4S2TP

Crystal structure of x-prolyl aminopeptidase from caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
617
structure length
615
Chain Sequence
HMTALEKLAKLRSLFHSERVLALTSSKPMVAYLLPSTDAHHSEYLADYDFRVKFLSGFSGSNAYVVVTDREALLWTDGRYFTQAGNQLDSNSWKLMKQGQPDSITVVDWLVRELERGSVIGFDPTLSTFDAGSKTFKRLKAAGLQPVSIPGNLVDEFWTDRPRLAGEPVVVLDVEDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLGESGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHGTGHGVGHYLNVHEGPIGIGHRPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEAVVMSKAQNFLTFKSLTLVPIQTSIVDKSLLIEEEINWLNQYHARVLKEVGEHLQKRGKTDELKWLAEACKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Protein APP-1
total genus 211
structure length 615
sequence length 617
chains with identical sequence Q
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00557 Peptidase_M24 Metallopeptidase family M24
P PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
P PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
P PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP01
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4s2tP03
2GA2A 3CB5A 4FLKA 2BHAA 4ZNGA 3S6BA 3IU9A 4A6VA 4U70A 3IU7A 4U6ZA 1QXYA 3FM3A 3I7MA 1A16A 4U6WA 1WN1A 4FLJA 2GG8A 1XNZA 2BHCA 4S2RP 4EGEA 3PKEA 2BN7A 4RGZ1 4FLIA 4U71A 1YW7A 3PKDA 5CNXA 2Q8KA 4S00A 4RZZA 2DFIA 5E2CA 2GZ5A 5JHUA 4B28A 2BHDA 3MX6A 2Q95A 4IKSA 4RZYA 1C22A 2Q96A 4IU6A 5CDEA 1YW8A 2BHBA 2MATA 3PKAA 2NQ6A 4ZWPA 2BWYA 1B6AA 2B3HA 2EVCA 5D6EA 1WL9A 1JAWA 2EVOA 4JUQA 1QZYA 4Z7MA 3RORA 5E5BA 2GU4A 2NQ7A 3FMQA 4U69A 4A6WA 3L7GA 3Q6DA 1XGSA 2BWWA 3RVAA 5CE6A 2BWVA 4HXXA 4S01A 2BWXA 2GG2A 2GG7A 1KQ0A 3O5VA 3IU8A 4U76A 3PN9A 4IKRA 1Y1NA 5CDVA 4IKTA 2BB7A 4FUKA 2BWSA 1W7VA 4IDYA 2GU5A 3FMRA 1WLRA 1C24A 2ZSGA 1BN5A 1C23A 3MATA 3MR1A 3CB6A 2GGCA 3BIQA 2ADUA 4IECA 2Q94A 2OKNA 4U73A 5D6FA 4OOKA 1C27A 2EA4A 1N51A 1XGMA 3TAVA 2P99A 2HOWA 4FO7A 4KM3A 1KP0A 4PV4A 1YVMA 1R5HA 4R60A 3OVKA 3PEBA 1WBQA 1QXZA 5FCFA 4U1BA 1WKMA 2GG9A 4U6JA 2B3KA 2V6CA 2BH3A 4IF7A 4S2TP 3CTZA 4FO8A 1PV9A 2BWUA 1MATA 4MATA 4ZWOA 2P9AA 2IW2A 3IG4A 2OAZA 1M35A 3PKBA 2Q93A 2EVMA 4IPAA 4QR8A 1CHMA 3D27A 2G6PA 5FCHA 3QOCA 4U75A 2P98A 1W2MA 2V3YA 3BIPA 5JFRA 1YW9A 4FLLA 3PKCA 1BOAA 1B59A 2GGBA 2V3XA 4U6EA 4U6CA 5CLSA 4PNCA 2V3ZA 4FKCA 2GU7A 5JI6A 1R58A 2GTXA 1O0XA 2GG5A 3IL0A 1XGNA 4IKUA 1QXWA 1R5GA 3TB5A 1C21A 2EA2A 2Q92A 2BWTA 5CDLA 5CIKA 2GG0A 4ZWUA 1WL6A 3OOOA 1XGOA 3L24A 1YJ3A 1WY2A 2B3LA 1KQ9A 3BITA 2GG3A 2GU6A
chains in the Genus database with same CATH superfamily
2GA2A 3CB5A 4FLKA 2BHAA 4ZNGA 3S6BA 3IU9A 4A6VA 4U70A 3IU7A 4U6ZA 1QXYA 3FM3A 3I7MA 1A16A 4U6WA 1WN1A 4FLJA 2GG8A 1XNZA 2BHCA 4S2RP 4EGEA 3PKEA 2BN7A 4RGZ1 4FLIA 4U71A 1YW7A 3PKDA 5CNXA 2Q8KA 4S00A 4RZZA 2DFIA 5E2CA 2GZ5A 5JHUA 4B28A 2BHDA 3MX6A 2Q95A 4IKSA 4RZYA 1C22A 2Q96A 4IU6A 5CDEA 1YW8A 2BHBA 2MATA 3PKAA 2NQ6A 4ZWPA 2BWYA 1B6AA 2B3HA 2EVCA 5D6EA 1WL9A 1JAWA 2EVOA 4JUQA 1QZYA 4Z7MA 3RORA 5E5BA 2GU4A 2NQ7A 3FMQA 4U69A 4A6WA 3L7GA 3Q6DA 1XGSA 2BWWA 3RVAA 5CE6A 2BWVA 4HXXA 4S01A 2BWXA 2GG2A 2GG7A 1KQ0A 3O5VA 3IU8A 4U76A 3PN9A 4IKRA 1Y1NA 5CDVA 4IKTA 2BB7A 4FUKA 2BWSA 1W7VA 4IDYA 2GU5A 3FMRA 1WLRA 1C24A 2ZSGA 1BN5A 1C23A 3MATA 3MR1A 3CB6A 2GGCA 3BIQA 2ADUA 4IECA 2Q94A 2OKNA 4U73A 5D6FA 4OOKA 1C27A 2EA4A 1N51A 1XGMA 3TAVA 2P99A 2HOWA 4FO7A 4KM3A 1KP0A 4PV4A 1YVMA 1R5HA 4R60A 3OVKA 3PEBA 1WBQA 1QXZA 5FCFA 4U1BA 1WKMA 2GG9A 4U6JA 2B3KA 2V6CA 2BH3A 4IF7A 4S2TP 3CTZA 4FO8A 1PV9A 2BWUA 1MATA 4MATA 4ZWOA 2P9AA 2IW2A 3IG4A 2OAZA 1M35A 3PKBA 2Q93A 2EVMA 4IPAA 4QR8A 1CHMA 3D27A 2G6PA 5FCHA 3QOCA 4U75A 2P98A 1W2MA 2V3YA 3BIPA 5JFRA 1YW9A 4FLLA 3PKCA 1BOAA 1B59A 2GGBA 2V3XA 4U6EA 4U6CA 5CLSA 4PNCA 2V3ZA 4FKCA 2GU7A 5JI6A 1R58A 2GTXA 1O0XA 2GG5A 3IL0A 1XGNA 4IKUA 1QXWA 1R5GA 3TB5A 1C21A 2EA2A 2Q92A 2BWTA 5CDLA 5CIKA 2GG0A 4ZWUA 1WL6A 3OOOA 1XGOA 3L24A 1YJ3A 1WY2A 2B3LA 1KQ9A 3BITA 2GG3A 2GU6A
chains in the Genus database with same CATH topology
2GA2A 3CB5A 4FLKA 2BHAA 4ZNGA 3S6BA 3IU9A 4A6VA 4U70A 3IU7A 4U6ZA 1QXYA 3FM3A 3I7MA 1A16A 4U6WA 1WN1A 4FLJA 2GG8A 1XNZA 2BHCA 4S2RP 4EGEA 3PKEA 2BN7A 4RGZ1 4FLIA 4U71A 1YW7A 3PKDA 5CNXA 2Q8KA 4S00A 4RZZA 2DFIA 5E2CA 2GZ5A 5JHUA 4B28A 2BHDA 3MX6A 2Q95A 4IKSA 4RZYA 1C22A 2Q96A 4IU6A 5CDEA 1YW8A 2BHBA 2MATA 3PKAA 2NQ6A 4ZWPA 2BWYA 1B6AA 2B3HA 2EVCA 5D6EA 1WL9A 1JAWA 2EVOA 4JUQA 1QZYA 4Z7MA 3RORA 5E5BA 2GU4A 2NQ7A 3FMQA 4U69A 4A6WA 3L7GA 3Q6DA 1XGSA 2BWWA 3RVAA 5CE6A 2BWVA 4HXXA 4S01A 2BWXA 2GG2A 2GG7A 1KQ0A 3O5VA 3IU8A 4U76A 3PN9A 4IKRA 1Y1NA 5CDVA 4IKTA 2BB7A 4FUKA 2BWSA 1W7VA 4IDYA 2GU5A 3FMRA 1WLRA 1C24A 2ZSGA 1BN5A 1C23A 3MATA 3MR1A 3CB6A 2GGCA 3BIQA 2ADUA 4IECA 2Q94A 2OKNA 4U73A 5D6FA 4OOKA 1C27A 2EA4A 1N51A 1XGMA 3TAVA 2P99A 2HOWA 4FO7A 4KM3A 1KP0A 4PV4A 1YVMA 1R5HA 4R60A 3OVKA 3PEBA 1WBQA 1QXZA 5FCFA 4U1BA 1WKMA 2GG9A 4U6JA 2B3KA 2V6CA 2BH3A 4IF7A 4S2TP 3CTZA 4FO8A 1PV9A 2BWUA 1MATA 4MATA 4ZWOA 2P9AA 2IW2A 3IG4A 2OAZA 1M35A 3PKBA 2Q93A 2EVMA 4IPAA 4QR8A 1CHMA 3D27A 2G6PA 5FCHA 3QOCA 4U75A 2P98A 1W2MA 2V3YA 3BIPA 5JFRA 1YW9A 4FLLA 3PKCA 1BOAA 1B59A 2GGBA 2V3XA 4U6EA 4U6CA 5CLSA 4PNCA 2V3ZA 4FKCA 2GU7A 5JI6A 1R58A 2GTXA 1O0XA 2GG5A 3IL0A 1XGNA 4IKUA 1QXWA 1R5GA 3TB5A 1C21A 2EA2A 2Q92A 2BWTA 5CDLA 5CIKA 2GG0A 4ZWUA 1WL6A 3OOOA 1XGOA 3L24A 1YJ3A 1WY2A 2B3LA 1KQ9A 3BITA 2GG3A 2GU6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA2 A;  3CB5 A;  4FLK A;  2BHA A;  4ZNG A;  3S6B A;  3IU9 A;  4A6V A;  4U70 A;  3IU7 A;  4U6Z A;  1QXY A;  3FM3 A;  3I7M A;  1A16 A;  4U6W A;  1WN1 A;  4FLJ A;  2GG8 A;  1XNZ A;  2BHC A;  4S2R P;  4EGE A;  3PKE A;  2BN7 A;  4RGZ 1;  4FLI A;  4U71 A;  1YW7 A;  3PKD A;  5CNX A;  2Q8K A;  4S00 A;  4RZZ A;  2DFI A;  5E2C A;  2GZ5 A;  5JHU A;  4B28 A;  2BHD A;  3MX6 A;  2Q95 A;  4IKS A;  4RZY A;  1C22 A;  2Q96 A;  4IU6 A;  5CDE A;  1YW8 A;  2BHB A;  2MAT A;  3PKA A;  2NQ6 A;  4ZWP A;  2BWY A;  1B6A A;  2B3H A;  2EVC A;  5D6E A;  1WL9 A;  1JAW A;  2EVO A;  4JUQ A;  1QZY A;  4Z7M A;  3ROR A;  5E5B A;  2GU4 A;  2NQ7 A;  3FMQ A;  4U69 A;  4A6W A;  3L7G A;  3Q6D A;  1XGS A;  2BWW A;  3RVA A;  5CE6 A;  2BWV A;  4HXX A;  4S01 A;  2BWX A;  2GG2 A;  2GG7 A;  1KQ0 A;  3O5V A;  3IU8 A;  4U76 A;  3PN9 A;  4IKR A;  1Y1N A;  5CDV A;  4IKT A;  2BB7 A;  4FUK A;  2BWS A;  1W7V A;  4IDY A;  2GU5 A;  3FMR A;  1WLR A;  1C24 A;  2ZSG A;  1BN5 A;  1C23 A;  3MAT A;  3MR1 A;  3CB6 A;  2GGC A;  3BIQ A;  2ADU A;  4IEC A;  2Q94 A;  2OKN A;  4U73 A;  5D6F A;  4OOK A;  1C27 A;  2EA4 A;  1N51 A;  1XGM A;  3TAV A;  2P99 A;  2HOW A;  4FO7 A;  4KM3 A;  1KP0 A;  4PV4 A;  1YVM A;  1R5H A;  4R60 A;  3OVK A;  3PEB A;  1WBQ A;  1QXZ A;  5FCF A;  4U1B A;  1WKM A;  2GG9 A;  4U6J A;  2B3K A;  2V6C A;  2BH3 A;  4IF7 A;  4S2T P;  3CTZ A;  4FO8 A;  1PV9 A;  2BWU A;  1MAT A;  4MAT A;  4ZWO A;  2P9A A;  2IW2 A;  3IG4 A;  2OAZ A;  1M35 A;  3PKB A;  2Q93 A;  2EVM A;  4IPA A;  4QR8 A;  1CHM A;  3D27 A;  2G6P A;  5FCH A;  3QOC A;  4U75 A;  2P98 A;  1W2M A;  2V3Y A;  3BIP A;  5JFR A;  1YW9 A;  4FLL A;  3PKC A;  1BOA A;  1B59 A;  2GGB A;  2V3X A;  4U6E A;  4U6C A;  5CLS A;  4PNC A;  2V3Z A;  4FKC A;  2GU7 A;  5JI6 A;  1R58 A;  2GTX A;  1O0X A;  2GG5 A;  3IL0 A;  1XGN A;  4IKU A;  1QXW A;  1R5G A;  3TB5 A;  1C21 A;  2EA2 A;  2Q92 A;  2BWT A;  5CDL A;  5CIK A;  2GG0 A;  4ZWU A;  1WL6 A;  3OOO A;  1XGO A;  3L24 A;  1YJ3 A;  1WY2 A;  2B3L A;  1KQ9 A;  3BIT A;  2GG3 A;  2GU6 A; 
#chains in the Genus database with same CATH topology
 2GA2 A;  3CB5 A;  4FLK A;  2BHA A;  4ZNG A;  3S6B A;  3IU9 A;  4A6V A;  4U70 A;  3IU7 A;  4U6Z A;  1QXY A;  3FM3 A;  3I7M A;  1A16 A;  4U6W A;  1WN1 A;  4FLJ A;  2GG8 A;  1XNZ A;  2BHC A;  4S2R P;  4EGE A;  3PKE A;  2BN7 A;  4RGZ 1;  4FLI A;  4U71 A;  1YW7 A;  3PKD A;  5CNX A;  2Q8K A;  4S00 A;  4RZZ A;  2DFI A;  5E2C A;  2GZ5 A;  5JHU A;  4B28 A;  2BHD A;  3MX6 A;  2Q95 A;  4IKS A;  4RZY A;  1C22 A;  2Q96 A;  4IU6 A;  5CDE A;  1YW8 A;  2BHB A;  2MAT A;  3PKA A;  2NQ6 A;  4ZWP A;  2BWY A;  1B6A A;  2B3H A;  2EVC A;  5D6E A;  1WL9 A;  1JAW A;  2EVO A;  4JUQ A;  1QZY A;  4Z7M A;  3ROR A;  5E5B A;  2GU4 A;  2NQ7 A;  3FMQ A;  4U69 A;  4A6W A;  3L7G A;  3Q6D A;  1XGS A;  2BWW A;  3RVA A;  5CE6 A;  2BWV A;  4HXX A;  4S01 A;  2BWX A;  2GG2 A;  2GG7 A;  1KQ0 A;  3O5V A;  3IU8 A;  4U76 A;  3PN9 A;  4IKR A;  1Y1N A;  5CDV A;  4IKT A;  2BB7 A;  4FUK A;  2BWS A;  1W7V A;  4IDY A;  2GU5 A;  3FMR A;  1WLR A;  1C24 A;  2ZSG A;  1BN5 A;  1C23 A;  3MAT A;  3MR1 A;  3CB6 A;  2GGC A;  3BIQ A;  2ADU A;  4IEC A;  2Q94 A;  2OKN A;  4U73 A;  5D6F A;  4OOK A;  1C27 A;  2EA4 A;  1N51 A;  1XGM A;  3TAV A;  2P99 A;  2HOW A;  4FO7 A;  4KM3 A;  1KP0 A;  4PV4 A;  1YVM A;  1R5H A;  4R60 A;  3OVK A;  3PEB A;  1WBQ A;  1QXZ A;  5FCF A;  4U1B A;  1WKM A;  2GG9 A;  4U6J A;  2B3K A;  2V6C A;  2BH3 A;  4IF7 A;  4S2T P;  3CTZ A;  4FO8 A;  1PV9 A;  2BWU A;  1MAT A;  4MAT A;  4ZWO A;  2P9A A;  2IW2 A;  3IG4 A;  2OAZ A;  1M35 A;  3PKB A;  2Q93 A;  2EVM A;  4IPA A;  4QR8 A;  1CHM A;  3D27 A;  2G6P A;  5FCH A;  3QOC A;  4U75 A;  2P98 A;  1W2M A;  2V3Y A;  3BIP A;  5JFR A;  1YW9 A;  4FLL A;  3PKC A;  1BOA A;  1B59 A;  2GGB A;  2V3X A;  4U6E A;  4U6C A;  5CLS A;  4PNC A;  2V3Z A;  4FKC A;  2GU7 A;  5JI6 A;  1R58 A;  2GTX A;  1O0X A;  2GG5 A;  3IL0 A;  1XGN A;  4IKU A;  1QXW A;  1R5G A;  3TB5 A;  1C21 A;  2EA2 A;  2Q92 A;  2BWT A;  5CDL A;  5CIK A;  2GG0 A;  4ZWU A;  1WL6 A;  3OOO A;  1XGO A;  3L24 A;  1YJ3 A;  1WY2 A;  2B3L A;  1KQ9 A;  3BIT A;  2GG3 A;  2GU6 A; 
#chains in the Genus database with same CATH homology
 2GA2 A;  3CB5 A;  4FLK A;  2BHA A;  4ZNG A;  3S6B A;  3IU9 A;  4A6V A;  4U70 A;  3IU7 A;  4U6Z A;  1QXY A;  3FM3 A;  3I7M A;  1A16 A;  4U6W A;  1WN1 A;  4FLJ A;  2GG8 A;  1XNZ A;  2BHC A;  4S2R P;  4EGE A;  3PKE A;  2BN7 A;  4RGZ 1;  4FLI A;  4U71 A;  1YW7 A;  3PKD A;  5CNX A;  2Q8K A;  4S00 A;  4RZZ A;  2DFI A;  5E2C A;  2GZ5 A;  5JHU A;  4B28 A;  2BHD A;  3MX6 A;  2Q95 A;  4IKS A;  4RZY A;  1C22 A;  2Q96 A;  4IU6 A;  5CDE A;  1YW8 A;  2BHB A;  2MAT A;  3PKA A;  2NQ6 A;  4ZWP A;  2BWY A;  1B6A A;  2B3H A;  2EVC A;  5D6E A;  1WL9 A;  1JAW A;  2EVO A;  4JUQ A;  1QZY A;  4Z7M A;  3ROR A;  5E5B A;  2GU4 A;  2NQ7 A;  3FMQ A;  4U69 A;  4A6W A;  3L7G A;  3Q6D A;  1XGS A;  2BWW A;  3RVA A;  5CE6 A;  2BWV A;  4HXX A;  4S01 A;  2BWX A;  2GG2 A;  2GG7 A;  1KQ0 A;  3O5V A;  3IU8 A;  4U76 A;  3PN9 A;  4IKR A;  1Y1N A;  5CDV A;  4IKT A;  2BB7 A;  4FUK A;  2BWS A;  1W7V A;  4IDY A;  2GU5 A;  3FMR A;  1WLR A;  1C24 A;  2ZSG A;  1BN5 A;  1C23 A;  3MAT A;  3MR1 A;  3CB6 A;  2GGC A;  3BIQ A;  2ADU A;  4IEC A;  2Q94 A;  2OKN A;  4U73 A;  5D6F A;  4OOK A;  1C27 A;  2EA4 A;  1N51 A;  1XGM A;  3TAV A;  2P99 A;  2HOW A;  4FO7 A;  4KM3 A;  1KP0 A;  4PV4 A;  1YVM A;  1R5H A;  4R60 A;  3OVK A;  3PEB A;  1WBQ A;  1QXZ A;  5FCF A;  4U1B A;  1WKM A;  2GG9 A;  4U6J A;  2B3K A;  2V6C A;  2BH3 A;  4IF7 A;  4S2T P;  3CTZ A;  4FO8 A;  1PV9 A;  2BWU A;  1MAT A;  4MAT A;  4ZWO A;  2P9A A;  2IW2 A;  3IG4 A;  2OAZ A;  1M35 A;  3PKB A;  2Q93 A;  2EVM A;  4IPA A;  4QR8 A;  1CHM A;  3D27 A;  2G6P A;  5FCH A;  3QOC A;  4U75 A;  2P98 A;  1W2M A;  2V3Y A;  3BIP A;  5JFR A;  1YW9 A;  4FLL A;  3PKC A;  1BOA A;  1B59 A;  2GGB A;  2V3X A;  4U6E A;  4U6C A;  5CLS A;  4PNC A;  2V3Z A;  4FKC A;  2GU7 A;  5JI6 A;  1R58 A;  2GTX A;  1O0X A;  2GG5 A;  3IL0 A;  1XGN A;  4IKU A;  1QXW A;  1R5G A;  3TB5 A;  1C21 A;  2EA2 A;  2Q92 A;  2BWT A;  5CDL A;  5CIK A;  2GG0 A;  4ZWU A;  1WL6 A;  3OOO A;  1XGO A;  3L24 A;  1YJ3 A;  1WY2 A;  2B3L A;  1KQ9 A;  3BIT A;  2GG3 A;  2GU6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...