2BWVA

His361ala escherichia coli aminopeptidase p
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
440
structure length
439
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVADVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 157
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwvA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwvA02
2ADUA 3MX6A 2BWWA 4PV4A 4U71A 1YJ3A 4QR8A 1C21A 4FO8A 2GG3A 4U69A 2OAZA 4IECA 2IW2A 1R5GA 2P9AA 3FM3A 4PNCA 3RORA 3OVKA 5CNXA 2P98A 2BHCA 3PKCA 3TAVA 1CHMA 1QXZA 4IKTA 2BWUA 3IG4A 2BHAA 1B6AA 2GU7A 4U76A 1Y1NA 2NQ7A 3O5VA 1WKMA 4HXXA 2BH3A 2BWSA 4RZYA 5CE6A 1BN5A 5JFRA 4ZWOA 4FLKA 1A16A 2BB7A 3PEBA 1KQ0A 2GA2A 3PKEA 4U1BA 5FCHA 1BOAA 1KP0A 4U6ZA 2Q8KA 1WY2A 2GTXA 4FUKA 5D6FA 1WLRA 3Q6DA 3PKBA 3S6BA 2Q93A 4A6VA 1YVMA 3QOCA 2B3KA 4OOKA 4ZWUA 3IU7A 3BITA 1XGOA 3PN9A 2EVOA 2GG2A 3RVAA 4U6WA 1WBQA 1C24A 1C23A 4MATA 1JAWA 2GG0A 2Q92A 3PKAA 2G6PA 4U70A 1WL9A 2BWVA 2BWYA 5E2CA 2EA4A 4IU6A 5JHUA 3L7GA 4EGEA 2GU6A 4IKRA 2OKNA 4U6CA 4U73A 5CDVA 2GG7A 1M35A 1MATA 2GG9A 4Z7MA 4S01A 2GGCA 1XGSA 1XGMA 4JUQA 2Q95A 4ZWPA 1XNZA 3FMQA 2BHBA 2V3YA 1YW8A 3I7MA 3IL0A 1QXWA 4B28A 2NQ6A 1WN1A 4IF7A 3IU8A 1QZYA 1QXYA 3BIPA 4FLIA 4U75A 4FO7A 4A6WA 5CIKA 4S2RP 2GU5A 2DFIA 3PKDA 4IKUA 1B59A 2GZ5A 2B3HA 3FMRA 2EVMA 3CB6A 2HOWA 1YW9A 4FLJA 3CTZA 4RGZ1 4R60A 3IU9A 1C22A 2V6CA 5FCFA 4S2TP 5D6EA 4RZZA 1O0XA 4FLLA 1XGNA 1R5HA 1W7VA 3D27A 1PV9A 4S00A 2GGBA 2EA2A 2BHDA 3L24A 2BWXA 2EVCA 2BWTA 3TB5A 1C27A 4ZNGA 2V3ZA 1W2MA 4IKSA 4U6EA 1R58A 2GG5A 2MATA 2P99A 1WL6A 2ZSGA 2GU4A 1YW7A 3OOOA 4FKCA 2Q94A 3BIQA 5CLSA 2B3LA 3CB5A 5CDEA 2GG8A 1KQ9A 4IDYA 2V3XA 3MATA 4KM3A 5CDLA 2Q96A 4IPAA 4U6JA 1N51A 5E5BA 3MR1A 2BN7A 5JI6A
chains in the Genus database with same CATH superfamily
2ADUA 3MX6A 2BWWA 4PV4A 4U71A 1YJ3A 4QR8A 1C21A 4FO8A 2GG3A 4U69A 2OAZA 4IECA 2IW2A 1R5GA 2P9AA 3FM3A 4PNCA 3RORA 3OVKA 5CNXA 2P98A 2BHCA 3PKCA 3TAVA 1CHMA 1QXZA 4IKTA 2BWUA 3IG4A 2BHAA 1B6AA 2GU7A 4U76A 1Y1NA 2NQ7A 3O5VA 1WKMA 4HXXA 2BH3A 2BWSA 4RZYA 5CE6A 1BN5A 5JFRA 4ZWOA 4FLKA 1A16A 2BB7A 3PEBA 1KQ0A 2GA2A 3PKEA 4U1BA 5FCHA 1BOAA 1KP0A 4U6ZA 2Q8KA 1WY2A 2GTXA 4FUKA 5D6FA 1WLRA 3Q6DA 3PKBA 3S6BA 2Q93A 4A6VA 1YVMA 3QOCA 2B3KA 4OOKA 4ZWUA 3IU7A 3BITA 1XGOA 3PN9A 2EVOA 2GG2A 3RVAA 4U6WA 1WBQA 1C24A 1C23A 4MATA 1JAWA 2GG0A 2Q92A 3PKAA 2G6PA 4U70A 1WL9A 2BWVA 2BWYA 5E2CA 2EA4A 4IU6A 5JHUA 3L7GA 4EGEA 2GU6A 4IKRA 2OKNA 4U6CA 4U73A 5CDVA 2GG7A 1M35A 1MATA 2GG9A 4Z7MA 4S01A 2GGCA 1XGSA 1XGMA 4JUQA 2Q95A 4ZWPA 1XNZA 3FMQA 2BHBA 2V3YA 1YW8A 3I7MA 3IL0A 1QXWA 4B28A 2NQ6A 1WN1A 4IF7A 3IU8A 1QZYA 1QXYA 3BIPA 4FLIA 4U75A 4FO7A 4A6WA 5CIKA 4S2RP 2GU5A 2DFIA 3PKDA 4IKUA 1B59A 2GZ5A 2B3HA 3FMRA 2EVMA 3CB6A 2HOWA 1YW9A 4FLJA 3CTZA 4RGZ1 4R60A 3IU9A 1C22A 2V6CA 5FCFA 4S2TP 5D6EA 4RZZA 1O0XA 4FLLA 1XGNA 1R5HA 1W7VA 3D27A 1PV9A 4S00A 2GGBA 2EA2A 2BHDA 3L24A 2BWXA 2EVCA 2BWTA 3TB5A 1C27A 4ZNGA 2V3ZA 1W2MA 4IKSA 4U6EA 1R58A 2GG5A 2MATA 2P99A 1WL6A 2ZSGA 2GU4A 1YW7A 3OOOA 4FKCA 2Q94A 3BIQA 5CLSA 2B3LA 3CB5A 5CDEA 2GG8A 1KQ9A 4IDYA 2V3XA 3MATA 4KM3A 5CDLA 2Q96A 4IPAA 4U6JA 1N51A 5E5BA 3MR1A 2BN7A 5JI6A
chains in the Genus database with same CATH topology
2ADUA 3MX6A 2BWWA 4PV4A 4U71A 1YJ3A 4QR8A 1C21A 4FO8A 2GG3A 4U69A 2OAZA 4IECA 2IW2A 1R5GA 2P9AA 3FM3A 4PNCA 3RORA 3OVKA 5CNXA 2P98A 2BHCA 3PKCA 3TAVA 1CHMA 1QXZA 4IKTA 2BWUA 3IG4A 2BHAA 1B6AA 2GU7A 4U76A 1Y1NA 2NQ7A 3O5VA 1WKMA 4HXXA 2BH3A 2BWSA 4RZYA 5CE6A 1BN5A 5JFRA 4ZWOA 4FLKA 1A16A 2BB7A 3PEBA 1KQ0A 2GA2A 3PKEA 4U1BA 5FCHA 1BOAA 1KP0A 4U6ZA 2Q8KA 1WY2A 2GTXA 4FUKA 5D6FA 1WLRA 3Q6DA 3PKBA 3S6BA 2Q93A 4A6VA 1YVMA 3QOCA 2B3KA 4OOKA 4ZWUA 3IU7A 3BITA 1XGOA 3PN9A 2EVOA 2GG2A 3RVAA 4U6WA 1WBQA 1C24A 1C23A 4MATA 1JAWA 2GG0A 2Q92A 3PKAA 2G6PA 4U70A 1WL9A 2BWVA 2BWYA 5E2CA 2EA4A 4IU6A 5JHUA 3L7GA 4EGEA 2GU6A 4IKRA 2OKNA 4U6CA 4U73A 5CDVA 2GG7A 1M35A 1MATA 2GG9A 4Z7MA 4S01A 2GGCA 1XGSA 1XGMA 4JUQA 2Q95A 4ZWPA 1XNZA 3FMQA 2BHBA 2V3YA 1YW8A 3I7MA 3IL0A 1QXWA 4B28A 2NQ6A 1WN1A 4IF7A 3IU8A 1QZYA 1QXYA 3BIPA 4FLIA 4U75A 4FO7A 4A6WA 5CIKA 4S2RP 2GU5A 2DFIA 3PKDA 4IKUA 1B59A 2GZ5A 2B3HA 3FMRA 2EVMA 3CB6A 2HOWA 1YW9A 4FLJA 3CTZA 4RGZ1 4R60A 3IU9A 1C22A 2V6CA 5FCFA 4S2TP 5D6EA 4RZZA 1O0XA 4FLLA 1XGNA 1R5HA 1W7VA 3D27A 1PV9A 4S00A 2GGBA 2EA2A 2BHDA 3L24A 2BWXA 2EVCA 2BWTA 3TB5A 1C27A 4ZNGA 2V3ZA 1W2MA 4IKSA 4U6EA 1R58A 2GG5A 2MATA 2P99A 1WL6A 2ZSGA 2GU4A 1YW7A 3OOOA 4FKCA 2Q94A 3BIQA 5CLSA 2B3LA 3CB5A 5CDEA 2GG8A 1KQ9A 4IDYA 2V3XA 3MATA 4KM3A 5CDLA 2Q96A 4IPAA 4U6JA 1N51A 5E5BA 3MR1A 2BN7A 5JI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADU A;  3MX6 A;  2BWW A;  4PV4 A;  4U71 A;  1YJ3 A;  4QR8 A;  1C21 A;  4FO8 A;  2GG3 A;  4U69 A;  2OAZ A;  4IEC A;  2IW2 A;  1R5G A;  2P9A A;  3FM3 A;  4PNC A;  3ROR A;  3OVK A;  5CNX A;  2P98 A;  2BHC A;  3PKC A;  3TAV A;  1CHM A;  1QXZ A;  4IKT A;  2BWU A;  3IG4 A;  2BHA A;  1B6A A;  2GU7 A;  4U76 A;  1Y1N A;  2NQ7 A;  3O5V A;  1WKM A;  4HXX A;  2BH3 A;  2BWS A;  4RZY A;  5CE6 A;  1BN5 A;  5JFR A;  4ZWO A;  4FLK A;  1A16 A;  2BB7 A;  3PEB A;  1KQ0 A;  2GA2 A;  3PKE A;  4U1B A;  5FCH A;  1BOA A;  1KP0 A;  4U6Z A;  2Q8K A;  1WY2 A;  2GTX A;  4FUK A;  5D6F A;  1WLR A;  3Q6D A;  3PKB A;  3S6B A;  2Q93 A;  4A6V A;  1YVM A;  3QOC A;  2B3K A;  4OOK A;  4ZWU A;  3IU7 A;  3BIT A;  1XGO A;  3PN9 A;  2EVO A;  2GG2 A;  3RVA A;  4U6W A;  1WBQ A;  1C24 A;  1C23 A;  4MAT A;  1JAW A;  2GG0 A;  2Q92 A;  3PKA A;  2G6P A;  4U70 A;  1WL9 A;  2BWV A;  2BWY A;  5E2C A;  2EA4 A;  4IU6 A;  5JHU A;  3L7G A;  4EGE A;  2GU6 A;  4IKR A;  2OKN A;  4U6C A;  4U73 A;  5CDV A;  2GG7 A;  1M35 A;  1MAT A;  2GG9 A;  4Z7M A;  4S01 A;  2GGC A;  1XGS A;  1XGM A;  4JUQ A;  2Q95 A;  4ZWP A;  1XNZ A;  3FMQ A;  2BHB A;  2V3Y A;  1YW8 A;  3I7M A;  3IL0 A;  1QXW A;  4B28 A;  2NQ6 A;  1WN1 A;  4IF7 A;  3IU8 A;  1QZY A;  1QXY A;  3BIP A;  4FLI A;  4U75 A;  4FO7 A;  4A6W A;  5CIK A;  4S2R P;  2GU5 A;  2DFI A;  3PKD A;  4IKU A;  1B59 A;  2GZ5 A;  2B3H A;  3FMR A;  2EVM A;  3CB6 A;  2HOW A;  1YW9 A;  4FLJ A;  3CTZ A;  4RGZ 1;  4R60 A;  3IU9 A;  1C22 A;  2V6C A;  5FCF A;  4S2T P;  5D6E A;  4RZZ A;  1O0X A;  4FLL A;  1XGN A;  1R5H A;  1W7V A;  3D27 A;  1PV9 A;  4S00 A;  2GGB A;  2EA2 A;  2BHD A;  3L24 A;  2BWX A;  2EVC A;  2BWT A;  3TB5 A;  1C27 A;  4ZNG A;  2V3Z A;  1W2M A;  4IKS A;  4U6E A;  1R58 A;  2GG5 A;  2MAT A;  2P99 A;  1WL6 A;  2ZSG A;  2GU4 A;  1YW7 A;  3OOO A;  4FKC A;  2Q94 A;  3BIQ A;  5CLS A;  2B3L A;  3CB5 A;  5CDE A;  2GG8 A;  1KQ9 A;  4IDY A;  2V3X A;  3MAT A;  4KM3 A;  5CDL A;  2Q96 A;  4IPA A;  4U6J A;  1N51 A;  5E5B A;  3MR1 A;  2BN7 A;  5JI6 A; 
#chains in the Genus database with same CATH topology
 2ADU A;  3MX6 A;  2BWW A;  4PV4 A;  4U71 A;  1YJ3 A;  4QR8 A;  1C21 A;  4FO8 A;  2GG3 A;  4U69 A;  2OAZ A;  4IEC A;  2IW2 A;  1R5G A;  2P9A A;  3FM3 A;  4PNC A;  3ROR A;  3OVK A;  5CNX A;  2P98 A;  2BHC A;  3PKC A;  3TAV A;  1CHM A;  1QXZ A;  4IKT A;  2BWU A;  3IG4 A;  2BHA A;  1B6A A;  2GU7 A;  4U76 A;  1Y1N A;  2NQ7 A;  3O5V A;  1WKM A;  4HXX A;  2BH3 A;  2BWS A;  4RZY A;  5CE6 A;  1BN5 A;  5JFR A;  4ZWO A;  4FLK A;  1A16 A;  2BB7 A;  3PEB A;  1KQ0 A;  2GA2 A;  3PKE A;  4U1B A;  5FCH A;  1BOA A;  1KP0 A;  4U6Z A;  2Q8K A;  1WY2 A;  2GTX A;  4FUK A;  5D6F A;  1WLR A;  3Q6D A;  3PKB A;  3S6B A;  2Q93 A;  4A6V A;  1YVM A;  3QOC A;  2B3K A;  4OOK A;  4ZWU A;  3IU7 A;  3BIT A;  1XGO A;  3PN9 A;  2EVO A;  2GG2 A;  3RVA A;  4U6W A;  1WBQ A;  1C24 A;  1C23 A;  4MAT A;  1JAW A;  2GG0 A;  2Q92 A;  3PKA A;  2G6P A;  4U70 A;  1WL9 A;  2BWV A;  2BWY A;  5E2C A;  2EA4 A;  4IU6 A;  5JHU A;  3L7G A;  4EGE A;  2GU6 A;  4IKR A;  2OKN A;  4U6C A;  4U73 A;  5CDV A;  2GG7 A;  1M35 A;  1MAT A;  2GG9 A;  4Z7M A;  4S01 A;  2GGC A;  1XGS A;  1XGM A;  4JUQ A;  2Q95 A;  4ZWP A;  1XNZ A;  3FMQ A;  2BHB A;  2V3Y A;  1YW8 A;  3I7M A;  3IL0 A;  1QXW A;  4B28 A;  2NQ6 A;  1WN1 A;  4IF7 A;  3IU8 A;  1QZY A;  1QXY A;  3BIP A;  4FLI A;  4U75 A;  4FO7 A;  4A6W A;  5CIK A;  4S2R P;  2GU5 A;  2DFI A;  3PKD A;  4IKU A;  1B59 A;  2GZ5 A;  2B3H A;  3FMR A;  2EVM A;  3CB6 A;  2HOW A;  1YW9 A;  4FLJ A;  3CTZ A;  4RGZ 1;  4R60 A;  3IU9 A;  1C22 A;  2V6C A;  5FCF A;  4S2T P;  5D6E A;  4RZZ A;  1O0X A;  4FLL A;  1XGN A;  1R5H A;  1W7V A;  3D27 A;  1PV9 A;  4S00 A;  2GGB A;  2EA2 A;  2BHD A;  3L24 A;  2BWX A;  2EVC A;  2BWT A;  3TB5 A;  1C27 A;  4ZNG A;  2V3Z A;  1W2M A;  4IKS A;  4U6E A;  1R58 A;  2GG5 A;  2MAT A;  2P99 A;  1WL6 A;  2ZSG A;  2GU4 A;  1YW7 A;  3OOO A;  4FKC A;  2Q94 A;  3BIQ A;  5CLS A;  2B3L A;  3CB5 A;  5CDE A;  2GG8 A;  1KQ9 A;  4IDY A;  2V3X A;  3MAT A;  4KM3 A;  5CDL A;  2Q96 A;  4IPA A;  4U6J A;  1N51 A;  5E5B A;  3MR1 A;  2BN7 A;  5JI6 A; 
#chains in the Genus database with same CATH homology
 2ADU A;  3MX6 A;  2BWW A;  4PV4 A;  4U71 A;  1YJ3 A;  4QR8 A;  1C21 A;  4FO8 A;  2GG3 A;  4U69 A;  2OAZ A;  4IEC A;  2IW2 A;  1R5G A;  2P9A A;  3FM3 A;  4PNC A;  3ROR A;  3OVK A;  5CNX A;  2P98 A;  2BHC A;  3PKC A;  3TAV A;  1CHM A;  1QXZ A;  4IKT A;  2BWU A;  3IG4 A;  2BHA A;  1B6A A;  2GU7 A;  4U76 A;  1Y1N A;  2NQ7 A;  3O5V A;  1WKM A;  4HXX A;  2BH3 A;  2BWS A;  4RZY A;  5CE6 A;  1BN5 A;  5JFR A;  4ZWO A;  4FLK A;  1A16 A;  2BB7 A;  3PEB A;  1KQ0 A;  2GA2 A;  3PKE A;  4U1B A;  5FCH A;  1BOA A;  1KP0 A;  4U6Z A;  2Q8K A;  1WY2 A;  2GTX A;  4FUK A;  5D6F A;  1WLR A;  3Q6D A;  3PKB A;  3S6B A;  2Q93 A;  4A6V A;  1YVM A;  3QOC A;  2B3K A;  4OOK A;  4ZWU A;  3IU7 A;  3BIT A;  1XGO A;  3PN9 A;  2EVO A;  2GG2 A;  3RVA A;  4U6W A;  1WBQ A;  1C24 A;  1C23 A;  4MAT A;  1JAW A;  2GG0 A;  2Q92 A;  3PKA A;  2G6P A;  4U70 A;  1WL9 A;  2BWV A;  2BWY A;  5E2C A;  2EA4 A;  4IU6 A;  5JHU A;  3L7G A;  4EGE A;  2GU6 A;  4IKR A;  2OKN A;  4U6C A;  4U73 A;  5CDV A;  2GG7 A;  1M35 A;  1MAT A;  2GG9 A;  4Z7M A;  4S01 A;  2GGC A;  1XGS A;  1XGM A;  4JUQ A;  2Q95 A;  4ZWP A;  1XNZ A;  3FMQ A;  2BHB A;  2V3Y A;  1YW8 A;  3I7M A;  3IL0 A;  1QXW A;  4B28 A;  2NQ6 A;  1WN1 A;  4IF7 A;  3IU8 A;  1QZY A;  1QXY A;  3BIP A;  4FLI A;  4U75 A;  4FO7 A;  4A6W A;  5CIK A;  4S2R P;  2GU5 A;  2DFI A;  3PKD A;  4IKU A;  1B59 A;  2GZ5 A;  2B3H A;  3FMR A;  2EVM A;  3CB6 A;  2HOW A;  1YW9 A;  4FLJ A;  3CTZ A;  4RGZ 1;  4R60 A;  3IU9 A;  1C22 A;  2V6C A;  5FCF A;  4S2T P;  5D6E A;  4RZZ A;  1O0X A;  4FLL A;  1XGN A;  1R5H A;  1W7V A;  3D27 A;  1PV9 A;  4S00 A;  2GGB A;  2EA2 A;  2BHD A;  3L24 A;  2BWX A;  2EVC A;  2BWT A;  3TB5 A;  1C27 A;  4ZNG A;  2V3Z A;  1W2M A;  4IKS A;  4U6E A;  1R58 A;  2GG5 A;  2MAT A;  2P99 A;  1WL6 A;  2ZSG A;  2GU4 A;  1YW7 A;  3OOO A;  4FKC A;  2Q94 A;  3BIQ A;  5CLS A;  2B3L A;  3CB5 A;  5CDE A;  2GG8 A;  1KQ9 A;  4IDY A;  2V3X A;  3MAT A;  4KM3 A;  5CDL A;  2Q96 A;  4IPA A;  4U6J A;  1N51 A;  5E5B A;  3MR1 A;  2BN7 A;  5JI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...