2BWVA

His361ala escherichia coli aminopeptidase p
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVADVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 157
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwvA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwvA02
2V3ZA 1MATA 3TB5A 5JHUA 4U75A 1YW7A 2P98A 3PKDA 4PNCA 1QXYA 1B6AA 5JFRA 3L24A 3FMQA 5JI6A 1XNZA 3IG4A 1C27A 4JUQA 3IL0A 3BIQA 3RVAA 2GGCA 1R5GA 2P9AA 4U6EA 4S01A 3CTZA 2GZ5A 4RZZA 5CDEA 2GG0A 2Q8KA 4FUKA 2EVCA 4FLKA 4EGEA 3S6BA 5CDLA 3QOCA 3FMRA 4IECA 4FKCA 2NQ7A 1WL6A 2ADUA 4IDYA 1KP0A 1JAWA 3IU8A 1KQ0A 1R58A 2MATA 4QR8A 5CLSA 4U70A 5D6FA 2GG9A 5CE6A 1C24A 1A16A 4S2TP 2EA2A 3PKBA 2ZSGA 3D27A 2BWUA 5CNXA 4Z7MA 2Q95A 2NQ6A 4KM3A 2P99A 1N51A 4A6WA 5CIKA 5CDVA 2GG2A 1Y1NA 2BHAA 2EVMA 3CB6A 1XGNA 3PEBA 3BITA 5D6EA 2BB7A 4S00A 1WKMA 4FLLA 3PKCA 2GGBA 1XGSA 5E2CA 2B3HA 4U6ZA 3MX6A 5E5BA 4ZWOA 3TAVA 4B28A 1KQ9A 3PKEA 2GTXA 1W2MA 3MATA 2GG5A 2Q92A 1XGOA 2BHBA 2BWWA 4RZYA 4U71A 2BWYA 1B59A 4IPAA 2BWTA 4U69A 1QXWA 4IKTA 2BWVA 4IF7A 1BOAA 1WN1A 2BWSA 4R60A 4U73A 4FO8A 4U76A 2EA4A 1M35A 1QZYA 2DFIA 1C22A 2GU4A 1WY2A 2Q96A 4IU6A 2GU6A 2GG7A 2BWXA 2BHDA 2GG3A 4OOKA 4U1BA 2HOWA 4U6WA 3MR1A 4A6VA 1PV9A 1YJ3A 2OKNA 3CB5A 5FCHA 2GU7A 4S2RP 3IU9A 1C23A 2GU5A 4MATA 3OVKA 2Q94A 2Q93A 3Q6DA 1C21A 1XGMA 3O5VA 3OOOA 3FM3A 2BHCA 3RORA 3L7GA 3I7MA 4ZWPA 1WL9A 3BIPA 1YVMA 1BN5A 3PKAA 4RGZ1 1O0XA 4FLJA 3PN9A 4FO7A 1YW9A 2GA2A 2B3KA 2EVOA 1W7VA 2V3YA 4ZWUA 2GG8A 1CHMA 4IKRA 2BH3A 2BN7A 1R5HA 2V6CA 2V3XA 2G6PA 5FCFA 4IKSA 4FLIA 2OAZA 4ZNGA 4U6CA 1WBQA 4IKUA 1YW8A 4HXXA 2IW2A 1QXZA 3IU7A 4U6JA 2B3LA 4PV4A 1WLRA
chains in the Genus database with same CATH superfamily
2V3ZA 1MATA 3TB5A 5JHUA 4U75A 1YW7A 2P98A 3PKDA 4PNCA 1QXYA 1B6AA 5JFRA 3L24A 3FMQA 5JI6A 1XNZA 3IG4A 1C27A 4JUQA 3IL0A 3BIQA 3RVAA 2GGCA 1R5GA 2P9AA 4U6EA 4S01A 3CTZA 2GZ5A 4RZZA 5CDEA 2GG0A 2Q8KA 4FUKA 2EVCA 4FLKA 4EGEA 3S6BA 5CDLA 3QOCA 3FMRA 4IECA 4FKCA 2NQ7A 1WL6A 2ADUA 4IDYA 1KP0A 1JAWA 3IU8A 1KQ0A 1R58A 2MATA 4QR8A 5CLSA 4U70A 5D6FA 2GG9A 5CE6A 1C24A 1A16A 4S2TP 2EA2A 3PKBA 2ZSGA 3D27A 2BWUA 5CNXA 4Z7MA 2Q95A 2NQ6A 4KM3A 2P99A 1N51A 4A6WA 5CIKA 5CDVA 2GG2A 1Y1NA 2BHAA 2EVMA 3CB6A 1XGNA 3PEBA 3BITA 5D6EA 2BB7A 4S00A 1WKMA 4FLLA 3PKCA 2GGBA 1XGSA 5E2CA 2B3HA 4U6ZA 3MX6A 5E5BA 4ZWOA 3TAVA 4B28A 1KQ9A 3PKEA 2GTXA 1W2MA 3MATA 2GG5A 2Q92A 1XGOA 2BHBA 2BWWA 4RZYA 4U71A 2BWYA 1B59A 4IPAA 2BWTA 4U69A 1QXWA 4IKTA 2BWVA 4IF7A 1BOAA 1WN1A 2BWSA 4R60A 4U73A 4FO8A 4U76A 2EA4A 1M35A 1QZYA 2DFIA 1C22A 2GU4A 1WY2A 2Q96A 4IU6A 2GU6A 2GG7A 2BWXA 2BHDA 2GG3A 4OOKA 4U1BA 2HOWA 4U6WA 3MR1A 4A6VA 1PV9A 1YJ3A 2OKNA 3CB5A 5FCHA 2GU7A 4S2RP 3IU9A 1C23A 2GU5A 4MATA 3OVKA 2Q94A 2Q93A 3Q6DA 1C21A 1XGMA 3O5VA 3OOOA 3FM3A 2BHCA 3RORA 3L7GA 3I7MA 4ZWPA 1WL9A 3BIPA 1YVMA 1BN5A 3PKAA 4RGZ1 1O0XA 4FLJA 3PN9A 4FO7A 1YW9A 2GA2A 2B3KA 2EVOA 1W7VA 2V3YA 4ZWUA 2GG8A 1CHMA 4IKRA 2BH3A 2BN7A 1R5HA 2V6CA 2V3XA 2G6PA 5FCFA 4IKSA 4FLIA 2OAZA 4ZNGA 4U6CA 1WBQA 4IKUA 1YW8A 4HXXA 2IW2A 1QXZA 3IU7A 4U6JA 2B3LA 4PV4A 1WLRA
chains in the Genus database with same CATH topology
2V3ZA 1MATA 3TB5A 5JHUA 4U75A 1YW7A 2P98A 3PKDA 4PNCA 1QXYA 1B6AA 5JFRA 3L24A 3FMQA 5JI6A 1XNZA 3IG4A 1C27A 4JUQA 3IL0A 3BIQA 3RVAA 2GGCA 1R5GA 2P9AA 4U6EA 4S01A 3CTZA 2GZ5A 4RZZA 5CDEA 2GG0A 2Q8KA 4FUKA 2EVCA 4FLKA 4EGEA 3S6BA 5CDLA 3QOCA 3FMRA 4IECA 4FKCA 2NQ7A 1WL6A 2ADUA 4IDYA 1KP0A 1JAWA 3IU8A 1KQ0A 1R58A 2MATA 4QR8A 5CLSA 4U70A 5D6FA 2GG9A 5CE6A 1C24A 1A16A 4S2TP 2EA2A 3PKBA 2ZSGA 3D27A 2BWUA 5CNXA 4Z7MA 2Q95A 2NQ6A 4KM3A 2P99A 1N51A 4A6WA 5CIKA 5CDVA 2GG2A 1Y1NA 2BHAA 2EVMA 3CB6A 1XGNA 3PEBA 3BITA 5D6EA 2BB7A 4S00A 1WKMA 4FLLA 3PKCA 2GGBA 1XGSA 5E2CA 2B3HA 4U6ZA 3MX6A 5E5BA 4ZWOA 3TAVA 4B28A 1KQ9A 3PKEA 2GTXA 1W2MA 3MATA 2GG5A 2Q92A 1XGOA 2BHBA 2BWWA 4RZYA 4U71A 2BWYA 1B59A 4IPAA 2BWTA 4U69A 1QXWA 4IKTA 2BWVA 4IF7A 1BOAA 1WN1A 2BWSA 4R60A 4U73A 4FO8A 4U76A 2EA4A 1M35A 1QZYA 2DFIA 1C22A 2GU4A 1WY2A 2Q96A 4IU6A 2GU6A 2GG7A 2BWXA 2BHDA 2GG3A 4OOKA 4U1BA 2HOWA 4U6WA 3MR1A 4A6VA 1PV9A 1YJ3A 2OKNA 3CB5A 5FCHA 2GU7A 4S2RP 3IU9A 1C23A 2GU5A 4MATA 3OVKA 2Q94A 2Q93A 3Q6DA 1C21A 1XGMA 3O5VA 3OOOA 3FM3A 2BHCA 3RORA 3L7GA 3I7MA 4ZWPA 1WL9A 3BIPA 1YVMA 1BN5A 3PKAA 4RGZ1 1O0XA 4FLJA 3PN9A 4FO7A 1YW9A 2GA2A 2B3KA 2EVOA 1W7VA 2V3YA 4ZWUA 2GG8A 1CHMA 4IKRA 2BH3A 2BN7A 1R5HA 2V6CA 2V3XA 2G6PA 5FCFA 4IKSA 4FLIA 2OAZA 4ZNGA 4U6CA 1WBQA 4IKUA 1YW8A 4HXXA 2IW2A 1QXZA 3IU7A 4U6JA 2B3LA 4PV4A 1WLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V3Z A;  1MAT A;  3TB5 A;  5JHU A;  4U75 A;  1YW7 A;  2P98 A;  3PKD A;  4PNC A;  1QXY A;  1B6A A;  5JFR A;  3L24 A;  3FMQ A;  5JI6 A;  1XNZ A;  3IG4 A;  1C27 A;  4JUQ A;  3IL0 A;  3BIQ A;  3RVA A;  2GGC A;  1R5G A;  2P9A A;  4U6E A;  4S01 A;  3CTZ A;  2GZ5 A;  4RZZ A;  5CDE A;  2GG0 A;  2Q8K A;  4FUK A;  2EVC A;  4FLK A;  4EGE A;  3S6B A;  5CDL A;  3QOC A;  3FMR A;  4IEC A;  4FKC A;  2NQ7 A;  1WL6 A;  2ADU A;  4IDY A;  1KP0 A;  1JAW A;  3IU8 A;  1KQ0 A;  1R58 A;  2MAT A;  4QR8 A;  5CLS A;  4U70 A;  5D6F A;  2GG9 A;  5CE6 A;  1C24 A;  1A16 A;  4S2T P;  2EA2 A;  3PKB A;  2ZSG A;  3D27 A;  2BWU A;  5CNX A;  4Z7M A;  2Q95 A;  2NQ6 A;  4KM3 A;  2P99 A;  1N51 A;  4A6W A;  5CIK A;  5CDV A;  2GG2 A;  1Y1N A;  2BHA A;  2EVM A;  3CB6 A;  1XGN A;  3PEB A;  3BIT A;  5D6E A;  2BB7 A;  4S00 A;  1WKM A;  4FLL A;  3PKC A;  2GGB A;  1XGS A;  5E2C A;  2B3H A;  4U6Z A;  3MX6 A;  5E5B A;  4ZWO A;  3TAV A;  4B28 A;  1KQ9 A;  3PKE A;  2GTX A;  1W2M A;  3MAT A;  2GG5 A;  2Q92 A;  1XGO A;  2BHB A;  2BWW A;  4RZY A;  4U71 A;  2BWY A;  1B59 A;  4IPA A;  2BWT A;  4U69 A;  1QXW A;  4IKT A;  2BWV A;  4IF7 A;  1BOA A;  1WN1 A;  2BWS A;  4R60 A;  4U73 A;  4FO8 A;  4U76 A;  2EA4 A;  1M35 A;  1QZY A;  2DFI A;  1C22 A;  2GU4 A;  1WY2 A;  2Q96 A;  4IU6 A;  2GU6 A;  2GG7 A;  2BWX A;  2BHD A;  2GG3 A;  4OOK A;  4U1B A;  2HOW A;  4U6W A;  3MR1 A;  4A6V A;  1PV9 A;  1YJ3 A;  2OKN A;  3CB5 A;  5FCH A;  2GU7 A;  4S2R P;  3IU9 A;  1C23 A;  2GU5 A;  4MAT A;  3OVK A;  2Q94 A;  2Q93 A;  3Q6D A;  1C21 A;  1XGM A;  3O5V A;  3OOO A;  3FM3 A;  2BHC A;  3ROR A;  3L7G A;  3I7M A;  4ZWP A;  1WL9 A;  3BIP A;  1YVM A;  1BN5 A;  3PKA A;  4RGZ 1;  1O0X A;  4FLJ A;  3PN9 A;  4FO7 A;  1YW9 A;  2GA2 A;  2B3K A;  2EVO A;  1W7V A;  2V3Y A;  4ZWU A;  2GG8 A;  1CHM A;  4IKR A;  2BH3 A;  2BN7 A;  1R5H A;  2V6C A;  2V3X A;  2G6P A;  5FCF A;  4IKS A;  4FLI A;  2OAZ A;  4ZNG A;  4U6C A;  1WBQ A;  4IKU A;  1YW8 A;  4HXX A;  2IW2 A;  1QXZ A;  3IU7 A;  4U6J A;  2B3L A;  4PV4 A;  1WLR A; 
#chains in the Genus database with same CATH topology
 2V3Z A;  1MAT A;  3TB5 A;  5JHU A;  4U75 A;  1YW7 A;  2P98 A;  3PKD A;  4PNC A;  1QXY A;  1B6A A;  5JFR A;  3L24 A;  3FMQ A;  5JI6 A;  1XNZ A;  3IG4 A;  1C27 A;  4JUQ A;  3IL0 A;  3BIQ A;  3RVA A;  2GGC A;  1R5G A;  2P9A A;  4U6E A;  4S01 A;  3CTZ A;  2GZ5 A;  4RZZ A;  5CDE A;  2GG0 A;  2Q8K A;  4FUK A;  2EVC A;  4FLK A;  4EGE A;  3S6B A;  5CDL A;  3QOC A;  3FMR A;  4IEC A;  4FKC A;  2NQ7 A;  1WL6 A;  2ADU A;  4IDY A;  1KP0 A;  1JAW A;  3IU8 A;  1KQ0 A;  1R58 A;  2MAT A;  4QR8 A;  5CLS A;  4U70 A;  5D6F A;  2GG9 A;  5CE6 A;  1C24 A;  1A16 A;  4S2T P;  2EA2 A;  3PKB A;  2ZSG A;  3D27 A;  2BWU A;  5CNX A;  4Z7M A;  2Q95 A;  2NQ6 A;  4KM3 A;  2P99 A;  1N51 A;  4A6W A;  5CIK A;  5CDV A;  2GG2 A;  1Y1N A;  2BHA A;  2EVM A;  3CB6 A;  1XGN A;  3PEB A;  3BIT A;  5D6E A;  2BB7 A;  4S00 A;  1WKM A;  4FLL A;  3PKC A;  2GGB A;  1XGS A;  5E2C A;  2B3H A;  4U6Z A;  3MX6 A;  5E5B A;  4ZWO A;  3TAV A;  4B28 A;  1KQ9 A;  3PKE A;  2GTX A;  1W2M A;  3MAT A;  2GG5 A;  2Q92 A;  1XGO A;  2BHB A;  2BWW A;  4RZY A;  4U71 A;  2BWY A;  1B59 A;  4IPA A;  2BWT A;  4U69 A;  1QXW A;  4IKT A;  2BWV A;  4IF7 A;  1BOA A;  1WN1 A;  2BWS A;  4R60 A;  4U73 A;  4FO8 A;  4U76 A;  2EA4 A;  1M35 A;  1QZY A;  2DFI A;  1C22 A;  2GU4 A;  1WY2 A;  2Q96 A;  4IU6 A;  2GU6 A;  2GG7 A;  2BWX A;  2BHD A;  2GG3 A;  4OOK A;  4U1B A;  2HOW A;  4U6W A;  3MR1 A;  4A6V A;  1PV9 A;  1YJ3 A;  2OKN A;  3CB5 A;  5FCH A;  2GU7 A;  4S2R P;  3IU9 A;  1C23 A;  2GU5 A;  4MAT A;  3OVK A;  2Q94 A;  2Q93 A;  3Q6D A;  1C21 A;  1XGM A;  3O5V A;  3OOO A;  3FM3 A;  2BHC A;  3ROR A;  3L7G A;  3I7M A;  4ZWP A;  1WL9 A;  3BIP A;  1YVM A;  1BN5 A;  3PKA A;  4RGZ 1;  1O0X A;  4FLJ A;  3PN9 A;  4FO7 A;  1YW9 A;  2GA2 A;  2B3K A;  2EVO A;  1W7V A;  2V3Y A;  4ZWU A;  2GG8 A;  1CHM A;  4IKR A;  2BH3 A;  2BN7 A;  1R5H A;  2V6C A;  2V3X A;  2G6P A;  5FCF A;  4IKS A;  4FLI A;  2OAZ A;  4ZNG A;  4U6C A;  1WBQ A;  4IKU A;  1YW8 A;  4HXX A;  2IW2 A;  1QXZ A;  3IU7 A;  4U6J A;  2B3L A;  4PV4 A;  1WLR A; 
#chains in the Genus database with same CATH homology
 2V3Z A;  1MAT A;  3TB5 A;  5JHU A;  4U75 A;  1YW7 A;  2P98 A;  3PKD A;  4PNC A;  1QXY A;  1B6A A;  5JFR A;  3L24 A;  3FMQ A;  5JI6 A;  1XNZ A;  3IG4 A;  1C27 A;  4JUQ A;  3IL0 A;  3BIQ A;  3RVA A;  2GGC A;  1R5G A;  2P9A A;  4U6E A;  4S01 A;  3CTZ A;  2GZ5 A;  4RZZ A;  5CDE A;  2GG0 A;  2Q8K A;  4FUK A;  2EVC A;  4FLK A;  4EGE A;  3S6B A;  5CDL A;  3QOC A;  3FMR A;  4IEC A;  4FKC A;  2NQ7 A;  1WL6 A;  2ADU A;  4IDY A;  1KP0 A;  1JAW A;  3IU8 A;  1KQ0 A;  1R58 A;  2MAT A;  4QR8 A;  5CLS A;  4U70 A;  5D6F A;  2GG9 A;  5CE6 A;  1C24 A;  1A16 A;  4S2T P;  2EA2 A;  3PKB A;  2ZSG A;  3D27 A;  2BWU A;  5CNX A;  4Z7M A;  2Q95 A;  2NQ6 A;  4KM3 A;  2P99 A;  1N51 A;  4A6W A;  5CIK A;  5CDV A;  2GG2 A;  1Y1N A;  2BHA A;  2EVM A;  3CB6 A;  1XGN A;  3PEB A;  3BIT A;  5D6E A;  2BB7 A;  4S00 A;  1WKM A;  4FLL A;  3PKC A;  2GGB A;  1XGS A;  5E2C A;  2B3H A;  4U6Z A;  3MX6 A;  5E5B A;  4ZWO A;  3TAV A;  4B28 A;  1KQ9 A;  3PKE A;  2GTX A;  1W2M A;  3MAT A;  2GG5 A;  2Q92 A;  1XGO A;  2BHB A;  2BWW A;  4RZY A;  4U71 A;  2BWY A;  1B59 A;  4IPA A;  2BWT A;  4U69 A;  1QXW A;  4IKT A;  2BWV A;  4IF7 A;  1BOA A;  1WN1 A;  2BWS A;  4R60 A;  4U73 A;  4FO8 A;  4U76 A;  2EA4 A;  1M35 A;  1QZY A;  2DFI A;  1C22 A;  2GU4 A;  1WY2 A;  2Q96 A;  4IU6 A;  2GU6 A;  2GG7 A;  2BWX A;  2BHD A;  2GG3 A;  4OOK A;  4U1B A;  2HOW A;  4U6W A;  3MR1 A;  4A6V A;  1PV9 A;  1YJ3 A;  2OKN A;  3CB5 A;  5FCH A;  2GU7 A;  4S2R P;  3IU9 A;  1C23 A;  2GU5 A;  4MAT A;  3OVK A;  2Q94 A;  2Q93 A;  3Q6D A;  1C21 A;  1XGM A;  3O5V A;  3OOO A;  3FM3 A;  2BHC A;  3ROR A;  3L7G A;  3I7M A;  4ZWP A;  1WL9 A;  3BIP A;  1YVM A;  1BN5 A;  3PKA A;  4RGZ 1;  1O0X A;  4FLJ A;  3PN9 A;  4FO7 A;  1YW9 A;  2GA2 A;  2B3K A;  2EVO A;  1W7V A;  2V3Y A;  4ZWU A;  2GG8 A;  1CHM A;  4IKR A;  2BH3 A;  2BN7 A;  1R5H A;  2V6C A;  2V3X A;  2G6P A;  5FCF A;  4IKS A;  4FLI A;  2OAZ A;  4ZNG A;  4U6C A;  1WBQ A;  4IKU A;  1YW8 A;  4HXX A;  2IW2 A;  1QXZ A;  3IU7 A;  4U6J A;  2B3L A;  4PV4 A;  1WLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...