4S2TP

Crystal structure of x-prolyl aminopeptidase from caenorhabditis elegans: a cytosolic enzyme with a di-nuclear active site
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
617
structure length
615
Chain Sequence
HMTALEKLAKLRSLFHSERVLALTSSKPMVAYLLPSTDAHHSEYLADYDFRVKFLSGFSGSNAYVVVTDREALLWTDGRYFTQAGNQLDSNSWKLMKQGQPDSITVVDWLVRELERGSVIGFDPTLSTFDAGSKTFKRLKAAGLQPVSIPGNLVDEFWTDRPRLAGEPVVVLDVEDTGLTTSKKVENLREKLKQKKCDAAVFTLLDDVMWLLNIRGSDIPYNPLAYSYLFVAMREIHVFIDNEKLDEKSRAHFHKSNVSIHPYGEVYSWISNWLKAKEASKEPHMVYLTPETNYAIGSIIGEENSMVDTSLVQTAKATKNDHEMQGMRNSHLRDSAALVEFLCWLEKELLSGKRYTEIELADKIDHLRSLQDKYVTLSFDTISAVGDHAALPHYKPLGESGNRKAAANQVFLLDSGAHYGDGTTDVTRTVWYTNPPKEFILHNTLVLKGHINLARAKFPDGIYGSRLDTLTRDALWKLGLDFEHGTGHGVGHYLNVHEGPIGIGHRPTGGELHASQVLTIEPGFYAKEKYGIRIENCYETVEAVVMSKAQNFLTFKSLTLVPIQTSIVDKSLLIEEEINWLNQYHARVLKEVGEHLQKRGKTDELKWLAEACKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Protein APP-1
publication title Crystal structure of X-prolyl aminopeptidase from Caenorhabditis elegans: A cytosolic enzyme with a di-nuclear active site.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Hydrolase/hydrolase inhibitor
total genus 211
structure length 615
sequence length 617
chains with identical sequence Q
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2015-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00557 Peptidase_M24 Metallopeptidase family M24
P PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
P PF16188 Peptidase_M24_C C-terminal region of peptidase_M24
P PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP01
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4s2tP02
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4s2tP03
2B3HA 1B59A 4U6ZA 3PN9A 4IKUA 2P98A 1KQ0A 4A6VA 2OAZA 2Q93A 1QXZA 4ZWOA 4U76A 1CHMA 3PKDA 2BHAA 1QXYA 3OVKA 2GG9A 2NQ7A 4FLIA 4MATA 2B3KA 1WN1A 3CB6A 1PV9A 2GG2A 4IECA 2G6PA 1C27A 2BHDA 4IKSA 4U73A 4IKTA 1W7VA 1XGOA 4U6CA 2BWYA 3IL0A 1YJ3A 1WKMA 3TAVA 3TB5A 1R5HA 3IU8A 3MX6A 4OOKA 1BOAA 5FCFA 4EGEA 1B6AA 1C21A 2P9AA 1YW8A 1XGMA 2HOWA 1KQ9A 2BH3A 2P99A 5CLSA 3PKEA 4U70A 4IDYA 2V3XA 1C24A 1JAWA 2EA2A 5JI6A 2IW2A 4RGZ1 2GU4A 1YVMA 3I7MA 5JFRA 1N51A 4ZNGA 2GG8A 2BWTA 2Q95A 3O5VA 1XNZA 4R60A 2BHBA 2GG7A 3L7GA 3MATA 1WBQA 1KP0A 5E2CA 1QZYA 2EVOA 1XGSA 1W2MA 2BN7A 2GZ5A 2GG0A 1WY2A 5CDVA 3OOOA 4FKCA 3PEBA 1QXWA 2V3ZA 2Q96A 3IU9A 3D27A 2EVCA 3MR1A 5E5BA 2NQ6A 4S2TP 2BWSA 3PKAA 2GA2A 2OKNA 1C23A 1MATA 3FMQA 1R58A 2BB7A 4S2RP 1XGNA 3FM3A 4U6JA 2ADUA 4IF7A 4U71A 2GU6A 4PNCA 4FUKA 2BWVA 3PKBA 3RORA 5CIKA 4U69A 3Q6DA 4PV4A 1R5GA 3S6BA 3IU7A 5D6EA 2BWUA 4FLJA 2MATA 4FO7A 2BWXA 1WL6A 1O0XA 2Q92A 3L24A 4U6EA 5D6FA 1WL9A 4RZYA 1Y1NA 5CNXA 2B3LA 4HXXA 4ZWUA 2GG3A 4Z7MA 3RVAA 3BITA 4IPAA 2BWWA 4ZWPA 1C22A 5FCHA 5CE6A 3QOCA 2V6CA 4KM3A 4RZZA 2Q94A 3BIPA 4FO8A 4U1BA 2EVMA 5CDLA 2V3YA 1YW9A 2BHCA 2ZSGA 2GU5A 4JUQA 4U6WA 2GGCA 2GTXA 2GU7A 4IKRA 4U75A 4IU6A 3FMRA 2Q8KA 3CTZA 1A16A 5JHUA 3CB5A 1BN5A 4FLLA 4B28A 1WLRA 1YW7A 2GG5A 3BIQA 3IG4A 3PKCA 4S01A 4QR8A 4A6WA 2EA4A 2DFIA 1M35A 5CDEA 4FLKA 2GGBA 4S00A
chains in the Genus database with same CATH superfamily
2B3HA 1B59A 4U6ZA 3PN9A 4IKUA 2P98A 1KQ0A 4A6VA 2OAZA 2Q93A 1QXZA 4ZWOA 4U76A 1CHMA 3PKDA 2BHAA 1QXYA 3OVKA 2GG9A 2NQ7A 4FLIA 4MATA 2B3KA 1WN1A 3CB6A 1PV9A 2GG2A 4IECA 2G6PA 1C27A 2BHDA 4IKSA 4U73A 4IKTA 1W7VA 1XGOA 4U6CA 2BWYA 3IL0A 1YJ3A 1WKMA 3TAVA 3TB5A 1R5HA 3IU8A 3MX6A 4OOKA 1BOAA 5FCFA 4EGEA 1B6AA 1C21A 2P9AA 1YW8A 1XGMA 2HOWA 1KQ9A 2BH3A 2P99A 5CLSA 3PKEA 4U70A 4IDYA 2V3XA 1C24A 1JAWA 2EA2A 5JI6A 2IW2A 4RGZ1 2GU4A 1YVMA 3I7MA 5JFRA 1N51A 4ZNGA 2GG8A 2BWTA 2Q95A 3O5VA 1XNZA 4R60A 2BHBA 2GG7A 3L7GA 3MATA 1WBQA 1KP0A 5E2CA 1QZYA 2EVOA 1XGSA 1W2MA 2BN7A 2GZ5A 2GG0A 1WY2A 5CDVA 3OOOA 4FKCA 3PEBA 1QXWA 2V3ZA 2Q96A 3IU9A 3D27A 2EVCA 3MR1A 5E5BA 2NQ6A 4S2TP 2BWSA 3PKAA 2GA2A 2OKNA 1C23A 1MATA 3FMQA 1R58A 2BB7A 4S2RP 1XGNA 3FM3A 4U6JA 2ADUA 4IF7A 4U71A 2GU6A 4PNCA 4FUKA 2BWVA 3PKBA 3RORA 5CIKA 4U69A 3Q6DA 4PV4A 1R5GA 3S6BA 3IU7A 5D6EA 2BWUA 4FLJA 2MATA 4FO7A 2BWXA 1WL6A 1O0XA 2Q92A 3L24A 4U6EA 5D6FA 1WL9A 4RZYA 1Y1NA 5CNXA 2B3LA 4HXXA 4ZWUA 2GG3A 4Z7MA 3RVAA 3BITA 4IPAA 2BWWA 4ZWPA 1C22A 5FCHA 5CE6A 3QOCA 2V6CA 4KM3A 4RZZA 2Q94A 3BIPA 4FO8A 4U1BA 2EVMA 5CDLA 2V3YA 1YW9A 2BHCA 2ZSGA 2GU5A 4JUQA 4U6WA 2GGCA 2GTXA 2GU7A 4IKRA 4U75A 4IU6A 3FMRA 2Q8KA 3CTZA 1A16A 5JHUA 3CB5A 1BN5A 4FLLA 4B28A 1WLRA 1YW7A 2GG5A 3BIQA 3IG4A 3PKCA 4S01A 4QR8A 4A6WA 2EA4A 2DFIA 1M35A 5CDEA 4FLKA 2GGBA 4S00A
chains in the Genus database with same CATH topology
2B3HA 1B59A 4U6ZA 3PN9A 4IKUA 2P98A 1KQ0A 4A6VA 2OAZA 2Q93A 1QXZA 4ZWOA 4U76A 1CHMA 3PKDA 2BHAA 1QXYA 3OVKA 2GG9A 2NQ7A 4FLIA 4MATA 2B3KA 1WN1A 3CB6A 1PV9A 2GG2A 4IECA 2G6PA 1C27A 2BHDA 4IKSA 4U73A 4IKTA 1W7VA 1XGOA 4U6CA 2BWYA 3IL0A 1YJ3A 1WKMA 3TAVA 3TB5A 1R5HA 3IU8A 3MX6A 4OOKA 1BOAA 5FCFA 4EGEA 1B6AA 1C21A 2P9AA 1YW8A 1XGMA 2HOWA 1KQ9A 2BH3A 2P99A 5CLSA 3PKEA 4U70A 4IDYA 2V3XA 1C24A 1JAWA 2EA2A 5JI6A 2IW2A 4RGZ1 2GU4A 1YVMA 3I7MA 5JFRA 1N51A 4ZNGA 2GG8A 2BWTA 2Q95A 3O5VA 1XNZA 4R60A 2BHBA 2GG7A 3L7GA 3MATA 1WBQA 1KP0A 5E2CA 1QZYA 2EVOA 1XGSA 1W2MA 2BN7A 2GZ5A 2GG0A 1WY2A 5CDVA 3OOOA 4FKCA 3PEBA 1QXWA 2V3ZA 2Q96A 3IU9A 3D27A 2EVCA 3MR1A 5E5BA 2NQ6A 4S2TP 2BWSA 3PKAA 2GA2A 2OKNA 1C23A 1MATA 3FMQA 1R58A 2BB7A 4S2RP 1XGNA 3FM3A 4U6JA 2ADUA 4IF7A 4U71A 2GU6A 4PNCA 4FUKA 2BWVA 3PKBA 3RORA 5CIKA 4U69A 3Q6DA 4PV4A 1R5GA 3S6BA 3IU7A 5D6EA 2BWUA 4FLJA 2MATA 4FO7A 2BWXA 1WL6A 1O0XA 2Q92A 3L24A 4U6EA 5D6FA 1WL9A 4RZYA 1Y1NA 5CNXA 2B3LA 4HXXA 4ZWUA 2GG3A 4Z7MA 3RVAA 3BITA 4IPAA 2BWWA 4ZWPA 1C22A 5FCHA 5CE6A 3QOCA 2V6CA 4KM3A 4RZZA 2Q94A 3BIPA 4FO8A 4U1BA 2EVMA 5CDLA 2V3YA 1YW9A 2BHCA 2ZSGA 2GU5A 4JUQA 4U6WA 2GGCA 2GTXA 2GU7A 4IKRA 4U75A 4IU6A 3FMRA 2Q8KA 3CTZA 1A16A 5JHUA 3CB5A 1BN5A 4FLLA 4B28A 1WLRA 1YW7A 2GG5A 3BIQA 3IG4A 3PKCA 4S01A 4QR8A 4A6WA 2EA4A 2DFIA 1M35A 5CDEA 4FLKA 2GGBA 4S00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3H A;  1B59 A;  4U6Z A;  3PN9 A;  4IKU A;  2P98 A;  1KQ0 A;  4A6V A;  2OAZ A;  2Q93 A;  1QXZ A;  4ZWO A;  4U76 A;  1CHM A;  3PKD A;  2BHA A;  1QXY A;  3OVK A;  2GG9 A;  2NQ7 A;  4FLI A;  4MAT A;  2B3K A;  1WN1 A;  3CB6 A;  1PV9 A;  2GG2 A;  4IEC A;  2G6P A;  1C27 A;  2BHD A;  4IKS A;  4U73 A;  4IKT A;  1W7V A;  1XGO A;  4U6C A;  2BWY A;  3IL0 A;  1YJ3 A;  1WKM A;  3TAV A;  3TB5 A;  1R5H A;  3IU8 A;  3MX6 A;  4OOK A;  1BOA A;  5FCF A;  4EGE A;  1B6A A;  1C21 A;  2P9A A;  1YW8 A;  1XGM A;  2HOW A;  1KQ9 A;  2BH3 A;  2P99 A;  5CLS A;  3PKE A;  4U70 A;  4IDY A;  2V3X A;  1C24 A;  1JAW A;  2EA2 A;  5JI6 A;  2IW2 A;  4RGZ 1;  2GU4 A;  1YVM A;  3I7M A;  5JFR A;  1N51 A;  4ZNG A;  2GG8 A;  2BWT A;  2Q95 A;  3O5V A;  1XNZ A;  4R60 A;  2BHB A;  2GG7 A;  3L7G A;  3MAT A;  1WBQ A;  1KP0 A;  5E2C A;  1QZY A;  2EVO A;  1XGS A;  1W2M A;  2BN7 A;  2GZ5 A;  2GG0 A;  1WY2 A;  5CDV A;  3OOO A;  4FKC A;  3PEB A;  1QXW A;  2V3Z A;  2Q96 A;  3IU9 A;  3D27 A;  2EVC A;  3MR1 A;  5E5B A;  2NQ6 A;  4S2T P;  2BWS A;  3PKA A;  2GA2 A;  2OKN A;  1C23 A;  1MAT A;  3FMQ A;  1R58 A;  2BB7 A;  4S2R P;  1XGN A;  3FM3 A;  4U6J A;  2ADU A;  4IF7 A;  4U71 A;  2GU6 A;  4PNC A;  4FUK A;  2BWV A;  3PKB A;  3ROR A;  5CIK A;  4U69 A;  3Q6D A;  4PV4 A;  1R5G A;  3S6B A;  3IU7 A;  5D6E A;  2BWU A;  4FLJ A;  2MAT A;  4FO7 A;  2BWX A;  1WL6 A;  1O0X A;  2Q92 A;  3L24 A;  4U6E A;  5D6F A;  1WL9 A;  4RZY A;  1Y1N A;  5CNX A;  2B3L A;  4HXX A;  4ZWU A;  2GG3 A;  4Z7M A;  3RVA A;  3BIT A;  4IPA A;  2BWW A;  4ZWP A;  1C22 A;  5FCH A;  5CE6 A;  3QOC A;  2V6C A;  4KM3 A;  4RZZ A;  2Q94 A;  3BIP A;  4FO8 A;  4U1B A;  2EVM A;  5CDL A;  2V3Y A;  1YW9 A;  2BHC A;  2ZSG A;  2GU5 A;  4JUQ A;  4U6W A;  2GGC A;  2GTX A;  2GU7 A;  4IKR A;  4U75 A;  4IU6 A;  3FMR A;  2Q8K A;  3CTZ A;  1A16 A;  5JHU A;  3CB5 A;  1BN5 A;  4FLL A;  4B28 A;  1WLR A;  1YW7 A;  2GG5 A;  3BIQ A;  3IG4 A;  3PKC A;  4S01 A;  4QR8 A;  4A6W A;  2EA4 A;  2DFI A;  1M35 A;  5CDE A;  4FLK A;  2GGB A;  4S00 A; 
#chains in the Genus database with same CATH topology
 2B3H A;  1B59 A;  4U6Z A;  3PN9 A;  4IKU A;  2P98 A;  1KQ0 A;  4A6V A;  2OAZ A;  2Q93 A;  1QXZ A;  4ZWO A;  4U76 A;  1CHM A;  3PKD A;  2BHA A;  1QXY A;  3OVK A;  2GG9 A;  2NQ7 A;  4FLI A;  4MAT A;  2B3K A;  1WN1 A;  3CB6 A;  1PV9 A;  2GG2 A;  4IEC A;  2G6P A;  1C27 A;  2BHD A;  4IKS A;  4U73 A;  4IKT A;  1W7V A;  1XGO A;  4U6C A;  2BWY A;  3IL0 A;  1YJ3 A;  1WKM A;  3TAV A;  3TB5 A;  1R5H A;  3IU8 A;  3MX6 A;  4OOK A;  1BOA A;  5FCF A;  4EGE A;  1B6A A;  1C21 A;  2P9A A;  1YW8 A;  1XGM A;  2HOW A;  1KQ9 A;  2BH3 A;  2P99 A;  5CLS A;  3PKE A;  4U70 A;  4IDY A;  2V3X A;  1C24 A;  1JAW A;  2EA2 A;  5JI6 A;  2IW2 A;  4RGZ 1;  2GU4 A;  1YVM A;  3I7M A;  5JFR A;  1N51 A;  4ZNG A;  2GG8 A;  2BWT A;  2Q95 A;  3O5V A;  1XNZ A;  4R60 A;  2BHB A;  2GG7 A;  3L7G A;  3MAT A;  1WBQ A;  1KP0 A;  5E2C A;  1QZY A;  2EVO A;  1XGS A;  1W2M A;  2BN7 A;  2GZ5 A;  2GG0 A;  1WY2 A;  5CDV A;  3OOO A;  4FKC A;  3PEB A;  1QXW A;  2V3Z A;  2Q96 A;  3IU9 A;  3D27 A;  2EVC A;  3MR1 A;  5E5B A;  2NQ6 A;  4S2T P;  2BWS A;  3PKA A;  2GA2 A;  2OKN A;  1C23 A;  1MAT A;  3FMQ A;  1R58 A;  2BB7 A;  4S2R P;  1XGN A;  3FM3 A;  4U6J A;  2ADU A;  4IF7 A;  4U71 A;  2GU6 A;  4PNC A;  4FUK A;  2BWV A;  3PKB A;  3ROR A;  5CIK A;  4U69 A;  3Q6D A;  4PV4 A;  1R5G A;  3S6B A;  3IU7 A;  5D6E A;  2BWU A;  4FLJ A;  2MAT A;  4FO7 A;  2BWX A;  1WL6 A;  1O0X A;  2Q92 A;  3L24 A;  4U6E A;  5D6F A;  1WL9 A;  4RZY A;  1Y1N A;  5CNX A;  2B3L A;  4HXX A;  4ZWU A;  2GG3 A;  4Z7M A;  3RVA A;  3BIT A;  4IPA A;  2BWW A;  4ZWP A;  1C22 A;  5FCH A;  5CE6 A;  3QOC A;  2V6C A;  4KM3 A;  4RZZ A;  2Q94 A;  3BIP A;  4FO8 A;  4U1B A;  2EVM A;  5CDL A;  2V3Y A;  1YW9 A;  2BHC A;  2ZSG A;  2GU5 A;  4JUQ A;  4U6W A;  2GGC A;  2GTX A;  2GU7 A;  4IKR A;  4U75 A;  4IU6 A;  3FMR A;  2Q8K A;  3CTZ A;  1A16 A;  5JHU A;  3CB5 A;  1BN5 A;  4FLL A;  4B28 A;  1WLR A;  1YW7 A;  2GG5 A;  3BIQ A;  3IG4 A;  3PKC A;  4S01 A;  4QR8 A;  4A6W A;  2EA4 A;  2DFI A;  1M35 A;  5CDE A;  4FLK A;  2GGB A;  4S00 A; 
#chains in the Genus database with same CATH homology
 2B3H A;  1B59 A;  4U6Z A;  3PN9 A;  4IKU A;  2P98 A;  1KQ0 A;  4A6V A;  2OAZ A;  2Q93 A;  1QXZ A;  4ZWO A;  4U76 A;  1CHM A;  3PKD A;  2BHA A;  1QXY A;  3OVK A;  2GG9 A;  2NQ7 A;  4FLI A;  4MAT A;  2B3K A;  1WN1 A;  3CB6 A;  1PV9 A;  2GG2 A;  4IEC A;  2G6P A;  1C27 A;  2BHD A;  4IKS A;  4U73 A;  4IKT A;  1W7V A;  1XGO A;  4U6C A;  2BWY A;  3IL0 A;  1YJ3 A;  1WKM A;  3TAV A;  3TB5 A;  1R5H A;  3IU8 A;  3MX6 A;  4OOK A;  1BOA A;  5FCF A;  4EGE A;  1B6A A;  1C21 A;  2P9A A;  1YW8 A;  1XGM A;  2HOW A;  1KQ9 A;  2BH3 A;  2P99 A;  5CLS A;  3PKE A;  4U70 A;  4IDY A;  2V3X A;  1C24 A;  1JAW A;  2EA2 A;  5JI6 A;  2IW2 A;  4RGZ 1;  2GU4 A;  1YVM A;  3I7M A;  5JFR A;  1N51 A;  4ZNG A;  2GG8 A;  2BWT A;  2Q95 A;  3O5V A;  1XNZ A;  4R60 A;  2BHB A;  2GG7 A;  3L7G A;  3MAT A;  1WBQ A;  1KP0 A;  5E2C A;  1QZY A;  2EVO A;  1XGS A;  1W2M A;  2BN7 A;  2GZ5 A;  2GG0 A;  1WY2 A;  5CDV A;  3OOO A;  4FKC A;  3PEB A;  1QXW A;  2V3Z A;  2Q96 A;  3IU9 A;  3D27 A;  2EVC A;  3MR1 A;  5E5B A;  2NQ6 A;  4S2T P;  2BWS A;  3PKA A;  2GA2 A;  2OKN A;  1C23 A;  1MAT A;  3FMQ A;  1R58 A;  2BB7 A;  4S2R P;  1XGN A;  3FM3 A;  4U6J A;  2ADU A;  4IF7 A;  4U71 A;  2GU6 A;  4PNC A;  4FUK A;  2BWV A;  3PKB A;  3ROR A;  5CIK A;  4U69 A;  3Q6D A;  4PV4 A;  1R5G A;  3S6B A;  3IU7 A;  5D6E A;  2BWU A;  4FLJ A;  2MAT A;  4FO7 A;  2BWX A;  1WL6 A;  1O0X A;  2Q92 A;  3L24 A;  4U6E A;  5D6F A;  1WL9 A;  4RZY A;  1Y1N A;  5CNX A;  2B3L A;  4HXX A;  4ZWU A;  2GG3 A;  4Z7M A;  3RVA A;  3BIT A;  4IPA A;  2BWW A;  4ZWP A;  1C22 A;  5FCH A;  5CE6 A;  3QOC A;  2V6C A;  4KM3 A;  4RZZ A;  2Q94 A;  3BIP A;  4FO8 A;  4U1B A;  2EVM A;  5CDL A;  2V3Y A;  1YW9 A;  2BHC A;  2ZSG A;  2GU5 A;  4JUQ A;  4U6W A;  2GGC A;  2GTX A;  2GU7 A;  4IKR A;  4U75 A;  4IU6 A;  3FMR A;  2Q8K A;  3CTZ A;  1A16 A;  5JHU A;  3CB5 A;  1BN5 A;  4FLL A;  4B28 A;  1WLR A;  1YW7 A;  2GG5 A;  3BIQ A;  3IG4 A;  3PKC A;  4S01 A;  4QR8 A;  4A6W A;  2EA4 A;  2DFI A;  1M35 A;  5CDE A;  4FLK A;  2GGB A;  4S00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...