2BWVA

His361ala escherichia coli aminopeptidase p
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVADVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 157
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwvA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwvA02
5E2CA 3O5VA 5FCHA 2EA4A 3FMQA 1A16A 3CB6A 2GGCA 1QZYA 3IU8A 4KM3A 2BHCA 2BWXA 3D27A 2ZSGA 1YW9A 2ADUA 1JAWA 3L24A 4RGZ1 2EVCA 1Y1NA 3BITA 1YVMA 4U76A 2BHDA 3BIPA 2EVMA 2GG8A 1QXZA 2GG2A 1KQ9A 2GU4A 4FO8A 4U6WA 4PV4A 4S2RP 2Q8KA 1QXYA 1C23A 4U69A 1BN5A 3TAVA 1B6AA 3PKDA 4ZWUA 3PKCA 4IDYA 4RZZA 4U6CA 1BOAA 1C22A 1XGSA 1XGNA 1MATA 4IKSA 4FLIA 1WBQA 5CIKA 5D6FA 5JFRA 2BWSA 1WLRA 2NQ6A 2MATA 1R5GA 1R58A 2OAZA 4U75A 2DFIA 3IU7A 2V3YA 2Q94A 1B59A 4MATA 1WL6A 5E5BA 2GTXA 4U6JA 2BWUA 3MATA 2GG3A 4Z7MA 3PEBA 2GA2A 3PKBA 2B3KA 4U71A 3IG4A 2P99A 2V3XA 4RZYA 5JHUA 2B3LA 4ZWPA 4U6ZA 1XNZA 2GG7A 1R5HA 2GZ5A 2P9AA 5CLSA 3PKEA 4IPAA 4S01A 2OKNA 5CDVA 4JUQA 2B3HA 1XGMA 2BB7A 3OVKA 4S00A 1KQ0A 3MR1A 4U70A 2P98A 1O0XA 5CDEA 5CE6A 4A6VA 1W7VA 2BWYA 3RVAA 3QOCA 3BIQA 4ZNGA 2Q92A 4QR8A 4PNCA 3PKAA 3Q6DA 4FLJA 4U1BA 3I7MA 5D6EA 1KP0A 3CTZA 1M35A 2HOWA 1CHMA 1C27A 2GGBA 2GU5A 4FUKA 4IU6A 3IU9A 3IL0A 4R60A 5CDLA 2GG5A 4IF7A 2V6CA 2IW2A 3L7GA 1N51A 2BWVA 4FO7A 5JI6A 2BH3A 4ZWOA 3PN9A 1W2MA 3TB5A 4IECA 1YW7A 4U73A 2Q96A 4HXXA 5CNXA 2BHBA 2BWTA 4B28A 2V3ZA 1YW8A 2GU7A 2Q93A 4IKUA 2EA2A 1WY2A 1WL9A 4S2TP 1C21A 3S6BA 4A6WA 4FLLA 4OOKA 3RORA 3OOOA 2Q95A 1XGOA 2GG0A 4U6EA 4FKCA 2NQ7A 2G6PA 2EVOA 4FLKA 3CB5A 1C24A 2BN7A 1WKMA 1YJ3A 1QXWA 1WN1A 3MX6A 2BHAA 1PV9A 2BWWA 2GG9A 4IKTA 4IKRA 3FM3A 2GU6A 4EGEA 5FCFA 3FMRA
chains in the Genus database with same CATH superfamily
5E2CA 3O5VA 5FCHA 2EA4A 3FMQA 1A16A 3CB6A 2GGCA 1QZYA 3IU8A 4KM3A 2BHCA 2BWXA 3D27A 2ZSGA 1YW9A 2ADUA 1JAWA 3L24A 4RGZ1 2EVCA 1Y1NA 3BITA 1YVMA 4U76A 2BHDA 3BIPA 2EVMA 2GG8A 1QXZA 2GG2A 1KQ9A 2GU4A 4FO8A 4U6WA 4PV4A 4S2RP 2Q8KA 1QXYA 1C23A 4U69A 1BN5A 3TAVA 1B6AA 3PKDA 4ZWUA 3PKCA 4IDYA 4RZZA 4U6CA 1BOAA 1C22A 1XGSA 1XGNA 1MATA 4IKSA 4FLIA 1WBQA 5CIKA 5D6FA 5JFRA 2BWSA 1WLRA 2NQ6A 2MATA 1R5GA 1R58A 2OAZA 4U75A 2DFIA 3IU7A 2V3YA 2Q94A 1B59A 4MATA 1WL6A 5E5BA 2GTXA 4U6JA 2BWUA 3MATA 2GG3A 4Z7MA 3PEBA 2GA2A 3PKBA 2B3KA 4U71A 3IG4A 2P99A 2V3XA 4RZYA 5JHUA 2B3LA 4ZWPA 4U6ZA 1XNZA 2GG7A 1R5HA 2GZ5A 2P9AA 5CLSA 3PKEA 4IPAA 4S01A 2OKNA 5CDVA 4JUQA 2B3HA 1XGMA 2BB7A 3OVKA 4S00A 1KQ0A 3MR1A 4U70A 2P98A 1O0XA 5CDEA 5CE6A 4A6VA 1W7VA 2BWYA 3RVAA 3QOCA 3BIQA 4ZNGA 2Q92A 4QR8A 4PNCA 3PKAA 3Q6DA 4FLJA 4U1BA 3I7MA 5D6EA 1KP0A 3CTZA 1M35A 2HOWA 1CHMA 1C27A 2GGBA 2GU5A 4FUKA 4IU6A 3IU9A 3IL0A 4R60A 5CDLA 2GG5A 4IF7A 2V6CA 2IW2A 3L7GA 1N51A 2BWVA 4FO7A 5JI6A 2BH3A 4ZWOA 3PN9A 1W2MA 3TB5A 4IECA 1YW7A 4U73A 2Q96A 4HXXA 5CNXA 2BHBA 2BWTA 4B28A 2V3ZA 1YW8A 2GU7A 2Q93A 4IKUA 2EA2A 1WY2A 1WL9A 4S2TP 1C21A 3S6BA 4A6WA 4FLLA 4OOKA 3RORA 3OOOA 2Q95A 1XGOA 2GG0A 4U6EA 4FKCA 2NQ7A 2G6PA 2EVOA 4FLKA 3CB5A 1C24A 2BN7A 1WKMA 1YJ3A 1QXWA 1WN1A 3MX6A 2BHAA 1PV9A 2BWWA 2GG9A 4IKTA 4IKRA 3FM3A 2GU6A 4EGEA 5FCFA 3FMRA
chains in the Genus database with same CATH topology
5E2CA 3O5VA 5FCHA 2EA4A 3FMQA 1A16A 3CB6A 2GGCA 1QZYA 3IU8A 4KM3A 2BHCA 2BWXA 3D27A 2ZSGA 1YW9A 2ADUA 1JAWA 3L24A 4RGZ1 2EVCA 1Y1NA 3BITA 1YVMA 4U76A 2BHDA 3BIPA 2EVMA 2GG8A 1QXZA 2GG2A 1KQ9A 2GU4A 4FO8A 4U6WA 4PV4A 4S2RP 2Q8KA 1QXYA 1C23A 4U69A 1BN5A 3TAVA 1B6AA 3PKDA 4ZWUA 3PKCA 4IDYA 4RZZA 4U6CA 1BOAA 1C22A 1XGSA 1XGNA 1MATA 4IKSA 4FLIA 1WBQA 5CIKA 5D6FA 5JFRA 2BWSA 1WLRA 2NQ6A 2MATA 1R5GA 1R58A 2OAZA 4U75A 2DFIA 3IU7A 2V3YA 2Q94A 1B59A 4MATA 1WL6A 5E5BA 2GTXA 4U6JA 2BWUA 3MATA 2GG3A 4Z7MA 3PEBA 2GA2A 3PKBA 2B3KA 4U71A 3IG4A 2P99A 2V3XA 4RZYA 5JHUA 2B3LA 4ZWPA 4U6ZA 1XNZA 2GG7A 1R5HA 2GZ5A 2P9AA 5CLSA 3PKEA 4IPAA 4S01A 2OKNA 5CDVA 4JUQA 2B3HA 1XGMA 2BB7A 3OVKA 4S00A 1KQ0A 3MR1A 4U70A 2P98A 1O0XA 5CDEA 5CE6A 4A6VA 1W7VA 2BWYA 3RVAA 3QOCA 3BIQA 4ZNGA 2Q92A 4QR8A 4PNCA 3PKAA 3Q6DA 4FLJA 4U1BA 3I7MA 5D6EA 1KP0A 3CTZA 1M35A 2HOWA 1CHMA 1C27A 2GGBA 2GU5A 4FUKA 4IU6A 3IU9A 3IL0A 4R60A 5CDLA 2GG5A 4IF7A 2V6CA 2IW2A 3L7GA 1N51A 2BWVA 4FO7A 5JI6A 2BH3A 4ZWOA 3PN9A 1W2MA 3TB5A 4IECA 1YW7A 4U73A 2Q96A 4HXXA 5CNXA 2BHBA 2BWTA 4B28A 2V3ZA 1YW8A 2GU7A 2Q93A 4IKUA 2EA2A 1WY2A 1WL9A 4S2TP 1C21A 3S6BA 4A6WA 4FLLA 4OOKA 3RORA 3OOOA 2Q95A 1XGOA 2GG0A 4U6EA 4FKCA 2NQ7A 2G6PA 2EVOA 4FLKA 3CB5A 1C24A 2BN7A 1WKMA 1YJ3A 1QXWA 1WN1A 3MX6A 2BHAA 1PV9A 2BWWA 2GG9A 4IKTA 4IKRA 3FM3A 2GU6A 4EGEA 5FCFA 3FMRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E2C A;  3O5V A;  5FCH A;  2EA4 A;  3FMQ A;  1A16 A;  3CB6 A;  2GGC A;  1QZY A;  3IU8 A;  4KM3 A;  2BHC A;  2BWX A;  3D27 A;  2ZSG A;  1YW9 A;  2ADU A;  1JAW A;  3L24 A;  4RGZ 1;  2EVC A;  1Y1N A;  3BIT A;  1YVM A;  4U76 A;  2BHD A;  3BIP A;  2EVM A;  2GG8 A;  1QXZ A;  2GG2 A;  1KQ9 A;  2GU4 A;  4FO8 A;  4U6W A;  4PV4 A;  4S2R P;  2Q8K A;  1QXY A;  1C23 A;  4U69 A;  1BN5 A;  3TAV A;  1B6A A;  3PKD A;  4ZWU A;  3PKC A;  4IDY A;  4RZZ A;  4U6C A;  1BOA A;  1C22 A;  1XGS A;  1XGN A;  1MAT A;  4IKS A;  4FLI A;  1WBQ A;  5CIK A;  5D6F A;  5JFR A;  2BWS A;  1WLR A;  2NQ6 A;  2MAT A;  1R5G A;  1R58 A;  2OAZ A;  4U75 A;  2DFI A;  3IU7 A;  2V3Y A;  2Q94 A;  1B59 A;  4MAT A;  1WL6 A;  5E5B A;  2GTX A;  4U6J A;  2BWU A;  3MAT A;  2GG3 A;  4Z7M A;  3PEB A;  2GA2 A;  3PKB A;  2B3K A;  4U71 A;  3IG4 A;  2P99 A;  2V3X A;  4RZY A;  5JHU A;  2B3L A;  4ZWP A;  4U6Z A;  1XNZ A;  2GG7 A;  1R5H A;  2GZ5 A;  2P9A A;  5CLS A;  3PKE A;  4IPA A;  4S01 A;  2OKN A;  5CDV A;  4JUQ A;  2B3H A;  1XGM A;  2BB7 A;  3OVK A;  4S00 A;  1KQ0 A;  3MR1 A;  4U70 A;  2P98 A;  1O0X A;  5CDE A;  5CE6 A;  4A6V A;  1W7V A;  2BWY A;  3RVA A;  3QOC A;  3BIQ A;  4ZNG A;  2Q92 A;  4QR8 A;  4PNC A;  3PKA A;  3Q6D A;  4FLJ A;  4U1B A;  3I7M A;  5D6E A;  1KP0 A;  3CTZ A;  1M35 A;  2HOW A;  1CHM A;  1C27 A;  2GGB A;  2GU5 A;  4FUK A;  4IU6 A;  3IU9 A;  3IL0 A;  4R60 A;  5CDL A;  2GG5 A;  4IF7 A;  2V6C A;  2IW2 A;  3L7G A;  1N51 A;  2BWV A;  4FO7 A;  5JI6 A;  2BH3 A;  4ZWO A;  3PN9 A;  1W2M A;  3TB5 A;  4IEC A;  1YW7 A;  4U73 A;  2Q96 A;  4HXX A;  5CNX A;  2BHB A;  2BWT A;  4B28 A;  2V3Z A;  1YW8 A;  2GU7 A;  2Q93 A;  4IKU A;  2EA2 A;  1WY2 A;  1WL9 A;  4S2T P;  1C21 A;  3S6B A;  4A6W A;  4FLL A;  4OOK A;  3ROR A;  3OOO A;  2Q95 A;  1XGO A;  2GG0 A;  4U6E A;  4FKC A;  2NQ7 A;  2G6P A;  2EVO A;  4FLK A;  3CB5 A;  1C24 A;  2BN7 A;  1WKM A;  1YJ3 A;  1QXW A;  1WN1 A;  3MX6 A;  2BHA A;  1PV9 A;  2BWW A;  2GG9 A;  4IKT A;  4IKR A;  3FM3 A;  2GU6 A;  4EGE A;  5FCF A;  3FMR A; 
#chains in the Genus database with same CATH topology
 5E2C A;  3O5V A;  5FCH A;  2EA4 A;  3FMQ A;  1A16 A;  3CB6 A;  2GGC A;  1QZY A;  3IU8 A;  4KM3 A;  2BHC A;  2BWX A;  3D27 A;  2ZSG A;  1YW9 A;  2ADU A;  1JAW A;  3L24 A;  4RGZ 1;  2EVC A;  1Y1N A;  3BIT A;  1YVM A;  4U76 A;  2BHD A;  3BIP A;  2EVM A;  2GG8 A;  1QXZ A;  2GG2 A;  1KQ9 A;  2GU4 A;  4FO8 A;  4U6W A;  4PV4 A;  4S2R P;  2Q8K A;  1QXY A;  1C23 A;  4U69 A;  1BN5 A;  3TAV A;  1B6A A;  3PKD A;  4ZWU A;  3PKC A;  4IDY A;  4RZZ A;  4U6C A;  1BOA A;  1C22 A;  1XGS A;  1XGN A;  1MAT A;  4IKS A;  4FLI A;  1WBQ A;  5CIK A;  5D6F A;  5JFR A;  2BWS A;  1WLR A;  2NQ6 A;  2MAT A;  1R5G A;  1R58 A;  2OAZ A;  4U75 A;  2DFI A;  3IU7 A;  2V3Y A;  2Q94 A;  1B59 A;  4MAT A;  1WL6 A;  5E5B A;  2GTX A;  4U6J A;  2BWU A;  3MAT A;  2GG3 A;  4Z7M A;  3PEB A;  2GA2 A;  3PKB A;  2B3K A;  4U71 A;  3IG4 A;  2P99 A;  2V3X A;  4RZY A;  5JHU A;  2B3L A;  4ZWP A;  4U6Z A;  1XNZ A;  2GG7 A;  1R5H A;  2GZ5 A;  2P9A A;  5CLS A;  3PKE A;  4IPA A;  4S01 A;  2OKN A;  5CDV A;  4JUQ A;  2B3H A;  1XGM A;  2BB7 A;  3OVK A;  4S00 A;  1KQ0 A;  3MR1 A;  4U70 A;  2P98 A;  1O0X A;  5CDE A;  5CE6 A;  4A6V A;  1W7V A;  2BWY A;  3RVA A;  3QOC A;  3BIQ A;  4ZNG A;  2Q92 A;  4QR8 A;  4PNC A;  3PKA A;  3Q6D A;  4FLJ A;  4U1B A;  3I7M A;  5D6E A;  1KP0 A;  3CTZ A;  1M35 A;  2HOW A;  1CHM A;  1C27 A;  2GGB A;  2GU5 A;  4FUK A;  4IU6 A;  3IU9 A;  3IL0 A;  4R60 A;  5CDL A;  2GG5 A;  4IF7 A;  2V6C A;  2IW2 A;  3L7G A;  1N51 A;  2BWV A;  4FO7 A;  5JI6 A;  2BH3 A;  4ZWO A;  3PN9 A;  1W2M A;  3TB5 A;  4IEC A;  1YW7 A;  4U73 A;  2Q96 A;  4HXX A;  5CNX A;  2BHB A;  2BWT A;  4B28 A;  2V3Z A;  1YW8 A;  2GU7 A;  2Q93 A;  4IKU A;  2EA2 A;  1WY2 A;  1WL9 A;  4S2T P;  1C21 A;  3S6B A;  4A6W A;  4FLL A;  4OOK A;  3ROR A;  3OOO A;  2Q95 A;  1XGO A;  2GG0 A;  4U6E A;  4FKC A;  2NQ7 A;  2G6P A;  2EVO A;  4FLK A;  3CB5 A;  1C24 A;  2BN7 A;  1WKM A;  1YJ3 A;  1QXW A;  1WN1 A;  3MX6 A;  2BHA A;  1PV9 A;  2BWW A;  2GG9 A;  4IKT A;  4IKR A;  3FM3 A;  2GU6 A;  4EGE A;  5FCF A;  3FMR A; 
#chains in the Genus database with same CATH homology
 5E2C A;  3O5V A;  5FCH A;  2EA4 A;  3FMQ A;  1A16 A;  3CB6 A;  2GGC A;  1QZY A;  3IU8 A;  4KM3 A;  2BHC A;  2BWX A;  3D27 A;  2ZSG A;  1YW9 A;  2ADU A;  1JAW A;  3L24 A;  4RGZ 1;  2EVC A;  1Y1N A;  3BIT A;  1YVM A;  4U76 A;  2BHD A;  3BIP A;  2EVM A;  2GG8 A;  1QXZ A;  2GG2 A;  1KQ9 A;  2GU4 A;  4FO8 A;  4U6W A;  4PV4 A;  4S2R P;  2Q8K A;  1QXY A;  1C23 A;  4U69 A;  1BN5 A;  3TAV A;  1B6A A;  3PKD A;  4ZWU A;  3PKC A;  4IDY A;  4RZZ A;  4U6C A;  1BOA A;  1C22 A;  1XGS A;  1XGN A;  1MAT A;  4IKS A;  4FLI A;  1WBQ A;  5CIK A;  5D6F A;  5JFR A;  2BWS A;  1WLR A;  2NQ6 A;  2MAT A;  1R5G A;  1R58 A;  2OAZ A;  4U75 A;  2DFI A;  3IU7 A;  2V3Y A;  2Q94 A;  1B59 A;  4MAT A;  1WL6 A;  5E5B A;  2GTX A;  4U6J A;  2BWU A;  3MAT A;  2GG3 A;  4Z7M A;  3PEB A;  2GA2 A;  3PKB A;  2B3K A;  4U71 A;  3IG4 A;  2P99 A;  2V3X A;  4RZY A;  5JHU A;  2B3L A;  4ZWP A;  4U6Z A;  1XNZ A;  2GG7 A;  1R5H A;  2GZ5 A;  2P9A A;  5CLS A;  3PKE A;  4IPA A;  4S01 A;  2OKN A;  5CDV A;  4JUQ A;  2B3H A;  1XGM A;  2BB7 A;  3OVK A;  4S00 A;  1KQ0 A;  3MR1 A;  4U70 A;  2P98 A;  1O0X A;  5CDE A;  5CE6 A;  4A6V A;  1W7V A;  2BWY A;  3RVA A;  3QOC A;  3BIQ A;  4ZNG A;  2Q92 A;  4QR8 A;  4PNC A;  3PKA A;  3Q6D A;  4FLJ A;  4U1B A;  3I7M A;  5D6E A;  1KP0 A;  3CTZ A;  1M35 A;  2HOW A;  1CHM A;  1C27 A;  2GGB A;  2GU5 A;  4FUK A;  4IU6 A;  3IU9 A;  3IL0 A;  4R60 A;  5CDL A;  2GG5 A;  4IF7 A;  2V6C A;  2IW2 A;  3L7G A;  1N51 A;  2BWV A;  4FO7 A;  5JI6 A;  2BH3 A;  4ZWO A;  3PN9 A;  1W2M A;  3TB5 A;  4IEC A;  1YW7 A;  4U73 A;  2Q96 A;  4HXX A;  5CNX A;  2BHB A;  2BWT A;  4B28 A;  2V3Z A;  1YW8 A;  2GU7 A;  2Q93 A;  4IKU A;  2EA2 A;  1WY2 A;  1WL9 A;  4S2T P;  1C21 A;  3S6B A;  4A6W A;  4FLL A;  4OOK A;  3ROR A;  3OOO A;  2Q95 A;  1XGO A;  2GG0 A;  4U6E A;  4FKC A;  2NQ7 A;  2G6P A;  2EVO A;  4FLK A;  3CB5 A;  1C24 A;  2BN7 A;  1WKM A;  1YJ3 A;  1QXW A;  1WN1 A;  3MX6 A;  2BHA A;  1PV9 A;  2BWW A;  2GG9 A;  4IKT A;  4IKR A;  3FM3 A;  2GU6 A;  4EGE A;  5FCF A;  3FMR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...