4S2TP

Crystal structure of x-prolyl aminopeptidase from caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
617
structure length
615
Chain Sequence
HMTALEKLAKLRSLFHSERVLALTSSKPMVAYLLPSTDAHHSEYLADYDFRVKFLSGFSGSNAYVVVTDREALLWTDGRYFTQAGNQLDSNSWKLMKQGQPDSITVVDWLVRELERGSVIGFDPTLSTFDAGSKTFKRLKAAGLQPVSIPGNLVDEFWTDRPRLAGEPVVVLDVEDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLGESGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHGTGHGVGHYLNVHEGPIGIGHRPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEAVVMSKAQNFLTFKSLTLVPIQTSIVDKSLLIEEEINWLNQYHARVLKEVGEHLQKRGKTDELKWLAEACKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Protein APP-1
publication title Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
pubmed doi rcsb
source organism Caenorhabditis elegans
total genus 211
structure length 615
sequence length 617
chains with identical sequence Q
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00557 Peptidase_M24 Metallopeptidase family M24
P PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
P PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
P PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP01
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4s2tP03
1B59A 4U71A 4FLIA 4QR8A 2BWXA 2BWTA 3O5VA 3PEBA 1BOAA 1QXWA 4RZZA 2GG2A 4FUKA 1Y1NA 4U6CA 2BN7A 2GTXA 4IKUA 1W7VA 2EA2A 1XNZA 3BIPA 1C27A 2B3HA 2B3LA 5CLSA 3FMRA 4Z7MA 2ADUA 1B6AA 2NQ6A 2Q8KA 2BWUA 2EVCA 3CTZA 4IU6A 2GG0A 1KQ9A 2Q96A 2B3KA 5JHUA 1WBQA 5FCFA 4OOKA 2OKNA 5CDVA 1M35A 4FO8A 4IKSA 1YVMA 5JFRA 1C22A 3D27A 3PKDA 3FM3A 3RVAA 1YW9A 4IDYA 2GU5A 3MR1A 3CB6A 4U76A 1YJ3A 5D6EA 2BHDA 4U1BA 1A16A 3PKAA 1QXYA 1WN1A 2BB7A 3PKBA 1WL9A 2GG8A 3L24A 3IG4A 2GA2A 3OVKA 5CNXA 4EGEA 2OAZA 4U6JA 1CHMA 4A6WA 2G6PA 2P99A 1YW8A 1WKMA 3MATA 2ZSGA 2Q94A 3OOOA 3IU7A 1XGMA 4U69A 1QXZA 4FLJA 2BWWA 2EA4A 2GG7A 4MATA 3CB5A 3TAVA 4FLLA 3BITA 5E5BA 2GU6A 4A6VA 1KP0A 4S00A 1JAWA 4S2RP 1C23A 3IU9A 1QZYA 3IU8A 4U6EA 2V3ZA 2GU4A 2BWSA 2BWYA 4U6ZA 3L7GA 1WLRA 2V3YA 3Q6DA 4B28A 2GG3A 5E2CA 4RGZ1 4HXXA 4IECA 5CE6A 3IL0A 1YW7A 3FMQA 3RORA 4KM3A 1WL6A 3I7MA 3PKEA 4IPAA 2HOWA 1BN5A 4ZWOA 4R60A 1N51A 1PV9A 3QOCA 4ZWUA 2GG9A 4IF7A 2BWVA 4U73A 4FKCA 1WY2A 2NQ7A 1R5GA 5D6FA 5FCHA 4FO7A 4U6WA 4JUQA 3S6BA 2IW2A 2Q92A 2BHCA 3TB5A 4PNCA 2V3XA 2GGBA 1XGSA 2Q93A 2P9AA 1W2MA 1C21A 1C24A 2P98A 1MATA 4ZWPA 1O0XA 4U75A 2EVOA 1KQ0A 4S01A 5CDLA 4S2TP 4U70A 3BIQA 4ZNGA 2DFIA 2GZ5A 2V6CA 3PKCA 5JI6A 1R5HA 4IKTA 4PV4A 2Q95A 3PN9A 5CIKA 5CDEA 2BHAA 1R58A 1XGOA 3MX6A 4IKRA 2GG5A 2MATA 2BH3A 2GGCA 2BHBA 2GU7A 2EVMA 4FLKA 1XGNA 4RZYA
chains in the Genus database with same CATH superfamily
1B59A 4U71A 4FLIA 4QR8A 2BWXA 2BWTA 3O5VA 3PEBA 1BOAA 1QXWA 4RZZA 2GG2A 4FUKA 1Y1NA 4U6CA 2BN7A 2GTXA 4IKUA 1W7VA 2EA2A 1XNZA 3BIPA 1C27A 2B3HA 2B3LA 5CLSA 3FMRA 4Z7MA 2ADUA 1B6AA 2NQ6A 2Q8KA 2BWUA 2EVCA 3CTZA 4IU6A 2GG0A 1KQ9A 2Q96A 2B3KA 5JHUA 1WBQA 5FCFA 4OOKA 2OKNA 5CDVA 1M35A 4FO8A 4IKSA 1YVMA 5JFRA 1C22A 3D27A 3PKDA 3FM3A 3RVAA 1YW9A 4IDYA 2GU5A 3MR1A 3CB6A 4U76A 1YJ3A 5D6EA 2BHDA 4U1BA 1A16A 3PKAA 1QXYA 1WN1A 2BB7A 3PKBA 1WL9A 2GG8A 3L24A 3IG4A 2GA2A 3OVKA 5CNXA 4EGEA 2OAZA 4U6JA 1CHMA 4A6WA 2G6PA 2P99A 1YW8A 1WKMA 3MATA 2ZSGA 2Q94A 3OOOA 3IU7A 1XGMA 4U69A 1QXZA 4FLJA 2BWWA 2EA4A 2GG7A 4MATA 3CB5A 3TAVA 4FLLA 3BITA 5E5BA 2GU6A 4A6VA 1KP0A 4S00A 1JAWA 4S2RP 1C23A 3IU9A 1QZYA 3IU8A 4U6EA 2V3ZA 2GU4A 2BWSA 2BWYA 4U6ZA 3L7GA 1WLRA 2V3YA 3Q6DA 4B28A 2GG3A 5E2CA 4RGZ1 4HXXA 4IECA 5CE6A 3IL0A 1YW7A 3FMQA 3RORA 4KM3A 1WL6A 3I7MA 3PKEA 4IPAA 2HOWA 1BN5A 4ZWOA 4R60A 1N51A 1PV9A 3QOCA 4ZWUA 2GG9A 4IF7A 2BWVA 4U73A 4FKCA 1WY2A 2NQ7A 1R5GA 5D6FA 5FCHA 4FO7A 4U6WA 4JUQA 3S6BA 2IW2A 2Q92A 2BHCA 3TB5A 4PNCA 2V3XA 2GGBA 1XGSA 2Q93A 2P9AA 1W2MA 1C21A 1C24A 2P98A 1MATA 4ZWPA 1O0XA 4U75A 2EVOA 1KQ0A 4S01A 5CDLA 4S2TP 4U70A 3BIQA 4ZNGA 2DFIA 2GZ5A 2V6CA 3PKCA 5JI6A 1R5HA 4IKTA 4PV4A 2Q95A 3PN9A 5CIKA 5CDEA 2BHAA 1R58A 1XGOA 3MX6A 4IKRA 2GG5A 2MATA 2BH3A 2GGCA 2BHBA 2GU7A 2EVMA 4FLKA 1XGNA 4RZYA
chains in the Genus database with same CATH topology
1B59A 4U71A 4FLIA 4QR8A 2BWXA 2BWTA 3O5VA 3PEBA 1BOAA 1QXWA 4RZZA 2GG2A 4FUKA 1Y1NA 4U6CA 2BN7A 2GTXA 4IKUA 1W7VA 2EA2A 1XNZA 3BIPA 1C27A 2B3HA 2B3LA 5CLSA 3FMRA 4Z7MA 2ADUA 1B6AA 2NQ6A 2Q8KA 2BWUA 2EVCA 3CTZA 4IU6A 2GG0A 1KQ9A 2Q96A 2B3KA 5JHUA 1WBQA 5FCFA 4OOKA 2OKNA 5CDVA 1M35A 4FO8A 4IKSA 1YVMA 5JFRA 1C22A 3D27A 3PKDA 3FM3A 3RVAA 1YW9A 4IDYA 2GU5A 3MR1A 3CB6A 4U76A 1YJ3A 5D6EA 2BHDA 4U1BA 1A16A 3PKAA 1QXYA 1WN1A 2BB7A 3PKBA 1WL9A 2GG8A 3L24A 3IG4A 2GA2A 3OVKA 5CNXA 4EGEA 2OAZA 4U6JA 1CHMA 4A6WA 2G6PA 2P99A 1YW8A 1WKMA 3MATA 2ZSGA 2Q94A 3OOOA 3IU7A 1XGMA 4U69A 1QXZA 4FLJA 2BWWA 2EA4A 2GG7A 4MATA 3CB5A 3TAVA 4FLLA 3BITA 5E5BA 2GU6A 4A6VA 1KP0A 4S00A 1JAWA 4S2RP 1C23A 3IU9A 1QZYA 3IU8A 4U6EA 2V3ZA 2GU4A 2BWSA 2BWYA 4U6ZA 3L7GA 1WLRA 2V3YA 3Q6DA 4B28A 2GG3A 5E2CA 4RGZ1 4HXXA 4IECA 5CE6A 3IL0A 1YW7A 3FMQA 3RORA 4KM3A 1WL6A 3I7MA 3PKEA 4IPAA 2HOWA 1BN5A 4ZWOA 4R60A 1N51A 1PV9A 3QOCA 4ZWUA 2GG9A 4IF7A 2BWVA 4U73A 4FKCA 1WY2A 2NQ7A 1R5GA 5D6FA 5FCHA 4FO7A 4U6WA 4JUQA 3S6BA 2IW2A 2Q92A 2BHCA 3TB5A 4PNCA 2V3XA 2GGBA 1XGSA 2Q93A 2P9AA 1W2MA 1C21A 1C24A 2P98A 1MATA 4ZWPA 1O0XA 4U75A 2EVOA 1KQ0A 4S01A 5CDLA 4S2TP 4U70A 3BIQA 4ZNGA 2DFIA 2GZ5A 2V6CA 3PKCA 5JI6A 1R5HA 4IKTA 4PV4A 2Q95A 3PN9A 5CIKA 5CDEA 2BHAA 1R58A 1XGOA 3MX6A 4IKRA 2GG5A 2MATA 2BH3A 2GGCA 2BHBA 2GU7A 2EVMA 4FLKA 1XGNA 4RZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B59 A;  4U71 A;  4FLI A;  4QR8 A;  2BWX A;  2BWT A;  3O5V A;  3PEB A;  1BOA A;  1QXW A;  4RZZ A;  2GG2 A;  4FUK A;  1Y1N A;  4U6C A;  2BN7 A;  2GTX A;  4IKU A;  1W7V A;  2EA2 A;  1XNZ A;  3BIP A;  1C27 A;  2B3H A;  2B3L A;  5CLS A;  3FMR A;  4Z7M A;  2ADU A;  1B6A A;  2NQ6 A;  2Q8K A;  2BWU A;  2EVC A;  3CTZ A;  4IU6 A;  2GG0 A;  1KQ9 A;  2Q96 A;  2B3K A;  5JHU A;  1WBQ A;  5FCF A;  4OOK A;  2OKN A;  5CDV A;  1M35 A;  4FO8 A;  4IKS A;  1YVM A;  5JFR A;  1C22 A;  3D27 A;  3PKD A;  3FM3 A;  3RVA A;  1YW9 A;  4IDY A;  2GU5 A;  3MR1 A;  3CB6 A;  4U76 A;  1YJ3 A;  5D6E A;  2BHD A;  4U1B A;  1A16 A;  3PKA A;  1QXY A;  1WN1 A;  2BB7 A;  3PKB A;  1WL9 A;  2GG8 A;  3L24 A;  3IG4 A;  2GA2 A;  3OVK A;  5CNX A;  4EGE A;  2OAZ A;  4U6J A;  1CHM A;  4A6W A;  2G6P A;  2P99 A;  1YW8 A;  1WKM A;  3MAT A;  2ZSG A;  2Q94 A;  3OOO A;  3IU7 A;  1XGM A;  4U69 A;  1QXZ A;  4FLJ A;  2BWW A;  2EA4 A;  2GG7 A;  4MAT A;  3CB5 A;  3TAV A;  4FLL A;  3BIT A;  5E5B A;  2GU6 A;  4A6V A;  1KP0 A;  4S00 A;  1JAW A;  4S2R P;  1C23 A;  3IU9 A;  1QZY A;  3IU8 A;  4U6E A;  2V3Z A;  2GU4 A;  2BWS A;  2BWY A;  4U6Z A;  3L7G A;  1WLR A;  2V3Y A;  3Q6D A;  4B28 A;  2GG3 A;  5E2C A;  4RGZ 1;  4HXX A;  4IEC A;  5CE6 A;  3IL0 A;  1YW7 A;  3FMQ A;  3ROR A;  4KM3 A;  1WL6 A;  3I7M A;  3PKE A;  4IPA A;  2HOW A;  1BN5 A;  4ZWO A;  4R60 A;  1N51 A;  1PV9 A;  3QOC A;  4ZWU A;  2GG9 A;  4IF7 A;  2BWV A;  4U73 A;  4FKC A;  1WY2 A;  2NQ7 A;  1R5G A;  5D6F A;  5FCH A;  4FO7 A;  4U6W A;  4JUQ A;  3S6B A;  2IW2 A;  2Q92 A;  2BHC A;  3TB5 A;  4PNC A;  2V3X A;  2GGB A;  1XGS A;  2Q93 A;  2P9A A;  1W2M A;  1C21 A;  1C24 A;  2P98 A;  1MAT A;  4ZWP A;  1O0X A;  4U75 A;  2EVO A;  1KQ0 A;  4S01 A;  5CDL A;  4S2T P;  4U70 A;  3BIQ A;  4ZNG A;  2DFI A;  2GZ5 A;  2V6C A;  3PKC A;  5JI6 A;  1R5H A;  4IKT A;  4PV4 A;  2Q95 A;  3PN9 A;  5CIK A;  5CDE A;  2BHA A;  1R58 A;  1XGO A;  3MX6 A;  4IKR A;  2GG5 A;  2MAT A;  2BH3 A;  2GGC A;  2BHB A;  2GU7 A;  2EVM A;  4FLK A;  1XGN A;  4RZY A; 
#chains in the Genus database with same CATH topology
 1B59 A;  4U71 A;  4FLI A;  4QR8 A;  2BWX A;  2BWT A;  3O5V A;  3PEB A;  1BOA A;  1QXW A;  4RZZ A;  2GG2 A;  4FUK A;  1Y1N A;  4U6C A;  2BN7 A;  2GTX A;  4IKU A;  1W7V A;  2EA2 A;  1XNZ A;  3BIP A;  1C27 A;  2B3H A;  2B3L A;  5CLS A;  3FMR A;  4Z7M A;  2ADU A;  1B6A A;  2NQ6 A;  2Q8K A;  2BWU A;  2EVC A;  3CTZ A;  4IU6 A;  2GG0 A;  1KQ9 A;  2Q96 A;  2B3K A;  5JHU A;  1WBQ A;  5FCF A;  4OOK A;  2OKN A;  5CDV A;  1M35 A;  4FO8 A;  4IKS A;  1YVM A;  5JFR A;  1C22 A;  3D27 A;  3PKD A;  3FM3 A;  3RVA A;  1YW9 A;  4IDY A;  2GU5 A;  3MR1 A;  3CB6 A;  4U76 A;  1YJ3 A;  5D6E A;  2BHD A;  4U1B A;  1A16 A;  3PKA A;  1QXY A;  1WN1 A;  2BB7 A;  3PKB A;  1WL9 A;  2GG8 A;  3L24 A;  3IG4 A;  2GA2 A;  3OVK A;  5CNX A;  4EGE A;  2OAZ A;  4U6J A;  1CHM A;  4A6W A;  2G6P A;  2P99 A;  1YW8 A;  1WKM A;  3MAT A;  2ZSG A;  2Q94 A;  3OOO A;  3IU7 A;  1XGM A;  4U69 A;  1QXZ A;  4FLJ A;  2BWW A;  2EA4 A;  2GG7 A;  4MAT A;  3CB5 A;  3TAV A;  4FLL A;  3BIT A;  5E5B A;  2GU6 A;  4A6V A;  1KP0 A;  4S00 A;  1JAW A;  4S2R P;  1C23 A;  3IU9 A;  1QZY A;  3IU8 A;  4U6E A;  2V3Z A;  2GU4 A;  2BWS A;  2BWY A;  4U6Z A;  3L7G A;  1WLR A;  2V3Y A;  3Q6D A;  4B28 A;  2GG3 A;  5E2C A;  4RGZ 1;  4HXX A;  4IEC A;  5CE6 A;  3IL0 A;  1YW7 A;  3FMQ A;  3ROR A;  4KM3 A;  1WL6 A;  3I7M A;  3PKE A;  4IPA A;  2HOW A;  1BN5 A;  4ZWO A;  4R60 A;  1N51 A;  1PV9 A;  3QOC A;  4ZWU A;  2GG9 A;  4IF7 A;  2BWV A;  4U73 A;  4FKC A;  1WY2 A;  2NQ7 A;  1R5G A;  5D6F A;  5FCH A;  4FO7 A;  4U6W A;  4JUQ A;  3S6B A;  2IW2 A;  2Q92 A;  2BHC A;  3TB5 A;  4PNC A;  2V3X A;  2GGB A;  1XGS A;  2Q93 A;  2P9A A;  1W2M A;  1C21 A;  1C24 A;  2P98 A;  1MAT A;  4ZWP A;  1O0X A;  4U75 A;  2EVO A;  1KQ0 A;  4S01 A;  5CDL A;  4S2T P;  4U70 A;  3BIQ A;  4ZNG A;  2DFI A;  2GZ5 A;  2V6C A;  3PKC A;  5JI6 A;  1R5H A;  4IKT A;  4PV4 A;  2Q95 A;  3PN9 A;  5CIK A;  5CDE A;  2BHA A;  1R58 A;  1XGO A;  3MX6 A;  4IKR A;  2GG5 A;  2MAT A;  2BH3 A;  2GGC A;  2BHB A;  2GU7 A;  2EVM A;  4FLK A;  1XGN A;  4RZY A; 
#chains in the Genus database with same CATH homology
 1B59 A;  4U71 A;  4FLI A;  4QR8 A;  2BWX A;  2BWT A;  3O5V A;  3PEB A;  1BOA A;  1QXW A;  4RZZ A;  2GG2 A;  4FUK A;  1Y1N A;  4U6C A;  2BN7 A;  2GTX A;  4IKU A;  1W7V A;  2EA2 A;  1XNZ A;  3BIP A;  1C27 A;  2B3H A;  2B3L A;  5CLS A;  3FMR A;  4Z7M A;  2ADU A;  1B6A A;  2NQ6 A;  2Q8K A;  2BWU A;  2EVC A;  3CTZ A;  4IU6 A;  2GG0 A;  1KQ9 A;  2Q96 A;  2B3K A;  5JHU A;  1WBQ A;  5FCF A;  4OOK A;  2OKN A;  5CDV A;  1M35 A;  4FO8 A;  4IKS A;  1YVM A;  5JFR A;  1C22 A;  3D27 A;  3PKD A;  3FM3 A;  3RVA A;  1YW9 A;  4IDY A;  2GU5 A;  3MR1 A;  3CB6 A;  4U76 A;  1YJ3 A;  5D6E A;  2BHD A;  4U1B A;  1A16 A;  3PKA A;  1QXY A;  1WN1 A;  2BB7 A;  3PKB A;  1WL9 A;  2GG8 A;  3L24 A;  3IG4 A;  2GA2 A;  3OVK A;  5CNX A;  4EGE A;  2OAZ A;  4U6J A;  1CHM A;  4A6W A;  2G6P A;  2P99 A;  1YW8 A;  1WKM A;  3MAT A;  2ZSG A;  2Q94 A;  3OOO A;  3IU7 A;  1XGM A;  4U69 A;  1QXZ A;  4FLJ A;  2BWW A;  2EA4 A;  2GG7 A;  4MAT A;  3CB5 A;  3TAV A;  4FLL A;  3BIT A;  5E5B A;  2GU6 A;  4A6V A;  1KP0 A;  4S00 A;  1JAW A;  4S2R P;  1C23 A;  3IU9 A;  1QZY A;  3IU8 A;  4U6E A;  2V3Z A;  2GU4 A;  2BWS A;  2BWY A;  4U6Z A;  3L7G A;  1WLR A;  2V3Y A;  3Q6D A;  4B28 A;  2GG3 A;  5E2C A;  4RGZ 1;  4HXX A;  4IEC A;  5CE6 A;  3IL0 A;  1YW7 A;  3FMQ A;  3ROR A;  4KM3 A;  1WL6 A;  3I7M A;  3PKE A;  4IPA A;  2HOW A;  1BN5 A;  4ZWO A;  4R60 A;  1N51 A;  1PV9 A;  3QOC A;  4ZWU A;  2GG9 A;  4IF7 A;  2BWV A;  4U73 A;  4FKC A;  1WY2 A;  2NQ7 A;  1R5G A;  5D6F A;  5FCH A;  4FO7 A;  4U6W A;  4JUQ A;  3S6B A;  2IW2 A;  2Q92 A;  2BHC A;  3TB5 A;  4PNC A;  2V3X A;  2GGB A;  1XGS A;  2Q93 A;  2P9A A;  1W2M A;  1C21 A;  1C24 A;  2P98 A;  1MAT A;  4ZWP A;  1O0X A;  4U75 A;  2EVO A;  1KQ0 A;  4S01 A;  5CDL A;  4S2T P;  4U70 A;  3BIQ A;  4ZNG A;  2DFI A;  2GZ5 A;  2V6C A;  3PKC A;  5JI6 A;  1R5H A;  4IKT A;  4PV4 A;  2Q95 A;  3PN9 A;  5CIK A;  5CDE A;  2BHA A;  1R58 A;  1XGO A;  3MX6 A;  4IKR A;  2GG5 A;  2MAT A;  2BH3 A;  2GGC A;  2BHB A;  2GU7 A;  2EVM A;  4FLK A;  1XGN A;  4RZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...