4S2TP

Crystal structure of x-prolyl aminopeptidase from caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
617
structure length
615
Chain Sequence
b'HMTALEKLAKLRSLFHSERVLALTSSKPMVAYLLPSTDAHHSEYLADYDFRVKFLSGFSGSNAYVVVTDREALLWTDGRYFTQAGNQLDSNSWKLMKQGQPDSITVVDWLVRELERGSVIGFDPTLSTFDAGSKTFKRLKAAGLQPVSIPGNLVDEFWTDRPRLAGEPVVVLDVEDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLGESGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHGTGHGVGHYLNVHEGPIGIGHRPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEAVVMSKAQNFLTFKSLTLVPIQTSIVDKSLLIEEEINWLNQYHARVLKEVGEHLQKRGKTDELKWLAEACKPI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein APP-1
publication title Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase/hydrolase inhibitor
total genus 211
structure length 615
sequence length 617
chains with identical sequence Q
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00557 Peptidase_M24 Metallopeptidase family M24
P PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
P PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
P PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP01
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4s2tP03
2GG2A 4IKRA 4U75A 3S6BA 4U6CA 4ZNGA 2MATA 3RORA 2BWXA 1YW7A 3RVAA 4KM3A 2BB7A 2EVOA 3L7GA 3I7MA 4S01A 1W7VA 1B6AA 1QXZA 2GA2A 3IL0A 2Q95A 3PKDA 2OAZA 4PV4A 4FO7A 4IU6A 2GZ5A 3BIPA 1R5GA 2B3KA 1W2MA 1WL9A 4OOKA 1YVMA 1XGSA 2G6PA 2GG7A 4FLLA 2GG3A 1YW9A 3IU7A 2ZSGA 4U6JA 4S2TP 5CDLA 1QZYA 1MATA 1YW8A 2BHCA 5CIKA 3D27A 2Q93A 4U6WA 5CNXA 1WLRA 2EVCA 1C24A 4FO8A 3FMRA 3IU8A 4IKSA 4QR8A 5D6FA 2BWVA 1WBQA 4HXXA 1JAWA 3OVKA 1KQ0A 4Z7MA 2GU6A 2DFIA 1A16A 3BITA 2GU4A 1PV9A 1R58A 2NQ6A 4RZYA 3PKBA 4FLKA 2Q8KA 2BWTA 2BWYA 2V3YA 5E2CA 2IW2A 2GG9A 4JUQA 2BHAA 5JHUA 2BN7A 4IPAA 4U6EA 2GG0A 4U1BA 2BWUA 4B28A 4RZZA 5CE6A 3PKAA 3IU9A 4EGEA 3MX6A 1KQ9A 3OOOA 1XGMA 2BWWA 4A6VA 2NQ7A 4IDYA 2B3LA 3MATA 5D6EA 1Y1NA 2EA4A 4U69A 2Q92A 1KP0A 4R60A 5JFRA 4FKCA 5E5BA 2P99A 2HOWA 1O0XA 4FLIA 1N51A 3TAVA 3Q6DA 1M35A 4RGZ1 4FLJA 2EVMA 3PKCA 5FCHA 2P9AA 3TB5A 2BH3A 4ZWUA 4PNCA 1CHMA 4U71A 2GG5A 3PEBA 1WN1A 3L24A 4IKUA 4FUKA 2GTXA 3O5VA 1WKMA 3CB5A 2GGCA 5CDVA 2ADUA 4U70A 2EA2A 1C21A 1QXYA 3MR1A 4IF7A 4MATA 3PN9A 5CDEA 3PKEA 4S00A 1WY2A 1BOAA 2BHDA 4U6ZA 5CLSA 3BIQA 1XNZA 1R5HA 2B3HA 2GU5A 2Q94A 2V3XA 4IECA 1XGOA 1XGNA 1C23A 3CTZA 2V3ZA 4ZWPA 2GGBA 3FM3A 4IKTA 4A6WA 1YJ3A 1BN5A 4U76A 4ZWOA 2GU7A 5FCFA 2Q96A 3IG4A 2GG8A 1B59A 2P98A 4S2RP 4U73A 1C22A 5JI6A 2V6CA 2BHBA 3FMQA 1C27A 3CB6A 1WL6A 2OKNA 2BWSA 3QOCA 1QXWA
chains in the Genus database with same CATH superfamily
2GG2A 4IKRA 4U75A 3S6BA 4U6CA 4ZNGA 2MATA 3RORA 2BWXA 1YW7A 3RVAA 4KM3A 2BB7A 2EVOA 3L7GA 3I7MA 4S01A 1W7VA 1B6AA 1QXZA 2GA2A 3IL0A 2Q95A 3PKDA 2OAZA 4PV4A 4FO7A 4IU6A 2GZ5A 3BIPA 1R5GA 2B3KA 1W2MA 1WL9A 4OOKA 1YVMA 1XGSA 2G6PA 2GG7A 4FLLA 2GG3A 1YW9A 3IU7A 2ZSGA 4U6JA 4S2TP 5CDLA 1QZYA 1MATA 1YW8A 2BHCA 5CIKA 3D27A 2Q93A 4U6WA 5CNXA 1WLRA 2EVCA 1C24A 4FO8A 3FMRA 3IU8A 4IKSA 4QR8A 5D6FA 2BWVA 1WBQA 4HXXA 1JAWA 3OVKA 1KQ0A 4Z7MA 2GU6A 2DFIA 1A16A 3BITA 2GU4A 1PV9A 1R58A 2NQ6A 4RZYA 3PKBA 4FLKA 2Q8KA 2BWTA 2BWYA 2V3YA 5E2CA 2IW2A 2GG9A 4JUQA 2BHAA 5JHUA 2BN7A 4IPAA 4U6EA 2GG0A 4U1BA 2BWUA 4B28A 4RZZA 5CE6A 3PKAA 3IU9A 4EGEA 3MX6A 1KQ9A 3OOOA 1XGMA 2BWWA 4A6VA 2NQ7A 4IDYA 2B3LA 3MATA 5D6EA 1Y1NA 2EA4A 4U69A 2Q92A 1KP0A 4R60A 5JFRA 4FKCA 5E5BA 2P99A 2HOWA 1O0XA 4FLIA 1N51A 3TAVA 3Q6DA 1M35A 4RGZ1 4FLJA 2EVMA 3PKCA 5FCHA 2P9AA 3TB5A 2BH3A 4ZWUA 4PNCA 1CHMA 4U71A 2GG5A 3PEBA 1WN1A 3L24A 4IKUA 4FUKA 2GTXA 3O5VA 1WKMA 3CB5A 2GGCA 5CDVA 2ADUA 4U70A 2EA2A 1C21A 1QXYA 3MR1A 4IF7A 4MATA 3PN9A 5CDEA 3PKEA 4S00A 1WY2A 1BOAA 2BHDA 4U6ZA 5CLSA 3BIQA 1XNZA 1R5HA 2B3HA 2GU5A 2Q94A 2V3XA 4IECA 1XGOA 1XGNA 1C23A 3CTZA 2V3ZA 4ZWPA 2GGBA 3FM3A 4IKTA 4A6WA 1YJ3A 1BN5A 4U76A 4ZWOA 2GU7A 5FCFA 2Q96A 3IG4A 2GG8A 1B59A 2P98A 4S2RP 4U73A 1C22A 5JI6A 2V6CA 2BHBA 3FMQA 1C27A 3CB6A 1WL6A 2OKNA 2BWSA 3QOCA 1QXWA
chains in the Genus database with same CATH topology
2GG2A 4IKRA 4U75A 3S6BA 4U6CA 4ZNGA 2MATA 3RORA 2BWXA 1YW7A 3RVAA 4KM3A 2BB7A 2EVOA 3L7GA 3I7MA 4S01A 1W7VA 1B6AA 1QXZA 2GA2A 3IL0A 2Q95A 3PKDA 2OAZA 4PV4A 4FO7A 4IU6A 2GZ5A 3BIPA 1R5GA 2B3KA 1W2MA 1WL9A 4OOKA 1YVMA 1XGSA 2G6PA 2GG7A 4FLLA 2GG3A 1YW9A 3IU7A 2ZSGA 4U6JA 4S2TP 5CDLA 1QZYA 1MATA 1YW8A 2BHCA 5CIKA 3D27A 2Q93A 4U6WA 5CNXA 1WLRA 2EVCA 1C24A 4FO8A 3FMRA 3IU8A 4IKSA 4QR8A 5D6FA 2BWVA 1WBQA 4HXXA 1JAWA 3OVKA 1KQ0A 4Z7MA 2GU6A 2DFIA 1A16A 3BITA 2GU4A 1PV9A 1R58A 2NQ6A 4RZYA 3PKBA 4FLKA 2Q8KA 2BWTA 2BWYA 2V3YA 5E2CA 2IW2A 2GG9A 4JUQA 2BHAA 5JHUA 2BN7A 4IPAA 4U6EA 2GG0A 4U1BA 2BWUA 4B28A 4RZZA 5CE6A 3PKAA 3IU9A 4EGEA 3MX6A 1KQ9A 3OOOA 1XGMA 2BWWA 4A6VA 2NQ7A 4IDYA 2B3LA 3MATA 5D6EA 1Y1NA 2EA4A 4U69A 2Q92A 1KP0A 4R60A 5JFRA 4FKCA 5E5BA 2P99A 2HOWA 1O0XA 4FLIA 1N51A 3TAVA 3Q6DA 1M35A 4RGZ1 4FLJA 2EVMA 3PKCA 5FCHA 2P9AA 3TB5A 2BH3A 4ZWUA 4PNCA 1CHMA 4U71A 2GG5A 3PEBA 1WN1A 3L24A 4IKUA 4FUKA 2GTXA 3O5VA 1WKMA 3CB5A 2GGCA 5CDVA 2ADUA 4U70A 2EA2A 1C21A 1QXYA 3MR1A 4IF7A 4MATA 3PN9A 5CDEA 3PKEA 4S00A 1WY2A 1BOAA 2BHDA 4U6ZA 5CLSA 3BIQA 1XNZA 1R5HA 2B3HA 2GU5A 2Q94A 2V3XA 4IECA 1XGOA 1XGNA 1C23A 3CTZA 2V3ZA 4ZWPA 2GGBA 3FM3A 4IKTA 4A6WA 1YJ3A 1BN5A 4U76A 4ZWOA 2GU7A 5FCFA 2Q96A 3IG4A 2GG8A 1B59A 2P98A 4S2RP 4U73A 1C22A 5JI6A 2V6CA 2BHBA 3FMQA 1C27A 3CB6A 1WL6A 2OKNA 2BWSA 3QOCA 1QXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG2 A;  4IKR A;  4U75 A;  3S6B A;  4U6C A;  4ZNG A;  2MAT A;  3ROR A;  2BWX A;  1YW7 A;  3RVA A;  4KM3 A;  2BB7 A;  2EVO A;  3L7G A;  3I7M A;  4S01 A;  1W7V A;  1B6A A;  1QXZ A;  2GA2 A;  3IL0 A;  2Q95 A;  3PKD A;  2OAZ A;  4PV4 A;  4FO7 A;  4IU6 A;  2GZ5 A;  3BIP A;  1R5G A;  2B3K A;  1W2M A;  1WL9 A;  4OOK A;  1YVM A;  1XGS A;  2G6P A;  2GG7 A;  4FLL A;  2GG3 A;  1YW9 A;  3IU7 A;  2ZSG A;  4U6J A;  4S2T P;  5CDL A;  1QZY A;  1MAT A;  1YW8 A;  2BHC A;  5CIK A;  3D27 A;  2Q93 A;  4U6W A;  5CNX A;  1WLR A;  2EVC A;  1C24 A;  4FO8 A;  3FMR A;  3IU8 A;  4IKS A;  4QR8 A;  5D6F A;  2BWV A;  1WBQ A;  4HXX A;  1JAW A;  3OVK A;  1KQ0 A;  4Z7M A;  2GU6 A;  2DFI A;  1A16 A;  3BIT A;  2GU4 A;  1PV9 A;  1R58 A;  2NQ6 A;  4RZY A;  3PKB A;  4FLK A;  2Q8K A;  2BWT A;  2BWY A;  2V3Y A;  5E2C A;  2IW2 A;  2GG9 A;  4JUQ A;  2BHA A;  5JHU A;  2BN7 A;  4IPA A;  4U6E A;  2GG0 A;  4U1B A;  2BWU A;  4B28 A;  4RZZ A;  5CE6 A;  3PKA A;  3IU9 A;  4EGE A;  3MX6 A;  1KQ9 A;  3OOO A;  1XGM A;  2BWW A;  4A6V A;  2NQ7 A;  4IDY A;  2B3L A;  3MAT A;  5D6E A;  1Y1N A;  2EA4 A;  4U69 A;  2Q92 A;  1KP0 A;  4R60 A;  5JFR A;  4FKC A;  5E5B A;  2P99 A;  2HOW A;  1O0X A;  4FLI A;  1N51 A;  3TAV A;  3Q6D A;  1M35 A;  4RGZ 1;  4FLJ A;  2EVM A;  3PKC A;  5FCH A;  2P9A A;  3TB5 A;  2BH3 A;  4ZWU A;  4PNC A;  1CHM A;  4U71 A;  2GG5 A;  3PEB A;  1WN1 A;  3L24 A;  4IKU A;  4FUK A;  2GTX A;  3O5V A;  1WKM A;  3CB5 A;  2GGC A;  5CDV A;  2ADU A;  4U70 A;  2EA2 A;  1C21 A;  1QXY A;  3MR1 A;  4IF7 A;  4MAT A;  3PN9 A;  5CDE A;  3PKE A;  4S00 A;  1WY2 A;  1BOA A;  2BHD A;  4U6Z A;  5CLS A;  3BIQ A;  1XNZ A;  1R5H A;  2B3H A;  2GU5 A;  2Q94 A;  2V3X A;  4IEC A;  1XGO A;  1XGN A;  1C23 A;  3CTZ A;  2V3Z A;  4ZWP A;  2GGB A;  3FM3 A;  4IKT A;  4A6W A;  1YJ3 A;  1BN5 A;  4U76 A;  4ZWO A;  2GU7 A;  5FCF A;  2Q96 A;  3IG4 A;  2GG8 A;  1B59 A;  2P98 A;  4S2R P;  4U73 A;  1C22 A;  5JI6 A;  2V6C A;  2BHB A;  3FMQ A;  1C27 A;  3CB6 A;  1WL6 A;  2OKN A;  2BWS A;  3QOC A;  1QXW A; 
#chains in the Genus database with same CATH topology
 2GG2 A;  4IKR A;  4U75 A;  3S6B A;  4U6C A;  4ZNG A;  2MAT A;  3ROR A;  2BWX A;  1YW7 A;  3RVA A;  4KM3 A;  2BB7 A;  2EVO A;  3L7G A;  3I7M A;  4S01 A;  1W7V A;  1B6A A;  1QXZ A;  2GA2 A;  3IL0 A;  2Q95 A;  3PKD A;  2OAZ A;  4PV4 A;  4FO7 A;  4IU6 A;  2GZ5 A;  3BIP A;  1R5G A;  2B3K A;  1W2M A;  1WL9 A;  4OOK A;  1YVM A;  1XGS A;  2G6P A;  2GG7 A;  4FLL A;  2GG3 A;  1YW9 A;  3IU7 A;  2ZSG A;  4U6J A;  4S2T P;  5CDL A;  1QZY A;  1MAT A;  1YW8 A;  2BHC A;  5CIK A;  3D27 A;  2Q93 A;  4U6W A;  5CNX A;  1WLR A;  2EVC A;  1C24 A;  4FO8 A;  3FMR A;  3IU8 A;  4IKS A;  4QR8 A;  5D6F A;  2BWV A;  1WBQ A;  4HXX A;  1JAW A;  3OVK A;  1KQ0 A;  4Z7M A;  2GU6 A;  2DFI A;  1A16 A;  3BIT A;  2GU4 A;  1PV9 A;  1R58 A;  2NQ6 A;  4RZY A;  3PKB A;  4FLK A;  2Q8K A;  2BWT A;  2BWY A;  2V3Y A;  5E2C A;  2IW2 A;  2GG9 A;  4JUQ A;  2BHA A;  5JHU A;  2BN7 A;  4IPA A;  4U6E A;  2GG0 A;  4U1B A;  2BWU A;  4B28 A;  4RZZ A;  5CE6 A;  3PKA A;  3IU9 A;  4EGE A;  3MX6 A;  1KQ9 A;  3OOO A;  1XGM A;  2BWW A;  4A6V A;  2NQ7 A;  4IDY A;  2B3L A;  3MAT A;  5D6E A;  1Y1N A;  2EA4 A;  4U69 A;  2Q92 A;  1KP0 A;  4R60 A;  5JFR A;  4FKC A;  5E5B A;  2P99 A;  2HOW A;  1O0X A;  4FLI A;  1N51 A;  3TAV A;  3Q6D A;  1M35 A;  4RGZ 1;  4FLJ A;  2EVM A;  3PKC A;  5FCH A;  2P9A A;  3TB5 A;  2BH3 A;  4ZWU A;  4PNC A;  1CHM A;  4U71 A;  2GG5 A;  3PEB A;  1WN1 A;  3L24 A;  4IKU A;  4FUK A;  2GTX A;  3O5V A;  1WKM A;  3CB5 A;  2GGC A;  5CDV A;  2ADU A;  4U70 A;  2EA2 A;  1C21 A;  1QXY A;  3MR1 A;  4IF7 A;  4MAT A;  3PN9 A;  5CDE A;  3PKE A;  4S00 A;  1WY2 A;  1BOA A;  2BHD A;  4U6Z A;  5CLS A;  3BIQ A;  1XNZ A;  1R5H A;  2B3H A;  2GU5 A;  2Q94 A;  2V3X A;  4IEC A;  1XGO A;  1XGN A;  1C23 A;  3CTZ A;  2V3Z A;  4ZWP A;  2GGB A;  3FM3 A;  4IKT A;  4A6W A;  1YJ3 A;  1BN5 A;  4U76 A;  4ZWO A;  2GU7 A;  5FCF A;  2Q96 A;  3IG4 A;  2GG8 A;  1B59 A;  2P98 A;  4S2R P;  4U73 A;  1C22 A;  5JI6 A;  2V6C A;  2BHB A;  3FMQ A;  1C27 A;  3CB6 A;  1WL6 A;  2OKN A;  2BWS A;  3QOC A;  1QXW A; 
#chains in the Genus database with same CATH homology
 2GG2 A;  4IKR A;  4U75 A;  3S6B A;  4U6C A;  4ZNG A;  2MAT A;  3ROR A;  2BWX A;  1YW7 A;  3RVA A;  4KM3 A;  2BB7 A;  2EVO A;  3L7G A;  3I7M A;  4S01 A;  1W7V A;  1B6A A;  1QXZ A;  2GA2 A;  3IL0 A;  2Q95 A;  3PKD A;  2OAZ A;  4PV4 A;  4FO7 A;  4IU6 A;  2GZ5 A;  3BIP A;  1R5G A;  2B3K A;  1W2M A;  1WL9 A;  4OOK A;  1YVM A;  1XGS A;  2G6P A;  2GG7 A;  4FLL A;  2GG3 A;  1YW9 A;  3IU7 A;  2ZSG A;  4U6J A;  4S2T P;  5CDL A;  1QZY A;  1MAT A;  1YW8 A;  2BHC A;  5CIK A;  3D27 A;  2Q93 A;  4U6W A;  5CNX A;  1WLR A;  2EVC A;  1C24 A;  4FO8 A;  3FMR A;  3IU8 A;  4IKS A;  4QR8 A;  5D6F A;  2BWV A;  1WBQ A;  4HXX A;  1JAW A;  3OVK A;  1KQ0 A;  4Z7M A;  2GU6 A;  2DFI A;  1A16 A;  3BIT A;  2GU4 A;  1PV9 A;  1R58 A;  2NQ6 A;  4RZY A;  3PKB A;  4FLK A;  2Q8K A;  2BWT A;  2BWY A;  2V3Y A;  5E2C A;  2IW2 A;  2GG9 A;  4JUQ A;  2BHA A;  5JHU A;  2BN7 A;  4IPA A;  4U6E A;  2GG0 A;  4U1B A;  2BWU A;  4B28 A;  4RZZ A;  5CE6 A;  3PKA A;  3IU9 A;  4EGE A;  3MX6 A;  1KQ9 A;  3OOO A;  1XGM A;  2BWW A;  4A6V A;  2NQ7 A;  4IDY A;  2B3L A;  3MAT A;  5D6E A;  1Y1N A;  2EA4 A;  4U69 A;  2Q92 A;  1KP0 A;  4R60 A;  5JFR A;  4FKC A;  5E5B A;  2P99 A;  2HOW A;  1O0X A;  4FLI A;  1N51 A;  3TAV A;  3Q6D A;  1M35 A;  4RGZ 1;  4FLJ A;  2EVM A;  3PKC A;  5FCH A;  2P9A A;  3TB5 A;  2BH3 A;  4ZWU A;  4PNC A;  1CHM A;  4U71 A;  2GG5 A;  3PEB A;  1WN1 A;  3L24 A;  4IKU A;  4FUK A;  2GTX A;  3O5V A;  1WKM A;  3CB5 A;  2GGC A;  5CDV A;  2ADU A;  4U70 A;  2EA2 A;  1C21 A;  1QXY A;  3MR1 A;  4IF7 A;  4MAT A;  3PN9 A;  5CDE A;  3PKE A;  4S00 A;  1WY2 A;  1BOA A;  2BHD A;  4U6Z A;  5CLS A;  3BIQ A;  1XNZ A;  1R5H A;  2B3H A;  2GU5 A;  2Q94 A;  2V3X A;  4IEC A;  1XGO A;  1XGN A;  1C23 A;  3CTZ A;  2V3Z A;  4ZWP A;  2GGB A;  3FM3 A;  4IKT A;  4A6W A;  1YJ3 A;  1BN5 A;  4U76 A;  4ZWO A;  2GU7 A;  5FCF A;  2Q96 A;  3IG4 A;  2GG8 A;  1B59 A;  2P98 A;  4S2R P;  4U73 A;  1C22 A;  5JI6 A;  2V6C A;  2BHB A;  3FMQ A;  1C27 A;  3CB6 A;  1WL6 A;  2OKN A;  2BWS A;  3QOC A;  1QXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...