4S2TP

Crystal structure of x-prolyl aminopeptidase from caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
617
structure length
615
Chain Sequence
HMTALEKLAKLRSLFHSERVLALTSSKPMVAYLLPSTDAHHSEYLADYDFRVKFLSGFSGSNAYVVVTDREALLWTDGRYFTQAGNQLDSNSWKLMKQGQPDSITVVDWLVRELERGSVIGFDPTLSTFDAGSKTFKRLKAAGLQPVSIPGNLVDEFWTDRPRLAGEPVVVLDVEDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLGESGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHGTGHGVGHYLNVHEGPIGIGHRPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEAVVMSKAQNFLTFKSLTLVPIQTSIVDKSLLIEEEINWLNQYHARVLKEVGEHLQKRGKTDELKWLAEACKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein APP-1
publication title Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase/hydrolase inhibitor
total genus 211
structure length 615
sequence length 617
chains with identical sequence Q
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00557 Peptidase_M24 Metallopeptidase family M24
P PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
P PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
P PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP01
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4s2tP03
2Q92A 2V3ZA 3OOOA 4U76A 2BWSA 2BWUA 5JI6A 4IKTA 4ZWPA 3RORA 4B28A 2BB7A 3RVAA 2GG3A 1R5HA 2GTXA 3FMQA 4U69A 3CB6A 3MX6A 1W2MA 3PN9A 4IKUA 5JFRA 4HXXA 1C22A 2OAZA 1WY2A 4FLKA 5FCHA 1WKMA 2BHAA 1R5GA 5CE6A 2Q96A 3Q6DA 1MATA 2GU4A 1YW9A 1YJ3A 3QOCA 5CDEA 1XGSA 2GG2A 5D6EA 1C23A 4S2TP 4FO8A 3BITA 1YVMA 5D6FA 1C24A 2B3HA 3PKBA 1KQ9A 4KM3A 4IF7A 4EGEA 3MR1A 2GU5A 2BWWA 1N51A 3BIQA 4FKCA 4ZNGA 1R58A 2BN7A 2EVOA 1PV9A 2GG5A 5FCFA 3O5VA 3IU8A 1B59A 2V3YA 2GGCA 2G6PA 4RZZA 2Q8KA 2BWXA 5CLSA 1C27A 4FLJA 1BN5A 2GGBA 4Z7MA 2BWYA 3BIPA 4IKRA 3CTZA 4U75A 3L24A 5JHUA 1BOAA 2B3KA 2BWVA 4FLIA 1XGMA 3PKAA 4U1BA 4U71A 1WLRA 3D27A 1QXZA 1C21A 4PV4A 1WN1A 2EA4A 1W7VA 5CNXA 1WL6A 4ZWUA 4IU6A 3OVKA 5CIKA 3FMRA 2GA2A 2BH3A 2BHCA 3CB5A 3L7GA 3IU9A 4S2RP 3PKCA 3IU7A 2ADUA 4A6VA 1KP0A 4RGZ1 2EVMA 1XGNA 4PNCA 2B3LA 2P9AA 4S01A 3FM3A 2EA2A 1Y1NA 4ZWOA 2GZ5A 2DFIA 2GG7A 2V3XA 2GG8A 2V6CA 4QR8A 4MATA 2GG0A 4U6CA 1O0XA 1M35A 2OKNA 3MATA 2BHBA 2EVCA 2HOWA 3PKEA 2IW2A 3I7MA 5E2CA 3IG4A 4IPAA 3TAVA 1QXYA 2P98A 4IECA 1QXWA 2GU6A 5E5BA 4S00A 4U6EA 5CDVA 1KQ0A 2Q95A 2ZSGA 4U6JA 4IKSA 4U70A 2NQ6A 1XNZA 1YW7A 4IDYA 2MATA 1YW8A 5CDLA 2Q94A 4U6ZA 1WL9A 4A6WA 4FO7A 4OOKA 1XGOA 3TB5A 1CHMA 4R60A 4FLLA 2P99A 4FUKA 4U6WA 4RZYA 1B6AA 4U73A 2BWTA 2GG9A 2Q93A 3PKDA 2NQ7A 3S6BA 1QZYA 2GU7A 1A16A 1JAWA 3PEBA 3IL0A 2BHDA 1WBQA 4JUQA
chains in the Genus database with same CATH superfamily
2Q92A 2V3ZA 3OOOA 4U76A 2BWSA 2BWUA 5JI6A 4IKTA 4ZWPA 3RORA 4B28A 2BB7A 3RVAA 2GG3A 1R5HA 2GTXA 3FMQA 4U69A 3CB6A 3MX6A 1W2MA 3PN9A 4IKUA 5JFRA 4HXXA 1C22A 2OAZA 1WY2A 4FLKA 5FCHA 1WKMA 2BHAA 1R5GA 5CE6A 2Q96A 3Q6DA 1MATA 2GU4A 1YW9A 1YJ3A 3QOCA 5CDEA 1XGSA 2GG2A 5D6EA 1C23A 4S2TP 4FO8A 3BITA 1YVMA 5D6FA 1C24A 2B3HA 3PKBA 1KQ9A 4KM3A 4IF7A 4EGEA 3MR1A 2GU5A 2BWWA 1N51A 3BIQA 4FKCA 4ZNGA 1R58A 2BN7A 2EVOA 1PV9A 2GG5A 5FCFA 3O5VA 3IU8A 1B59A 2V3YA 2GGCA 2G6PA 4RZZA 2Q8KA 2BWXA 5CLSA 1C27A 4FLJA 1BN5A 2GGBA 4Z7MA 2BWYA 3BIPA 4IKRA 3CTZA 4U75A 3L24A 5JHUA 1BOAA 2B3KA 2BWVA 4FLIA 1XGMA 3PKAA 4U1BA 4U71A 1WLRA 3D27A 1QXZA 1C21A 4PV4A 1WN1A 2EA4A 1W7VA 5CNXA 1WL6A 4ZWUA 4IU6A 3OVKA 5CIKA 3FMRA 2GA2A 2BH3A 2BHCA 3CB5A 3L7GA 3IU9A 4S2RP 3PKCA 3IU7A 2ADUA 4A6VA 1KP0A 4RGZ1 2EVMA 1XGNA 4PNCA 2B3LA 2P9AA 4S01A 3FM3A 2EA2A 1Y1NA 4ZWOA 2GZ5A 2DFIA 2GG7A 2V3XA 2GG8A 2V6CA 4QR8A 4MATA 2GG0A 4U6CA 1O0XA 1M35A 2OKNA 3MATA 2BHBA 2EVCA 2HOWA 3PKEA 2IW2A 3I7MA 5E2CA 3IG4A 4IPAA 3TAVA 1QXYA 2P98A 4IECA 1QXWA 2GU6A 5E5BA 4S00A 4U6EA 5CDVA 1KQ0A 2Q95A 2ZSGA 4U6JA 4IKSA 4U70A 2NQ6A 1XNZA 1YW7A 4IDYA 2MATA 1YW8A 5CDLA 2Q94A 4U6ZA 1WL9A 4A6WA 4FO7A 4OOKA 1XGOA 3TB5A 1CHMA 4R60A 4FLLA 2P99A 4FUKA 4U6WA 4RZYA 1B6AA 4U73A 2BWTA 2GG9A 2Q93A 3PKDA 2NQ7A 3S6BA 1QZYA 2GU7A 1A16A 1JAWA 3PEBA 3IL0A 2BHDA 1WBQA 4JUQA
chains in the Genus database with same CATH topology
2Q92A 2V3ZA 3OOOA 4U76A 2BWSA 2BWUA 5JI6A 4IKTA 4ZWPA 3RORA 4B28A 2BB7A 3RVAA 2GG3A 1R5HA 2GTXA 3FMQA 4U69A 3CB6A 3MX6A 1W2MA 3PN9A 4IKUA 5JFRA 4HXXA 1C22A 2OAZA 1WY2A 4FLKA 5FCHA 1WKMA 2BHAA 1R5GA 5CE6A 2Q96A 3Q6DA 1MATA 2GU4A 1YW9A 1YJ3A 3QOCA 5CDEA 1XGSA 2GG2A 5D6EA 1C23A 4S2TP 4FO8A 3BITA 1YVMA 5D6FA 1C24A 2B3HA 3PKBA 1KQ9A 4KM3A 4IF7A 4EGEA 3MR1A 2GU5A 2BWWA 1N51A 3BIQA 4FKCA 4ZNGA 1R58A 2BN7A 2EVOA 1PV9A 2GG5A 5FCFA 3O5VA 3IU8A 1B59A 2V3YA 2GGCA 2G6PA 4RZZA 2Q8KA 2BWXA 5CLSA 1C27A 4FLJA 1BN5A 2GGBA 4Z7MA 2BWYA 3BIPA 4IKRA 3CTZA 4U75A 3L24A 5JHUA 1BOAA 2B3KA 2BWVA 4FLIA 1XGMA 3PKAA 4U1BA 4U71A 1WLRA 3D27A 1QXZA 1C21A 4PV4A 1WN1A 2EA4A 1W7VA 5CNXA 1WL6A 4ZWUA 4IU6A 3OVKA 5CIKA 3FMRA 2GA2A 2BH3A 2BHCA 3CB5A 3L7GA 3IU9A 4S2RP 3PKCA 3IU7A 2ADUA 4A6VA 1KP0A 4RGZ1 2EVMA 1XGNA 4PNCA 2B3LA 2P9AA 4S01A 3FM3A 2EA2A 1Y1NA 4ZWOA 2GZ5A 2DFIA 2GG7A 2V3XA 2GG8A 2V6CA 4QR8A 4MATA 2GG0A 4U6CA 1O0XA 1M35A 2OKNA 3MATA 2BHBA 2EVCA 2HOWA 3PKEA 2IW2A 3I7MA 5E2CA 3IG4A 4IPAA 3TAVA 1QXYA 2P98A 4IECA 1QXWA 2GU6A 5E5BA 4S00A 4U6EA 5CDVA 1KQ0A 2Q95A 2ZSGA 4U6JA 4IKSA 4U70A 2NQ6A 1XNZA 1YW7A 4IDYA 2MATA 1YW8A 5CDLA 2Q94A 4U6ZA 1WL9A 4A6WA 4FO7A 4OOKA 1XGOA 3TB5A 1CHMA 4R60A 4FLLA 2P99A 4FUKA 4U6WA 4RZYA 1B6AA 4U73A 2BWTA 2GG9A 2Q93A 3PKDA 2NQ7A 3S6BA 1QZYA 2GU7A 1A16A 1JAWA 3PEBA 3IL0A 2BHDA 1WBQA 4JUQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q92 A;  2V3Z A;  3OOO A;  4U76 A;  2BWS A;  2BWU A;  5JI6 A;  4IKT A;  4ZWP A;  3ROR A;  4B28 A;  2BB7 A;  3RVA A;  2GG3 A;  1R5H A;  2GTX A;  3FMQ A;  4U69 A;  3CB6 A;  3MX6 A;  1W2M A;  3PN9 A;  4IKU A;  5JFR A;  4HXX A;  1C22 A;  2OAZ A;  1WY2 A;  4FLK A;  5FCH A;  1WKM A;  2BHA A;  1R5G A;  5CE6 A;  2Q96 A;  3Q6D A;  1MAT A;  2GU4 A;  1YW9 A;  1YJ3 A;  3QOC A;  5CDE A;  1XGS A;  2GG2 A;  5D6E A;  1C23 A;  4S2T P;  4FO8 A;  3BIT A;  1YVM A;  5D6F A;  1C24 A;  2B3H A;  3PKB A;  1KQ9 A;  4KM3 A;  4IF7 A;  4EGE A;  3MR1 A;  2GU5 A;  2BWW A;  1N51 A;  3BIQ A;  4FKC A;  4ZNG A;  1R58 A;  2BN7 A;  2EVO A;  1PV9 A;  2GG5 A;  5FCF A;  3O5V A;  3IU8 A;  1B59 A;  2V3Y A;  2GGC A;  2G6P A;  4RZZ A;  2Q8K A;  2BWX A;  5CLS A;  1C27 A;  4FLJ A;  1BN5 A;  2GGB A;  4Z7M A;  2BWY A;  3BIP A;  4IKR A;  3CTZ A;  4U75 A;  3L24 A;  5JHU A;  1BOA A;  2B3K A;  2BWV A;  4FLI A;  1XGM A;  3PKA A;  4U1B A;  4U71 A;  1WLR A;  3D27 A;  1QXZ A;  1C21 A;  4PV4 A;  1WN1 A;  2EA4 A;  1W7V A;  5CNX A;  1WL6 A;  4ZWU A;  4IU6 A;  3OVK A;  5CIK A;  3FMR A;  2GA2 A;  2BH3 A;  2BHC A;  3CB5 A;  3L7G A;  3IU9 A;  4S2R P;  3PKC A;  3IU7 A;  2ADU A;  4A6V A;  1KP0 A;  4RGZ 1;  2EVM A;  1XGN A;  4PNC A;  2B3L A;  2P9A A;  4S01 A;  3FM3 A;  2EA2 A;  1Y1N A;  4ZWO A;  2GZ5 A;  2DFI A;  2GG7 A;  2V3X A;  2GG8 A;  2V6C A;  4QR8 A;  4MAT A;  2GG0 A;  4U6C A;  1O0X A;  1M35 A;  2OKN A;  3MAT A;  2BHB A;  2EVC A;  2HOW A;  3PKE A;  2IW2 A;  3I7M A;  5E2C A;  3IG4 A;  4IPA A;  3TAV A;  1QXY A;  2P98 A;  4IEC A;  1QXW A;  2GU6 A;  5E5B A;  4S00 A;  4U6E A;  5CDV A;  1KQ0 A;  2Q95 A;  2ZSG A;  4U6J A;  4IKS A;  4U70 A;  2NQ6 A;  1XNZ A;  1YW7 A;  4IDY A;  2MAT A;  1YW8 A;  5CDL A;  2Q94 A;  4U6Z A;  1WL9 A;  4A6W A;  4FO7 A;  4OOK A;  1XGO A;  3TB5 A;  1CHM A;  4R60 A;  4FLL A;  2P99 A;  4FUK A;  4U6W A;  4RZY A;  1B6A A;  4U73 A;  2BWT A;  2GG9 A;  2Q93 A;  3PKD A;  2NQ7 A;  3S6B A;  1QZY A;  2GU7 A;  1A16 A;  1JAW A;  3PEB A;  3IL0 A;  2BHD A;  1WBQ A;  4JUQ A; 
#chains in the Genus database with same CATH topology
 2Q92 A;  2V3Z A;  3OOO A;  4U76 A;  2BWS A;  2BWU A;  5JI6 A;  4IKT A;  4ZWP A;  3ROR A;  4B28 A;  2BB7 A;  3RVA A;  2GG3 A;  1R5H A;  2GTX A;  3FMQ A;  4U69 A;  3CB6 A;  3MX6 A;  1W2M A;  3PN9 A;  4IKU A;  5JFR A;  4HXX A;  1C22 A;  2OAZ A;  1WY2 A;  4FLK A;  5FCH A;  1WKM A;  2BHA A;  1R5G A;  5CE6 A;  2Q96 A;  3Q6D A;  1MAT A;  2GU4 A;  1YW9 A;  1YJ3 A;  3QOC A;  5CDE A;  1XGS A;  2GG2 A;  5D6E A;  1C23 A;  4S2T P;  4FO8 A;  3BIT A;  1YVM A;  5D6F A;  1C24 A;  2B3H A;  3PKB A;  1KQ9 A;  4KM3 A;  4IF7 A;  4EGE A;  3MR1 A;  2GU5 A;  2BWW A;  1N51 A;  3BIQ A;  4FKC A;  4ZNG A;  1R58 A;  2BN7 A;  2EVO A;  1PV9 A;  2GG5 A;  5FCF A;  3O5V A;  3IU8 A;  1B59 A;  2V3Y A;  2GGC A;  2G6P A;  4RZZ A;  2Q8K A;  2BWX A;  5CLS A;  1C27 A;  4FLJ A;  1BN5 A;  2GGB A;  4Z7M A;  2BWY A;  3BIP A;  4IKR A;  3CTZ A;  4U75 A;  3L24 A;  5JHU A;  1BOA A;  2B3K A;  2BWV A;  4FLI A;  1XGM A;  3PKA A;  4U1B A;  4U71 A;  1WLR A;  3D27 A;  1QXZ A;  1C21 A;  4PV4 A;  1WN1 A;  2EA4 A;  1W7V A;  5CNX A;  1WL6 A;  4ZWU A;  4IU6 A;  3OVK A;  5CIK A;  3FMR A;  2GA2 A;  2BH3 A;  2BHC A;  3CB5 A;  3L7G A;  3IU9 A;  4S2R P;  3PKC A;  3IU7 A;  2ADU A;  4A6V A;  1KP0 A;  4RGZ 1;  2EVM A;  1XGN A;  4PNC A;  2B3L A;  2P9A A;  4S01 A;  3FM3 A;  2EA2 A;  1Y1N A;  4ZWO A;  2GZ5 A;  2DFI A;  2GG7 A;  2V3X A;  2GG8 A;  2V6C A;  4QR8 A;  4MAT A;  2GG0 A;  4U6C A;  1O0X A;  1M35 A;  2OKN A;  3MAT A;  2BHB A;  2EVC A;  2HOW A;  3PKE A;  2IW2 A;  3I7M A;  5E2C A;  3IG4 A;  4IPA A;  3TAV A;  1QXY A;  2P98 A;  4IEC A;  1QXW A;  2GU6 A;  5E5B A;  4S00 A;  4U6E A;  5CDV A;  1KQ0 A;  2Q95 A;  2ZSG A;  4U6J A;  4IKS A;  4U70 A;  2NQ6 A;  1XNZ A;  1YW7 A;  4IDY A;  2MAT A;  1YW8 A;  5CDL A;  2Q94 A;  4U6Z A;  1WL9 A;  4A6W A;  4FO7 A;  4OOK A;  1XGO A;  3TB5 A;  1CHM A;  4R60 A;  4FLL A;  2P99 A;  4FUK A;  4U6W A;  4RZY A;  1B6A A;  4U73 A;  2BWT A;  2GG9 A;  2Q93 A;  3PKD A;  2NQ7 A;  3S6B A;  1QZY A;  2GU7 A;  1A16 A;  1JAW A;  3PEB A;  3IL0 A;  2BHD A;  1WBQ A;  4JUQ A; 
#chains in the Genus database with same CATH homology
 2Q92 A;  2V3Z A;  3OOO A;  4U76 A;  2BWS A;  2BWU A;  5JI6 A;  4IKT A;  4ZWP A;  3ROR A;  4B28 A;  2BB7 A;  3RVA A;  2GG3 A;  1R5H A;  2GTX A;  3FMQ A;  4U69 A;  3CB6 A;  3MX6 A;  1W2M A;  3PN9 A;  4IKU A;  5JFR A;  4HXX A;  1C22 A;  2OAZ A;  1WY2 A;  4FLK A;  5FCH A;  1WKM A;  2BHA A;  1R5G A;  5CE6 A;  2Q96 A;  3Q6D A;  1MAT A;  2GU4 A;  1YW9 A;  1YJ3 A;  3QOC A;  5CDE A;  1XGS A;  2GG2 A;  5D6E A;  1C23 A;  4S2T P;  4FO8 A;  3BIT A;  1YVM A;  5D6F A;  1C24 A;  2B3H A;  3PKB A;  1KQ9 A;  4KM3 A;  4IF7 A;  4EGE A;  3MR1 A;  2GU5 A;  2BWW A;  1N51 A;  3BIQ A;  4FKC A;  4ZNG A;  1R58 A;  2BN7 A;  2EVO A;  1PV9 A;  2GG5 A;  5FCF A;  3O5V A;  3IU8 A;  1B59 A;  2V3Y A;  2GGC A;  2G6P A;  4RZZ A;  2Q8K A;  2BWX A;  5CLS A;  1C27 A;  4FLJ A;  1BN5 A;  2GGB A;  4Z7M A;  2BWY A;  3BIP A;  4IKR A;  3CTZ A;  4U75 A;  3L24 A;  5JHU A;  1BOA A;  2B3K A;  2BWV A;  4FLI A;  1XGM A;  3PKA A;  4U1B A;  4U71 A;  1WLR A;  3D27 A;  1QXZ A;  1C21 A;  4PV4 A;  1WN1 A;  2EA4 A;  1W7V A;  5CNX A;  1WL6 A;  4ZWU A;  4IU6 A;  3OVK A;  5CIK A;  3FMR A;  2GA2 A;  2BH3 A;  2BHC A;  3CB5 A;  3L7G A;  3IU9 A;  4S2R P;  3PKC A;  3IU7 A;  2ADU A;  4A6V A;  1KP0 A;  4RGZ 1;  2EVM A;  1XGN A;  4PNC A;  2B3L A;  2P9A A;  4S01 A;  3FM3 A;  2EA2 A;  1Y1N A;  4ZWO A;  2GZ5 A;  2DFI A;  2GG7 A;  2V3X A;  2GG8 A;  2V6C A;  4QR8 A;  4MAT A;  2GG0 A;  4U6C A;  1O0X A;  1M35 A;  2OKN A;  3MAT A;  2BHB A;  2EVC A;  2HOW A;  3PKE A;  2IW2 A;  3I7M A;  5E2C A;  3IG4 A;  4IPA A;  3TAV A;  1QXY A;  2P98 A;  4IEC A;  1QXW A;  2GU6 A;  5E5B A;  4S00 A;  4U6E A;  5CDV A;  1KQ0 A;  2Q95 A;  2ZSG A;  4U6J A;  4IKS A;  4U70 A;  2NQ6 A;  1XNZ A;  1YW7 A;  4IDY A;  2MAT A;  1YW8 A;  5CDL A;  2Q94 A;  4U6Z A;  1WL9 A;  4A6W A;  4FO7 A;  4OOK A;  1XGO A;  3TB5 A;  1CHM A;  4R60 A;  4FLL A;  2P99 A;  4FUK A;  4U6W A;  4RZY A;  1B6A A;  4U73 A;  2BWT A;  2GG9 A;  2Q93 A;  3PKD A;  2NQ7 A;  3S6B A;  1QZY A;  2GU7 A;  1A16 A;  1JAW A;  3PEB A;  3IL0 A;  2BHD A;  1WBQ A;  4JUQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...