2BWVA

His361ala escherichia coli aminopeptidase p
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVADVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 157
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwvA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwvA02
4FLLA 3IU7A 2BN7A 2MATA 4IKSA 2EVMA 4IDYA 2EVCA 4U6JA 2Q8KA 4QR8A 3RVAA 4MATA 2GZ5A 4IU6A 3Q6DA 1W7VA 1WN1A 4U75A 5CIKA 4IPAA 3PKEA 1WY2A 4ZWUA 4IECA 5E5BA 4RGZ1 2GG5A 2IW2A 4S2TP 2NQ7A 4IKRA 2GG8A 2B3KA 1YVMA 1A16A 3OOOA 2GU7A 1BN5A 3IU8A 2BHBA 2V3YA 1WLRA 4ZNGA 2BWWA 1XNZA 5CDEA 4S2RP 5E2CA 2GG7A 3CTZA 4RZZA 4A6VA 3O5VA 1YW9A 1R5HA 3PN9A 2ADUA 1XGOA 1B59A 5CDLA 1WBQA 1CHMA 4IKUA 1XGMA 4FUKA 4FO7A 2BHCA 1MATA 3CB5A 1YJ3A 2EA2A 2GGBA 2Q93A 3D27A 5D6FA 2GU6A 2GU5A 3IL0A 4U1BA 4A6WA 5JFRA 1QXWA 1JAWA 1QXYA 1BOAA 2BWSA 2B3HA 4FKCA 4FLKA 3TB5A 4B28A 4U69A 4EGEA 1KQ9A 3PKDA 2V3XA 3OVKA 4U6ZA 3TAVA 1B6AA 4FO8A 1XGNA 3MATA 3BIQA 3S6BA 1KQ0A 2GG2A 4U6WA 3PKCA 3PKAA 4OOKA 2ZSGA 2BWTA 2GTXA 2BWUA 5JHUA 5JI6A 2GU4A 2B3LA 3BIPA 3L7GA 3MX6A 2V6CA 4HXXA 2P9AA 2V3ZA 1R5GA 3IU9A 2P99A 4FLIA 2Q96A 2BH3A 3BITA 3PKBA 1W2MA 1KP0A 1O0XA 2G6PA 2Q95A 4RZYA 2BHDA 2BHAA 1PV9A 4ZWPA 3QOCA 1C22A 3I7MA 1C24A 4Z7MA 1M35A 4FLJA 2BB7A 4S00A 2OAZA 3IG4A 5FCHA 1C23A 4U76A 4U6CA 1R58A 1WL6A 1Y1NA 5CLSA 3RORA 2P98A 4KM3A 4R60A 2Q92A 3FMRA 4IKTA 5CE6A 2GG3A 2GG0A 1XGSA 2EA4A 2EVOA 3MR1A 4U6EA 4U70A 2GG9A 3FMQA 4U73A 1QXZA 5D6EA 2OKNA 1C27A 5FCFA 1WKMA 1N51A 4ZWOA 3FM3A 1YW8A 2BWVA 2DFIA 2BWXA 4S01A 3PEBA 4PV4A 4PNCA 3CB6A 3L24A 2Q94A 1C21A 2BWYA 5CNXA 4IF7A 4U71A 2GA2A 1QZYA 1WL9A 2GGCA 4JUQA 2HOWA 5CDVA 1YW7A 2NQ6A
chains in the Genus database with same CATH superfamily
4FLLA 3IU7A 2BN7A 2MATA 4IKSA 2EVMA 4IDYA 2EVCA 4U6JA 2Q8KA 4QR8A 3RVAA 4MATA 2GZ5A 4IU6A 3Q6DA 1W7VA 1WN1A 4U75A 5CIKA 4IPAA 3PKEA 1WY2A 4ZWUA 4IECA 5E5BA 4RGZ1 2GG5A 2IW2A 4S2TP 2NQ7A 4IKRA 2GG8A 2B3KA 1YVMA 1A16A 3OOOA 2GU7A 1BN5A 3IU8A 2BHBA 2V3YA 1WLRA 4ZNGA 2BWWA 1XNZA 5CDEA 4S2RP 5E2CA 2GG7A 3CTZA 4RZZA 4A6VA 3O5VA 1YW9A 1R5HA 3PN9A 2ADUA 1XGOA 1B59A 5CDLA 1WBQA 1CHMA 4IKUA 1XGMA 4FUKA 4FO7A 2BHCA 1MATA 3CB5A 1YJ3A 2EA2A 2GGBA 2Q93A 3D27A 5D6FA 2GU6A 2GU5A 3IL0A 4U1BA 4A6WA 5JFRA 1QXWA 1JAWA 1QXYA 1BOAA 2BWSA 2B3HA 4FKCA 4FLKA 3TB5A 4B28A 4U69A 4EGEA 1KQ9A 3PKDA 2V3XA 3OVKA 4U6ZA 3TAVA 1B6AA 4FO8A 1XGNA 3MATA 3BIQA 3S6BA 1KQ0A 2GG2A 4U6WA 3PKCA 3PKAA 4OOKA 2ZSGA 2BWTA 2GTXA 2BWUA 5JHUA 5JI6A 2GU4A 2B3LA 3BIPA 3L7GA 3MX6A 2V6CA 4HXXA 2P9AA 2V3ZA 1R5GA 3IU9A 2P99A 4FLIA 2Q96A 2BH3A 3BITA 3PKBA 1W2MA 1KP0A 1O0XA 2G6PA 2Q95A 4RZYA 2BHDA 2BHAA 1PV9A 4ZWPA 3QOCA 1C22A 3I7MA 1C24A 4Z7MA 1M35A 4FLJA 2BB7A 4S00A 2OAZA 3IG4A 5FCHA 1C23A 4U76A 4U6CA 1R58A 1WL6A 1Y1NA 5CLSA 3RORA 2P98A 4KM3A 4R60A 2Q92A 3FMRA 4IKTA 5CE6A 2GG3A 2GG0A 1XGSA 2EA4A 2EVOA 3MR1A 4U6EA 4U70A 2GG9A 3FMQA 4U73A 1QXZA 5D6EA 2OKNA 1C27A 5FCFA 1WKMA 1N51A 4ZWOA 3FM3A 1YW8A 2BWVA 2DFIA 2BWXA 4S01A 3PEBA 4PV4A 4PNCA 3CB6A 3L24A 2Q94A 1C21A 2BWYA 5CNXA 4IF7A 4U71A 2GA2A 1QZYA 1WL9A 2GGCA 4JUQA 2HOWA 5CDVA 1YW7A 2NQ6A
chains in the Genus database with same CATH topology
4FLLA 3IU7A 2BN7A 2MATA 4IKSA 2EVMA 4IDYA 2EVCA 4U6JA 2Q8KA 4QR8A 3RVAA 4MATA 2GZ5A 4IU6A 3Q6DA 1W7VA 1WN1A 4U75A 5CIKA 4IPAA 3PKEA 1WY2A 4ZWUA 4IECA 5E5BA 4RGZ1 2GG5A 2IW2A 4S2TP 2NQ7A 4IKRA 2GG8A 2B3KA 1YVMA 1A16A 3OOOA 2GU7A 1BN5A 3IU8A 2BHBA 2V3YA 1WLRA 4ZNGA 2BWWA 1XNZA 5CDEA 4S2RP 5E2CA 2GG7A 3CTZA 4RZZA 4A6VA 3O5VA 1YW9A 1R5HA 3PN9A 2ADUA 1XGOA 1B59A 5CDLA 1WBQA 1CHMA 4IKUA 1XGMA 4FUKA 4FO7A 2BHCA 1MATA 3CB5A 1YJ3A 2EA2A 2GGBA 2Q93A 3D27A 5D6FA 2GU6A 2GU5A 3IL0A 4U1BA 4A6WA 5JFRA 1QXWA 1JAWA 1QXYA 1BOAA 2BWSA 2B3HA 4FKCA 4FLKA 3TB5A 4B28A 4U69A 4EGEA 1KQ9A 3PKDA 2V3XA 3OVKA 4U6ZA 3TAVA 1B6AA 4FO8A 1XGNA 3MATA 3BIQA 3S6BA 1KQ0A 2GG2A 4U6WA 3PKCA 3PKAA 4OOKA 2ZSGA 2BWTA 2GTXA 2BWUA 5JHUA 5JI6A 2GU4A 2B3LA 3BIPA 3L7GA 3MX6A 2V6CA 4HXXA 2P9AA 2V3ZA 1R5GA 3IU9A 2P99A 4FLIA 2Q96A 2BH3A 3BITA 3PKBA 1W2MA 1KP0A 1O0XA 2G6PA 2Q95A 4RZYA 2BHDA 2BHAA 1PV9A 4ZWPA 3QOCA 1C22A 3I7MA 1C24A 4Z7MA 1M35A 4FLJA 2BB7A 4S00A 2OAZA 3IG4A 5FCHA 1C23A 4U76A 4U6CA 1R58A 1WL6A 1Y1NA 5CLSA 3RORA 2P98A 4KM3A 4R60A 2Q92A 3FMRA 4IKTA 5CE6A 2GG3A 2GG0A 1XGSA 2EA4A 2EVOA 3MR1A 4U6EA 4U70A 2GG9A 3FMQA 4U73A 1QXZA 5D6EA 2OKNA 1C27A 5FCFA 1WKMA 1N51A 4ZWOA 3FM3A 1YW8A 2BWVA 2DFIA 2BWXA 4S01A 3PEBA 4PV4A 4PNCA 3CB6A 3L24A 2Q94A 1C21A 2BWYA 5CNXA 4IF7A 4U71A 2GA2A 1QZYA 1WL9A 2GGCA 4JUQA 2HOWA 5CDVA 1YW7A 2NQ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLL A;  3IU7 A;  2BN7 A;  2MAT A;  4IKS A;  2EVM A;  4IDY A;  2EVC A;  4U6J A;  2Q8K A;  4QR8 A;  3RVA A;  4MAT A;  2GZ5 A;  4IU6 A;  3Q6D A;  1W7V A;  1WN1 A;  4U75 A;  5CIK A;  4IPA A;  3PKE A;  1WY2 A;  4ZWU A;  4IEC A;  5E5B A;  4RGZ 1;  2GG5 A;  2IW2 A;  4S2T P;  2NQ7 A;  4IKR A;  2GG8 A;  2B3K A;  1YVM A;  1A16 A;  3OOO A;  2GU7 A;  1BN5 A;  3IU8 A;  2BHB A;  2V3Y A;  1WLR A;  4ZNG A;  2BWW A;  1XNZ A;  5CDE A;  4S2R P;  5E2C A;  2GG7 A;  3CTZ A;  4RZZ A;  4A6V A;  3O5V A;  1YW9 A;  1R5H A;  3PN9 A;  2ADU A;  1XGO A;  1B59 A;  5CDL A;  1WBQ A;  1CHM A;  4IKU A;  1XGM A;  4FUK A;  4FO7 A;  2BHC A;  1MAT A;  3CB5 A;  1YJ3 A;  2EA2 A;  2GGB A;  2Q93 A;  3D27 A;  5D6F A;  2GU6 A;  2GU5 A;  3IL0 A;  4U1B A;  4A6W A;  5JFR A;  1QXW A;  1JAW A;  1QXY A;  1BOA A;  2BWS A;  2B3H A;  4FKC A;  4FLK A;  3TB5 A;  4B28 A;  4U69 A;  4EGE A;  1KQ9 A;  3PKD A;  2V3X A;  3OVK A;  4U6Z A;  3TAV A;  1B6A A;  4FO8 A;  1XGN A;  3MAT A;  3BIQ A;  3S6B A;  1KQ0 A;  2GG2 A;  4U6W A;  3PKC A;  3PKA A;  4OOK A;  2ZSG A;  2BWT A;  2GTX A;  2BWU A;  5JHU A;  5JI6 A;  2GU4 A;  2B3L A;  3BIP A;  3L7G A;  3MX6 A;  2V6C A;  4HXX A;  2P9A A;  2V3Z A;  1R5G A;  3IU9 A;  2P99 A;  4FLI A;  2Q96 A;  2BH3 A;  3BIT A;  3PKB A;  1W2M A;  1KP0 A;  1O0X A;  2G6P A;  2Q95 A;  4RZY A;  2BHD A;  2BHA A;  1PV9 A;  4ZWP A;  3QOC A;  1C22 A;  3I7M A;  1C24 A;  4Z7M A;  1M35 A;  4FLJ A;  2BB7 A;  4S00 A;  2OAZ A;  3IG4 A;  5FCH A;  1C23 A;  4U76 A;  4U6C A;  1R58 A;  1WL6 A;  1Y1N A;  5CLS A;  3ROR A;  2P98 A;  4KM3 A;  4R60 A;  2Q92 A;  3FMR A;  4IKT A;  5CE6 A;  2GG3 A;  2GG0 A;  1XGS A;  2EA4 A;  2EVO A;  3MR1 A;  4U6E A;  4U70 A;  2GG9 A;  3FMQ A;  4U73 A;  1QXZ A;  5D6E A;  2OKN A;  1C27 A;  5FCF A;  1WKM A;  1N51 A;  4ZWO A;  3FM3 A;  1YW8 A;  2BWV A;  2DFI A;  2BWX A;  4S01 A;  3PEB A;  4PV4 A;  4PNC A;  3CB6 A;  3L24 A;  2Q94 A;  1C21 A;  2BWY A;  5CNX A;  4IF7 A;  4U71 A;  2GA2 A;  1QZY A;  1WL9 A;  2GGC A;  4JUQ A;  2HOW A;  5CDV A;  1YW7 A;  2NQ6 A; 
#chains in the Genus database with same CATH topology
 4FLL A;  3IU7 A;  2BN7 A;  2MAT A;  4IKS A;  2EVM A;  4IDY A;  2EVC A;  4U6J A;  2Q8K A;  4QR8 A;  3RVA A;  4MAT A;  2GZ5 A;  4IU6 A;  3Q6D A;  1W7V A;  1WN1 A;  4U75 A;  5CIK A;  4IPA A;  3PKE A;  1WY2 A;  4ZWU A;  4IEC A;  5E5B A;  4RGZ 1;  2GG5 A;  2IW2 A;  4S2T P;  2NQ7 A;  4IKR A;  2GG8 A;  2B3K A;  1YVM A;  1A16 A;  3OOO A;  2GU7 A;  1BN5 A;  3IU8 A;  2BHB A;  2V3Y A;  1WLR A;  4ZNG A;  2BWW A;  1XNZ A;  5CDE A;  4S2R P;  5E2C A;  2GG7 A;  3CTZ A;  4RZZ A;  4A6V A;  3O5V A;  1YW9 A;  1R5H A;  3PN9 A;  2ADU A;  1XGO A;  1B59 A;  5CDL A;  1WBQ A;  1CHM A;  4IKU A;  1XGM A;  4FUK A;  4FO7 A;  2BHC A;  1MAT A;  3CB5 A;  1YJ3 A;  2EA2 A;  2GGB A;  2Q93 A;  3D27 A;  5D6F A;  2GU6 A;  2GU5 A;  3IL0 A;  4U1B A;  4A6W A;  5JFR A;  1QXW A;  1JAW A;  1QXY A;  1BOA A;  2BWS A;  2B3H A;  4FKC A;  4FLK A;  3TB5 A;  4B28 A;  4U69 A;  4EGE A;  1KQ9 A;  3PKD A;  2V3X A;  3OVK A;  4U6Z A;  3TAV A;  1B6A A;  4FO8 A;  1XGN A;  3MAT A;  3BIQ A;  3S6B A;  1KQ0 A;  2GG2 A;  4U6W A;  3PKC A;  3PKA A;  4OOK A;  2ZSG A;  2BWT A;  2GTX A;  2BWU A;  5JHU A;  5JI6 A;  2GU4 A;  2B3L A;  3BIP A;  3L7G A;  3MX6 A;  2V6C A;  4HXX A;  2P9A A;  2V3Z A;  1R5G A;  3IU9 A;  2P99 A;  4FLI A;  2Q96 A;  2BH3 A;  3BIT A;  3PKB A;  1W2M A;  1KP0 A;  1O0X A;  2G6P A;  2Q95 A;  4RZY A;  2BHD A;  2BHA A;  1PV9 A;  4ZWP A;  3QOC A;  1C22 A;  3I7M A;  1C24 A;  4Z7M A;  1M35 A;  4FLJ A;  2BB7 A;  4S00 A;  2OAZ A;  3IG4 A;  5FCH A;  1C23 A;  4U76 A;  4U6C A;  1R58 A;  1WL6 A;  1Y1N A;  5CLS A;  3ROR A;  2P98 A;  4KM3 A;  4R60 A;  2Q92 A;  3FMR A;  4IKT A;  5CE6 A;  2GG3 A;  2GG0 A;  1XGS A;  2EA4 A;  2EVO A;  3MR1 A;  4U6E A;  4U70 A;  2GG9 A;  3FMQ A;  4U73 A;  1QXZ A;  5D6E A;  2OKN A;  1C27 A;  5FCF A;  1WKM A;  1N51 A;  4ZWO A;  3FM3 A;  1YW8 A;  2BWV A;  2DFI A;  2BWX A;  4S01 A;  3PEB A;  4PV4 A;  4PNC A;  3CB6 A;  3L24 A;  2Q94 A;  1C21 A;  2BWY A;  5CNX A;  4IF7 A;  4U71 A;  2GA2 A;  1QZY A;  1WL9 A;  2GGC A;  4JUQ A;  2HOW A;  5CDV A;  1YW7 A;  2NQ6 A; 
#chains in the Genus database with same CATH homology
 4FLL A;  3IU7 A;  2BN7 A;  2MAT A;  4IKS A;  2EVM A;  4IDY A;  2EVC A;  4U6J A;  2Q8K A;  4QR8 A;  3RVA A;  4MAT A;  2GZ5 A;  4IU6 A;  3Q6D A;  1W7V A;  1WN1 A;  4U75 A;  5CIK A;  4IPA A;  3PKE A;  1WY2 A;  4ZWU A;  4IEC A;  5E5B A;  4RGZ 1;  2GG5 A;  2IW2 A;  4S2T P;  2NQ7 A;  4IKR A;  2GG8 A;  2B3K A;  1YVM A;  1A16 A;  3OOO A;  2GU7 A;  1BN5 A;  3IU8 A;  2BHB A;  2V3Y A;  1WLR A;  4ZNG A;  2BWW A;  1XNZ A;  5CDE A;  4S2R P;  5E2C A;  2GG7 A;  3CTZ A;  4RZZ A;  4A6V A;  3O5V A;  1YW9 A;  1R5H A;  3PN9 A;  2ADU A;  1XGO A;  1B59 A;  5CDL A;  1WBQ A;  1CHM A;  4IKU A;  1XGM A;  4FUK A;  4FO7 A;  2BHC A;  1MAT A;  3CB5 A;  1YJ3 A;  2EA2 A;  2GGB A;  2Q93 A;  3D27 A;  5D6F A;  2GU6 A;  2GU5 A;  3IL0 A;  4U1B A;  4A6W A;  5JFR A;  1QXW A;  1JAW A;  1QXY A;  1BOA A;  2BWS A;  2B3H A;  4FKC A;  4FLK A;  3TB5 A;  4B28 A;  4U69 A;  4EGE A;  1KQ9 A;  3PKD A;  2V3X A;  3OVK A;  4U6Z A;  3TAV A;  1B6A A;  4FO8 A;  1XGN A;  3MAT A;  3BIQ A;  3S6B A;  1KQ0 A;  2GG2 A;  4U6W A;  3PKC A;  3PKA A;  4OOK A;  2ZSG A;  2BWT A;  2GTX A;  2BWU A;  5JHU A;  5JI6 A;  2GU4 A;  2B3L A;  3BIP A;  3L7G A;  3MX6 A;  2V6C A;  4HXX A;  2P9A A;  2V3Z A;  1R5G A;  3IU9 A;  2P99 A;  4FLI A;  2Q96 A;  2BH3 A;  3BIT A;  3PKB A;  1W2M A;  1KP0 A;  1O0X A;  2G6P A;  2Q95 A;  4RZY A;  2BHD A;  2BHA A;  1PV9 A;  4ZWP A;  3QOC A;  1C22 A;  3I7M A;  1C24 A;  4Z7M A;  1M35 A;  4FLJ A;  2BB7 A;  4S00 A;  2OAZ A;  3IG4 A;  5FCH A;  1C23 A;  4U76 A;  4U6C A;  1R58 A;  1WL6 A;  1Y1N A;  5CLS A;  3ROR A;  2P98 A;  4KM3 A;  4R60 A;  2Q92 A;  3FMR A;  4IKT A;  5CE6 A;  2GG3 A;  2GG0 A;  1XGS A;  2EA4 A;  2EVO A;  3MR1 A;  4U6E A;  4U70 A;  2GG9 A;  3FMQ A;  4U73 A;  1QXZ A;  5D6E A;  2OKN A;  1C27 A;  5FCF A;  1WKM A;  1N51 A;  4ZWO A;  3FM3 A;  1YW8 A;  2BWV A;  2DFI A;  2BWX A;  4S01 A;  3PEB A;  4PV4 A;  4PNC A;  3CB6 A;  3L24 A;  2Q94 A;  1C21 A;  2BWY A;  5CNX A;  4IF7 A;  4U71 A;  2GA2 A;  1QZY A;  1WL9 A;  2GGC A;  4JUQ A;  2HOW A;  5CDV A;  1YW7 A;  2NQ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...