2BB7A
chains in the Genus database with same CATH superfamily
1C24A 4Z7MA 4U73A 3IU7A 1WL6A 3BITA 2GU7A 4ZWPA 1JAWA 4S01A 2GTXA 1QXZA 5D6EA 3RVAA 2DFIA 2GG0A 2BWYA 4MATA 2V3ZA 4IU6A 4IKRA 4OOKA 2EVMA 2GG7A 1N51A 2B3KA 5JHUA 4R60A 2GU4A 5CIKA 3IG4A 2EA4A 2GGBA 2GA2A 2NQ6A 2Q94A 2MATA 4S2TP 2GU5A 2NQ7A 4PV4A 3PKDA 4HXXA 1CHMA 1W2MA 1QXWA 1YW8A 4FUKA 4ZNGA 3CB5A 5CDLA 2G6PA 3Q6DA 2GG8A 3MX6A 4FLLA 5E2CA 2P9AA 1XGOA 4U1BA 5CNXA 3IU9A 4PNCA 3L7GA 4FO7A 1A16A 3IL0A 2EA2A 4QR8A 2P98A 4FLJA 4IDYA 2BHBA 1BN5A 1BOAA 2BWSA 2OAZA 4IKSA 2P99A 3IU8A 4JUQA 2Q95A 3TAVA 1WL9A 1XNZA 1XGMA 3MATA 1KP0A 2GG2A 3O5VA 2EVCA 1MATA 4FKCA 1B59A 3CTZA 1B6AA 5D6FA 2B3HA 2Q96A 4U6WA 2GZ5A 5JI6A 2GG5A 4U75A 2BWWA 1WKMA 2BWUA 2BWTA 4KM3A 3PKEA 3TB5A 5FCFA 2BHAA 2GG3A 5CLSA 3FMRA 5CDVA 4ZWUA 2BHDA 2HOWA 1C23A 2Q8KA 1YJ3A 2GG9A 2V6CA 3OOOA 1KQ9A 4U69A 1C27A 4S2RP 4ZWOA 1WN1A 3PEBA 1WY2A 3QOCA 1WLRA 2B3LA 4S00A 3CB6A 2IW2A 1C22A 1QXYA 1R58A 4IECA 1C21A 4U6EA 4U6JA 1YVMA 2BWVA 3PKCA 4U6CA 3D27A 1XGNA 1YW9A 4U6ZA 3RORA 2BHCA 1R5HA 3L24A 4A6VA 3I7MA 2Q92A 3PN9A 3OVKA 3FMQA 1PV9A 1R5GA 2V3YA 5E5BA 2Q93A 5FCHA 3FM3A 5CE6A 1W7VA 2ZSGA 3BIQA 3MR1A 4RZYA 4A6WA 4RGZ1 4U71A 4IKUA 2V3XA 3BIPA 1KQ0A 4FLIA 1YW7A 2BN7A 3PKBA 1QZYA 1Y1NA 2BWXA 4IF7A 4EGEA 5JFRA 1WBQA 4RZZA 2GGCA 2GU6A 4FO8A 4U70A 4U76A 3S6BA 3PKAA 4FLKA 4IPAA 2ADUA 1O0XA 4IKTA 2EVOA 2OKNA 5CDEA 1M35A 2BH3A 4B28A 1XGSA 2BB7A
chains in the Genus database with same CATH topology
1C24A 4Z7MA 4U73A 3IU7A 1WL6A 3BITA 2GU7A 4ZWPA 1JAWA 4S01A 2GTXA 1QXZA 5D6EA 3RVAA 2DFIA 2GG0A 2BWYA 4MATA 2V3ZA 4IU6A 4IKRA 4OOKA 2EVMA 2GG7A 1N51A 2B3KA 5JHUA 4R60A 2GU4A 5CIKA 3IG4A 2EA4A 2GGBA 2GA2A 2NQ6A 2Q94A 2MATA 4S2TP 2GU5A 2NQ7A 4PV4A 3PKDA 4HXXA 1CHMA 1W2MA 1QXWA 1YW8A 4FUKA 4ZNGA 3CB5A 5CDLA 2G6PA 3Q6DA 2GG8A 3MX6A 4FLLA 5E2CA 2P9AA 1XGOA 4U1BA 5CNXA 3IU9A 4PNCA 3L7GA 4FO7A 1A16A 3IL0A 2EA2A 4QR8A 2P98A 4FLJA 4IDYA 2BHBA 1BN5A 1BOAA 2BWSA 2OAZA 4IKSA 2P99A 3IU8A 4JUQA 2Q95A 3TAVA 1WL9A 1XNZA 1XGMA 3MATA 1KP0A 2GG2A 3O5VA 2EVCA 1MATA 4FKCA 1B59A 3CTZA 1B6AA 5D6FA 2B3HA 2Q96A 4U6WA 2GZ5A 5JI6A 2GG5A 4U75A 2BWWA 1WKMA 2BWUA 2BWTA 4KM3A 3PKEA 3TB5A 5FCFA 2BHAA 2GG3A 5CLSA 3FMRA 5CDVA 4ZWUA 2BHDA 2HOWA 1C23A 2Q8KA 1YJ3A 2GG9A 2V6CA 3OOOA 1KQ9A 4U69A 1C27A 4S2RP 4ZWOA 1WN1A 3PEBA 1WY2A 3QOCA 1WLRA 2B3LA 4S00A 3CB6A 2IW2A 1C22A 1QXYA 1R58A 4IECA 1C21A 4U6EA 4U6JA 1YVMA 2BWVA 3PKCA 4U6CA 3D27A 1XGNA 1YW9A 4U6ZA 3RORA 2BHCA 1R5HA 3L24A 4A6VA 3I7MA 2Q92A 3PN9A 3OVKA 3FMQA 1PV9A 1R5GA 2V3YA 5E5BA 2Q93A 5FCHA 3FM3A 5CE6A 1W7VA 2ZSGA 3BIQA 3MR1A 4RZYA 4A6WA 4RGZ1 4U71A 4IKUA 2V3XA 3BIPA 1KQ0A 4FLIA 1YW7A 2BN7A 3PKBA 1QZYA 1Y1NA 2BWXA 4IF7A 4EGEA 5JFRA 1WBQA 4RZZA 2GGCA 2GU6A 4FO8A 4U70A 4U76A 3S6BA 3PKAA 4FLKA 4IPAA 2ADUA 1O0XA 4IKTA 2EVOA 2OKNA 5CDEA 1M35A 2BH3A 4B28A 1XGSA 2BB7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C24 A;  4Z7M A;  4U73 A;  3IU7 A;  1WL6 A;  3BIT A;  2GU7 A;  4ZWP A;  1JAW A;  4S01 A;  2GTX A;  1QXZ A;  5D6E A;  3RVA A;  2DFI A;  2GG0 A;  2BWY A;  4MAT A;  2V3Z A;  4IU6 A;  4IKR A;  4OOK A;  2EVM A;  2GG7 A;  1N51 A;  2B3K A;  5JHU A;  4R60 A;  2GU4 A;  5CIK A;  3IG4 A;  2EA4 A;  2GGB A;  2GA2 A;  2NQ6 A;  2Q94 A;  2MAT A;  4S2T P;  2GU5 A;  2NQ7 A;  4PV4 A;  3PKD A;  4HXX A;  1CHM A;  1W2M A;  1QXW A;  1YW8 A;  4FUK A;  4ZNG A;  3CB5 A;  5CDL A;  2G6P A;  3Q6D A;  2GG8 A;  3MX6 A;  4FLL A;  5E2C A;  2P9A A;  1XGO A;  4U1B A;  5CNX A;  3IU9 A;  4PNC A;  3L7G A;  4FO7 A;  1A16 A;  3IL0 A;  2EA2 A;  4QR8 A;  2P98 A;  4FLJ A;  4IDY A;  2BHB A;  1BN5 A;  1BOA A;  2BWS A;  2OAZ A;  4IKS A;  2P99 A;  3IU8 A;  4JUQ A;  2Q95 A;  3TAV A;  1WL9 A;  1XNZ A;  1XGM A;  3MAT A;  1KP0 A;  2GG2 A;  3O5V A;  2EVC A;  1MAT A;  4FKC A;  1B59 A;  3CTZ A;  1B6A A;  5D6F A;  2B3H A;  2Q96 A;  4U6W A;  2GZ5 A;  5JI6 A;  2GG5 A;  4U75 A;  2BWW A;  1WKM A;  2BWU A;  2BWT A;  4KM3 A;  3PKE A;  3TB5 A;  5FCF A;  2BHA A;  2GG3 A;  5CLS A;  3FMR A;  5CDV A;  4ZWU A;  2BHD A;  2HOW A;  1C23 A;  2Q8K A;  1YJ3 A;  2GG9 A;  2V6C A;  3OOO A;  1KQ9 A;  4U69 A;  1C27 A;  4S2R P;  4ZWO A;  1WN1 A;  3PEB A;  1WY2 A;  3QOC A;  1WLR A;  2B3L A;  4S00 A;  3CB6 A;  2IW2 A;  1C22 A;  1QXY A;  1R58 A;  4IEC A;  1C21 A;  4U6E A;  4U6J A;  1YVM A;  2BWV A;  3PKC A;  4U6C A;  3D27 A;  1XGN A;  1YW9 A;  4U6Z A;  3ROR A;  2BHC A;  1R5H A;  3L24 A;  4A6V A;  3I7M A;  2Q92 A;  3PN9 A;  3OVK A;  3FMQ A;  1PV9 A;  1R5G A;  2V3Y A;  5E5B A;  2Q93 A;  5FCH A;  3FM3 A;  5CE6 A;  1W7V A;  2ZSG A;  3BIQ A;  3MR1 A;  4RZY A;  4A6W A;  4RGZ 1;  4U71 A;  4IKU A;  2V3X A;  3BIP A;  1KQ0 A;  4FLI A;  1YW7 A;  2BN7 A;  3PKB A;  1QZY A;  1Y1N A;  2BWX A;  4IF7 A;  4EGE A;  5JFR A;  1WBQ A;  4RZZ A;  2GGC A;  2GU6 A;  4FO8 A;  4U70 A;  4U76 A;  3S6B A;  3PKA A;  4FLK A;  4IPA A;  2ADU A;  1O0X A;  4IKT A;  2EVO A;  2OKN A;  5CDE A;  1M35 A;  2BH3 A;  4B28 A;  1XGS A;  2BB7 A; 
#chains in the Genus database with same CATH topology
 1C24 A;  4Z7M A;  4U73 A;  3IU7 A;  1WL6 A;  3BIT A;  2GU7 A;  4ZWP A;  1JAW A;  4S01 A;  2GTX A;  1QXZ A;  5D6E A;  3RVA A;  2DFI A;  2GG0 A;  2BWY A;  4MAT A;  2V3Z A;  4IU6 A;  4IKR A;  4OOK A;  2EVM A;  2GG7 A;  1N51 A;  2B3K A;  5JHU A;  4R60 A;  2GU4 A;  5CIK A;  3IG4 A;  2EA4 A;  2GGB A;  2GA2 A;  2NQ6 A;  2Q94 A;  2MAT A;  4S2T P;  2GU5 A;  2NQ7 A;  4PV4 A;  3PKD A;  4HXX A;  1CHM A;  1W2M A;  1QXW A;  1YW8 A;  4FUK A;  4ZNG A;  3CB5 A;  5CDL A;  2G6P A;  3Q6D A;  2GG8 A;  3MX6 A;  4FLL A;  5E2C A;  2P9A A;  1XGO A;  4U1B A;  5CNX A;  3IU9 A;  4PNC A;  3L7G A;  4FO7 A;  1A16 A;  3IL0 A;  2EA2 A;  4QR8 A;  2P98 A;  4FLJ A;  4IDY A;  2BHB A;  1BN5 A;  1BOA A;  2BWS A;  2OAZ A;  4IKS A;  2P99 A;  3IU8 A;  4JUQ A;  2Q95 A;  3TAV A;  1WL9 A;  1XNZ A;  1XGM A;  3MAT A;  1KP0 A;  2GG2 A;  3O5V A;  2EVC A;  1MAT A;  4FKC A;  1B59 A;  3CTZ A;  1B6A A;  5D6F A;  2B3H A;  2Q96 A;  4U6W A;  2GZ5 A;  5JI6 A;  2GG5 A;  4U75 A;  2BWW A;  1WKM A;  2BWU A;  2BWT A;  4KM3 A;  3PKE A;  3TB5 A;  5FCF A;  2BHA A;  2GG3 A;  5CLS A;  3FMR A;  5CDV A;  4ZWU A;  2BHD A;  2HOW A;  1C23 A;  2Q8K A;  1YJ3 A;  2GG9 A;  2V6C A;  3OOO A;  1KQ9 A;  4U69 A;  1C27 A;  4S2R P;  4ZWO A;  1WN1 A;  3PEB A;  1WY2 A;  3QOC A;  1WLR A;  2B3L A;  4S00 A;  3CB6 A;  2IW2 A;  1C22 A;  1QXY A;  1R58 A;  4IEC A;  1C21 A;  4U6E A;  4U6J A;  1YVM A;  2BWV A;  3PKC A;  4U6C A;  3D27 A;  1XGN A;  1YW9 A;  4U6Z A;  3ROR A;  2BHC A;  1R5H A;  3L24 A;  4A6V A;  3I7M A;  2Q92 A;  3PN9 A;  3OVK A;  3FMQ A;  1PV9 A;  1R5G A;  2V3Y A;  5E5B A;  2Q93 A;  5FCH A;  3FM3 A;  5CE6 A;  1W7V A;  2ZSG A;  3BIQ A;  3MR1 A;  4RZY A;  4A6W A;  4RGZ 1;  4U71 A;  4IKU A;  2V3X A;  3BIP A;  1KQ0 A;  4FLI A;  1YW7 A;  2BN7 A;  3PKB A;  1QZY A;  1Y1N A;  2BWX A;  4IF7 A;  4EGE A;  5JFR A;  1WBQ A;  4RZZ A;  2GGC A;  2GU6 A;  4FO8 A;  4U70 A;  4U76 A;  3S6B A;  3PKA A;  4FLK A;  4IPA A;  2ADU A;  1O0X A;  4IKT A;  2EVO A;  2OKN A;  5CDE A;  1M35 A;  2BH3 A;  4B28 A;  1XGS A;  2BB7 A; 
#chains in the Genus database with same CATH homology
 1C24 A;  4Z7M A;  4U73 A;  3IU7 A;  1WL6 A;  3BIT A;  2GU7 A;  4ZWP A;  1JAW A;  4S01 A;  2GTX A;  1QXZ A;  5D6E A;  3RVA A;  2DFI A;  2GG0 A;  2BWY A;  4MAT A;  2V3Z A;  4IU6 A;  4IKR A;  4OOK A;  2EVM A;  2GG7 A;  1N51 A;  2B3K A;  5JHU A;  4R60 A;  2GU4 A;  5CIK A;  3IG4 A;  2EA4 A;  2GGB A;  2GA2 A;  2NQ6 A;  2Q94 A;  2MAT A;  4S2T P;  2GU5 A;  2NQ7 A;  4PV4 A;  3PKD A;  4HXX A;  1CHM A;  1W2M A;  1QXW A;  1YW8 A;  4FUK A;  4ZNG A;  3CB5 A;  5CDL A;  2G6P A;  3Q6D A;  2GG8 A;  3MX6 A;  4FLL A;  5E2C A;  2P9A A;  1XGO A;  4U1B A;  5CNX A;  3IU9 A;  4PNC A;  3L7G A;  4FO7 A;  1A16 A;  3IL0 A;  2EA2 A;  4QR8 A;  2P98 A;  4FLJ A;  4IDY A;  2BHB A;  1BN5 A;  1BOA A;  2BWS A;  2OAZ A;  4IKS A;  2P99 A;  3IU8 A;  4JUQ A;  2Q95 A;  3TAV A;  1WL9 A;  1XNZ A;  1XGM A;  3MAT A;  1KP0 A;  2GG2 A;  3O5V A;  2EVC A;  1MAT A;  4FKC A;  1B59 A;  3CTZ A;  1B6A A;  5D6F A;  2B3H A;  2Q96 A;  4U6W A;  2GZ5 A;  5JI6 A;  2GG5 A;  4U75 A;  2BWW A;  1WKM A;  2BWU A;  2BWT A;  4KM3 A;  3PKE A;  3TB5 A;  5FCF A;  2BHA A;  2GG3 A;  5CLS A;  3FMR A;  5CDV A;  4ZWU A;  2BHD A;  2HOW A;  1C23 A;  2Q8K A;  1YJ3 A;  2GG9 A;  2V6C A;  3OOO A;  1KQ9 A;  4U69 A;  1C27 A;  4S2R P;  4ZWO A;  1WN1 A;  3PEB A;  1WY2 A;  3QOC A;  1WLR A;  2B3L A;  4S00 A;  3CB6 A;  2IW2 A;  1C22 A;  1QXY A;  1R58 A;  4IEC A;  1C21 A;  4U6E A;  4U6J A;  1YVM A;  2BWV A;  3PKC A;  4U6C A;  3D27 A;  1XGN A;  1YW9 A;  4U6Z A;  3ROR A;  2BHC A;  1R5H A;  3L24 A;  4A6V A;  3I7M A;  2Q92 A;  3PN9 A;  3OVK A;  3FMQ A;  1PV9 A;  1R5G A;  2V3Y A;  5E5B A;  2Q93 A;  5FCH A;  3FM3 A;  5CE6 A;  1W7V A;  2ZSG A;  3BIQ A;  3MR1 A;  4RZY A;  4A6W A;  4RGZ 1;  4U71 A;  4IKU A;  2V3X A;  3BIP A;  1KQ0 A;  4FLI A;  1YW7 A;  2BN7 A;  3PKB A;  1QZY A;  1Y1N A;  2BWX A;  4IF7 A;  4EGE A;  5JFR A;  1WBQ A;  4RZZ A;  2GGC A;  2GU6 A;  4FO8 A;  4U70 A;  4U76 A;  3S6B A;  3PKA A;  4FLK A;  4IPA A;  2ADU A;  1O0X A;  4IKT A;  2EVO A;  2OKN A;  5CDE A;  1M35 A;  2BH3 A;  4B28 A;  1XGS A;  2BB7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...