2BWVA

His361ala escherichia coli aminopeptidase p
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVADVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 157
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwvA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwvA02
4A6WA 5D6EA 2P98A 1KQ9A 1N51A 4U6CA 5CNXA 2GU6A 5JI6A 2V3YA 4RGZ1 5E5BA 5CE6A 1WKMA 2GG5A 4FLKA 2GU5A 2Q95A 4U70A 2BWXA 4IECA 2GG3A 2V6CA 4Z7MA 5CDVA 4FO7A 5CDLA 2BB7A 4RZYA 1C22A 3IL0A 3PKDA 3IU8A 5E2CA 2GG2A 3FM3A 2GU4A 4U6ZA 4IKUA 3O5VA 2P9AA 5CLSA 1KP0A 4S00A 2GG9A 2GTXA 3PKBA 3BIPA 2GA2A 1O0XA 2Q92A 2IW2A 3RVAA 2GG8A 2BHAA 3BIQA 4ZWOA 1WBQA 1B59A 2BH3A 1R58A 2ADUA 4U76A 4KM3A 3QOCA 3CTZA 4U6EA 3PN9A 5JFRA 4ZNGA 4FO8A 3PEBA 4IDYA 1XNZA 2GG0A 1M35A 4IKTA 4A6VA 4FLLA 4IPAA 3L24A 3FMQA 3PKEA 3TAVA 4U6JA 3I7MA 1MATA 3IU9A 4EGEA 3CB5A 4PV4A 4U73A 3MR1A 4IF7A 2BHBA 2GU7A 2BN7A 4S2RP 2Q8KA 2EVOA 2GZ5A 3PKAA 4U69A 2P99A 1XGSA 1XGOA 3CB6A 1YW7A 3S6BA 4FKCA 1B6AA 2EVMA 2BWTA 1QZYA 1WY2A 3PKCA 4PNCA 1WLRA 2BWWA 1W2MA 4U75A 3TB5A 4RZZA 2GG7A 2BWYA 4QR8A 4U1BA 4ZWPA 2BWSA 3OVKA 4FUKA 4R60A 2NQ6A 1YJ3A 4FLIA 3RORA 1PV9A 1WL6A 1JAWA 5CDEA 1R5HA 4S01A 2GGCA 2MATA 3IG4A 1BN5A 1R5GA 2NQ7A 1XGNA 2EA4A 4IKRA 1CHMA 1W7VA 4S2TP 2ZSGA 2EVCA 4IU6A 2B3KA 1A16A 1C21A 1Y1NA 2B3LA 2BWUA 5D6FA 1WL9A 1QXWA 3L7GA 1QXZA 2HOWA 1XGMA 1YW9A 2BHCA 2Q93A 1C24A 1C23A 2V3XA 2DFIA 2V3ZA 5FCFA 4B28A 2OAZA 1BOAA 3MATA 4JUQA 2EA2A 2GGBA 4U6WA 1YW8A 3IU7A 3D27A 3MX6A 2G6PA 4MATA 2BWVA 1C27A 3FMRA 2BHDA 2B3HA 3Q6DA 2OKNA 5JHUA 1WN1A 5CIKA 4ZWUA 4OOKA 4U71A 2Q94A 2Q96A 4IKSA 1QXYA 4HXXA 5FCHA 1KQ0A 1YVMA 3OOOA 3BITA 4FLJA
chains in the Genus database with same CATH superfamily
4A6WA 5D6EA 2P98A 1KQ9A 1N51A 4U6CA 5CNXA 2GU6A 5JI6A 2V3YA 4RGZ1 5E5BA 5CE6A 1WKMA 2GG5A 4FLKA 2GU5A 2Q95A 4U70A 2BWXA 4IECA 2GG3A 2V6CA 4Z7MA 5CDVA 4FO7A 5CDLA 2BB7A 4RZYA 1C22A 3IL0A 3PKDA 3IU8A 5E2CA 2GG2A 3FM3A 2GU4A 4U6ZA 4IKUA 3O5VA 2P9AA 5CLSA 1KP0A 4S00A 2GG9A 2GTXA 3PKBA 3BIPA 2GA2A 1O0XA 2Q92A 2IW2A 3RVAA 2GG8A 2BHAA 3BIQA 4ZWOA 1WBQA 1B59A 2BH3A 1R58A 2ADUA 4U76A 4KM3A 3QOCA 3CTZA 4U6EA 3PN9A 5JFRA 4ZNGA 4FO8A 3PEBA 4IDYA 1XNZA 2GG0A 1M35A 4IKTA 4A6VA 4FLLA 4IPAA 3L24A 3FMQA 3PKEA 3TAVA 4U6JA 3I7MA 1MATA 3IU9A 4EGEA 3CB5A 4PV4A 4U73A 3MR1A 4IF7A 2BHBA 2GU7A 2BN7A 4S2RP 2Q8KA 2EVOA 2GZ5A 3PKAA 4U69A 2P99A 1XGSA 1XGOA 3CB6A 1YW7A 3S6BA 4FKCA 1B6AA 2EVMA 2BWTA 1QZYA 1WY2A 3PKCA 4PNCA 1WLRA 2BWWA 1W2MA 4U75A 3TB5A 4RZZA 2GG7A 2BWYA 4QR8A 4U1BA 4ZWPA 2BWSA 3OVKA 4FUKA 4R60A 2NQ6A 1YJ3A 4FLIA 3RORA 1PV9A 1WL6A 1JAWA 5CDEA 1R5HA 4S01A 2GGCA 2MATA 3IG4A 1BN5A 1R5GA 2NQ7A 1XGNA 2EA4A 4IKRA 1CHMA 1W7VA 4S2TP 2ZSGA 2EVCA 4IU6A 2B3KA 1A16A 1C21A 1Y1NA 2B3LA 2BWUA 5D6FA 1WL9A 1QXWA 3L7GA 1QXZA 2HOWA 1XGMA 1YW9A 2BHCA 2Q93A 1C24A 1C23A 2V3XA 2DFIA 2V3ZA 5FCFA 4B28A 2OAZA 1BOAA 3MATA 4JUQA 2EA2A 2GGBA 4U6WA 1YW8A 3IU7A 3D27A 3MX6A 2G6PA 4MATA 2BWVA 1C27A 3FMRA 2BHDA 2B3HA 3Q6DA 2OKNA 5JHUA 1WN1A 5CIKA 4ZWUA 4OOKA 4U71A 2Q94A 2Q96A 4IKSA 1QXYA 4HXXA 5FCHA 1KQ0A 1YVMA 3OOOA 3BITA 4FLJA
chains in the Genus database with same CATH topology
4A6WA 5D6EA 2P98A 1KQ9A 1N51A 4U6CA 5CNXA 2GU6A 5JI6A 2V3YA 4RGZ1 5E5BA 5CE6A 1WKMA 2GG5A 4FLKA 2GU5A 2Q95A 4U70A 2BWXA 4IECA 2GG3A 2V6CA 4Z7MA 5CDVA 4FO7A 5CDLA 2BB7A 4RZYA 1C22A 3IL0A 3PKDA 3IU8A 5E2CA 2GG2A 3FM3A 2GU4A 4U6ZA 4IKUA 3O5VA 2P9AA 5CLSA 1KP0A 4S00A 2GG9A 2GTXA 3PKBA 3BIPA 2GA2A 1O0XA 2Q92A 2IW2A 3RVAA 2GG8A 2BHAA 3BIQA 4ZWOA 1WBQA 1B59A 2BH3A 1R58A 2ADUA 4U76A 4KM3A 3QOCA 3CTZA 4U6EA 3PN9A 5JFRA 4ZNGA 4FO8A 3PEBA 4IDYA 1XNZA 2GG0A 1M35A 4IKTA 4A6VA 4FLLA 4IPAA 3L24A 3FMQA 3PKEA 3TAVA 4U6JA 3I7MA 1MATA 3IU9A 4EGEA 3CB5A 4PV4A 4U73A 3MR1A 4IF7A 2BHBA 2GU7A 2BN7A 4S2RP 2Q8KA 2EVOA 2GZ5A 3PKAA 4U69A 2P99A 1XGSA 1XGOA 3CB6A 1YW7A 3S6BA 4FKCA 1B6AA 2EVMA 2BWTA 1QZYA 1WY2A 3PKCA 4PNCA 1WLRA 2BWWA 1W2MA 4U75A 3TB5A 4RZZA 2GG7A 2BWYA 4QR8A 4U1BA 4ZWPA 2BWSA 3OVKA 4FUKA 4R60A 2NQ6A 1YJ3A 4FLIA 3RORA 1PV9A 1WL6A 1JAWA 5CDEA 1R5HA 4S01A 2GGCA 2MATA 3IG4A 1BN5A 1R5GA 2NQ7A 1XGNA 2EA4A 4IKRA 1CHMA 1W7VA 4S2TP 2ZSGA 2EVCA 4IU6A 2B3KA 1A16A 1C21A 1Y1NA 2B3LA 2BWUA 5D6FA 1WL9A 1QXWA 3L7GA 1QXZA 2HOWA 1XGMA 1YW9A 2BHCA 2Q93A 1C24A 1C23A 2V3XA 2DFIA 2V3ZA 5FCFA 4B28A 2OAZA 1BOAA 3MATA 4JUQA 2EA2A 2GGBA 4U6WA 1YW8A 3IU7A 3D27A 3MX6A 2G6PA 4MATA 2BWVA 1C27A 3FMRA 2BHDA 2B3HA 3Q6DA 2OKNA 5JHUA 1WN1A 5CIKA 4ZWUA 4OOKA 4U71A 2Q94A 2Q96A 4IKSA 1QXYA 4HXXA 5FCHA 1KQ0A 1YVMA 3OOOA 3BITA 4FLJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A6W A;  5D6E A;  2P98 A;  1KQ9 A;  1N51 A;  4U6C A;  5CNX A;  2GU6 A;  5JI6 A;  2V3Y A;  4RGZ 1;  5E5B A;  5CE6 A;  1WKM A;  2GG5 A;  4FLK A;  2GU5 A;  2Q95 A;  4U70 A;  2BWX A;  4IEC A;  2GG3 A;  2V6C A;  4Z7M A;  5CDV A;  4FO7 A;  5CDL A;  2BB7 A;  4RZY A;  1C22 A;  3IL0 A;  3PKD A;  3IU8 A;  5E2C A;  2GG2 A;  3FM3 A;  2GU4 A;  4U6Z A;  4IKU A;  3O5V A;  2P9A A;  5CLS A;  1KP0 A;  4S00 A;  2GG9 A;  2GTX A;  3PKB A;  3BIP A;  2GA2 A;  1O0X A;  2Q92 A;  2IW2 A;  3RVA A;  2GG8 A;  2BHA A;  3BIQ A;  4ZWO A;  1WBQ A;  1B59 A;  2BH3 A;  1R58 A;  2ADU A;  4U76 A;  4KM3 A;  3QOC A;  3CTZ A;  4U6E A;  3PN9 A;  5JFR A;  4ZNG A;  4FO8 A;  3PEB A;  4IDY A;  1XNZ A;  2GG0 A;  1M35 A;  4IKT A;  4A6V A;  4FLL A;  4IPA A;  3L24 A;  3FMQ A;  3PKE A;  3TAV A;  4U6J A;  3I7M A;  1MAT A;  3IU9 A;  4EGE A;  3CB5 A;  4PV4 A;  4U73 A;  3MR1 A;  4IF7 A;  2BHB A;  2GU7 A;  2BN7 A;  4S2R P;  2Q8K A;  2EVO A;  2GZ5 A;  3PKA A;  4U69 A;  2P99 A;  1XGS A;  1XGO A;  3CB6 A;  1YW7 A;  3S6B A;  4FKC A;  1B6A A;  2EVM A;  2BWT A;  1QZY A;  1WY2 A;  3PKC A;  4PNC A;  1WLR A;  2BWW A;  1W2M A;  4U75 A;  3TB5 A;  4RZZ A;  2GG7 A;  2BWY A;  4QR8 A;  4U1B A;  4ZWP A;  2BWS A;  3OVK A;  4FUK A;  4R60 A;  2NQ6 A;  1YJ3 A;  4FLI A;  3ROR A;  1PV9 A;  1WL6 A;  1JAW A;  5CDE A;  1R5H A;  4S01 A;  2GGC A;  2MAT A;  3IG4 A;  1BN5 A;  1R5G A;  2NQ7 A;  1XGN A;  2EA4 A;  4IKR A;  1CHM A;  1W7V A;  4S2T P;  2ZSG A;  2EVC A;  4IU6 A;  2B3K A;  1A16 A;  1C21 A;  1Y1N A;  2B3L A;  2BWU A;  5D6F A;  1WL9 A;  1QXW A;  3L7G A;  1QXZ A;  2HOW A;  1XGM A;  1YW9 A;  2BHC A;  2Q93 A;  1C24 A;  1C23 A;  2V3X A;  2DFI A;  2V3Z A;  5FCF A;  4B28 A;  2OAZ A;  1BOA A;  3MAT A;  4JUQ A;  2EA2 A;  2GGB A;  4U6W A;  1YW8 A;  3IU7 A;  3D27 A;  3MX6 A;  2G6P A;  4MAT A;  2BWV A;  1C27 A;  3FMR A;  2BHD A;  2B3H A;  3Q6D A;  2OKN A;  5JHU A;  1WN1 A;  5CIK A;  4ZWU A;  4OOK A;  4U71 A;  2Q94 A;  2Q96 A;  4IKS A;  1QXY A;  4HXX A;  5FCH A;  1KQ0 A;  1YVM A;  3OOO A;  3BIT A;  4FLJ A; 
#chains in the Genus database with same CATH topology
 4A6W A;  5D6E A;  2P98 A;  1KQ9 A;  1N51 A;  4U6C A;  5CNX A;  2GU6 A;  5JI6 A;  2V3Y A;  4RGZ 1;  5E5B A;  5CE6 A;  1WKM A;  2GG5 A;  4FLK A;  2GU5 A;  2Q95 A;  4U70 A;  2BWX A;  4IEC A;  2GG3 A;  2V6C A;  4Z7M A;  5CDV A;  4FO7 A;  5CDL A;  2BB7 A;  4RZY A;  1C22 A;  3IL0 A;  3PKD A;  3IU8 A;  5E2C A;  2GG2 A;  3FM3 A;  2GU4 A;  4U6Z A;  4IKU A;  3O5V A;  2P9A A;  5CLS A;  1KP0 A;  4S00 A;  2GG9 A;  2GTX A;  3PKB A;  3BIP A;  2GA2 A;  1O0X A;  2Q92 A;  2IW2 A;  3RVA A;  2GG8 A;  2BHA A;  3BIQ A;  4ZWO A;  1WBQ A;  1B59 A;  2BH3 A;  1R58 A;  2ADU A;  4U76 A;  4KM3 A;  3QOC A;  3CTZ A;  4U6E A;  3PN9 A;  5JFR A;  4ZNG A;  4FO8 A;  3PEB A;  4IDY A;  1XNZ A;  2GG0 A;  1M35 A;  4IKT A;  4A6V A;  4FLL A;  4IPA A;  3L24 A;  3FMQ A;  3PKE A;  3TAV A;  4U6J A;  3I7M A;  1MAT A;  3IU9 A;  4EGE A;  3CB5 A;  4PV4 A;  4U73 A;  3MR1 A;  4IF7 A;  2BHB A;  2GU7 A;  2BN7 A;  4S2R P;  2Q8K A;  2EVO A;  2GZ5 A;  3PKA A;  4U69 A;  2P99 A;  1XGS A;  1XGO A;  3CB6 A;  1YW7 A;  3S6B A;  4FKC A;  1B6A A;  2EVM A;  2BWT A;  1QZY A;  1WY2 A;  3PKC A;  4PNC A;  1WLR A;  2BWW A;  1W2M A;  4U75 A;  3TB5 A;  4RZZ A;  2GG7 A;  2BWY A;  4QR8 A;  4U1B A;  4ZWP A;  2BWS A;  3OVK A;  4FUK A;  4R60 A;  2NQ6 A;  1YJ3 A;  4FLI A;  3ROR A;  1PV9 A;  1WL6 A;  1JAW A;  5CDE A;  1R5H A;  4S01 A;  2GGC A;  2MAT A;  3IG4 A;  1BN5 A;  1R5G A;  2NQ7 A;  1XGN A;  2EA4 A;  4IKR A;  1CHM A;  1W7V A;  4S2T P;  2ZSG A;  2EVC A;  4IU6 A;  2B3K A;  1A16 A;  1C21 A;  1Y1N A;  2B3L A;  2BWU A;  5D6F A;  1WL9 A;  1QXW A;  3L7G A;  1QXZ A;  2HOW A;  1XGM A;  1YW9 A;  2BHC A;  2Q93 A;  1C24 A;  1C23 A;  2V3X A;  2DFI A;  2V3Z A;  5FCF A;  4B28 A;  2OAZ A;  1BOA A;  3MAT A;  4JUQ A;  2EA2 A;  2GGB A;  4U6W A;  1YW8 A;  3IU7 A;  3D27 A;  3MX6 A;  2G6P A;  4MAT A;  2BWV A;  1C27 A;  3FMR A;  2BHD A;  2B3H A;  3Q6D A;  2OKN A;  5JHU A;  1WN1 A;  5CIK A;  4ZWU A;  4OOK A;  4U71 A;  2Q94 A;  2Q96 A;  4IKS A;  1QXY A;  4HXX A;  5FCH A;  1KQ0 A;  1YVM A;  3OOO A;  3BIT A;  4FLJ A; 
#chains in the Genus database with same CATH homology
 4A6W A;  5D6E A;  2P98 A;  1KQ9 A;  1N51 A;  4U6C A;  5CNX A;  2GU6 A;  5JI6 A;  2V3Y A;  4RGZ 1;  5E5B A;  5CE6 A;  1WKM A;  2GG5 A;  4FLK A;  2GU5 A;  2Q95 A;  4U70 A;  2BWX A;  4IEC A;  2GG3 A;  2V6C A;  4Z7M A;  5CDV A;  4FO7 A;  5CDL A;  2BB7 A;  4RZY A;  1C22 A;  3IL0 A;  3PKD A;  3IU8 A;  5E2C A;  2GG2 A;  3FM3 A;  2GU4 A;  4U6Z A;  4IKU A;  3O5V A;  2P9A A;  5CLS A;  1KP0 A;  4S00 A;  2GG9 A;  2GTX A;  3PKB A;  3BIP A;  2GA2 A;  1O0X A;  2Q92 A;  2IW2 A;  3RVA A;  2GG8 A;  2BHA A;  3BIQ A;  4ZWO A;  1WBQ A;  1B59 A;  2BH3 A;  1R58 A;  2ADU A;  4U76 A;  4KM3 A;  3QOC A;  3CTZ A;  4U6E A;  3PN9 A;  5JFR A;  4ZNG A;  4FO8 A;  3PEB A;  4IDY A;  1XNZ A;  2GG0 A;  1M35 A;  4IKT A;  4A6V A;  4FLL A;  4IPA A;  3L24 A;  3FMQ A;  3PKE A;  3TAV A;  4U6J A;  3I7M A;  1MAT A;  3IU9 A;  4EGE A;  3CB5 A;  4PV4 A;  4U73 A;  3MR1 A;  4IF7 A;  2BHB A;  2GU7 A;  2BN7 A;  4S2R P;  2Q8K A;  2EVO A;  2GZ5 A;  3PKA A;  4U69 A;  2P99 A;  1XGS A;  1XGO A;  3CB6 A;  1YW7 A;  3S6B A;  4FKC A;  1B6A A;  2EVM A;  2BWT A;  1QZY A;  1WY2 A;  3PKC A;  4PNC A;  1WLR A;  2BWW A;  1W2M A;  4U75 A;  3TB5 A;  4RZZ A;  2GG7 A;  2BWY A;  4QR8 A;  4U1B A;  4ZWP A;  2BWS A;  3OVK A;  4FUK A;  4R60 A;  2NQ6 A;  1YJ3 A;  4FLI A;  3ROR A;  1PV9 A;  1WL6 A;  1JAW A;  5CDE A;  1R5H A;  4S01 A;  2GGC A;  2MAT A;  3IG4 A;  1BN5 A;  1R5G A;  2NQ7 A;  1XGN A;  2EA4 A;  4IKR A;  1CHM A;  1W7V A;  4S2T P;  2ZSG A;  2EVC A;  4IU6 A;  2B3K A;  1A16 A;  1C21 A;  1Y1N A;  2B3L A;  2BWU A;  5D6F A;  1WL9 A;  1QXW A;  3L7G A;  1QXZ A;  2HOW A;  1XGM A;  1YW9 A;  2BHC A;  2Q93 A;  1C24 A;  1C23 A;  2V3X A;  2DFI A;  2V3Z A;  5FCF A;  4B28 A;  2OAZ A;  1BOA A;  3MAT A;  4JUQ A;  2EA2 A;  2GGB A;  4U6W A;  1YW8 A;  3IU7 A;  3D27 A;  3MX6 A;  2G6P A;  4MAT A;  2BWV A;  1C27 A;  3FMR A;  2BHD A;  2B3H A;  3Q6D A;  2OKN A;  5JHU A;  1WN1 A;  5CIK A;  4ZWU A;  4OOK A;  4U71 A;  2Q94 A;  2Q96 A;  4IKS A;  1QXY A;  4HXX A;  5FCH A;  1KQ0 A;  1YVM A;  3OOO A;  3BIT A;  4FLJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...