2BH3A

Zn substituted e. coli aminopeptidase p in complex with product
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 161
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bh3A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bh3A02
4S01A 4U1BA 1C23A 4FO7A 2HOWA 3PKEA 4IPAA 3L24A 3PKBA 2BHDA 4U76A 3MR1A 1WN1A 3IU9A 4PNCA 3L7GA 2NQ7A 2V3YA 3PKAA 5JHUA 2Q96A 2MATA 2V6CA 4U71A 5JI6A 4RZYA 1XGOA 2BWTA 4S2TP 4B28A 1YW8A 2GG5A 3MATA 3RORA 1WKMA 2GU5A 2BHCA 4ZWUA 4FLKA 4U75A 2BWXA 1WL9A 1C27A 1XGSA 2P99A 2NQ6A 2BH3A 2OKNA 2V3XA 2EA4A 1QXYA 2OAZA 3MX6A 4PV4A 2Q95A 3CB6A 4FLLA 4IDYA 2BWSA 3OOOA 2GU7A 3IU7A 4JUQA 2BB7A 4U6EA 4IF7A 2IW2A 4A6WA 2BWYA 1WL6A 4S2RP 4IKTA 2BHBA 3PKCA 2Q93A 3TB5A 1O0XA 4ZWOA 2V3ZA 4IECA 2BHAA 4U6CA 4FUKA 2GG0A 2GG7A 2EA2A 2GGCA 5CLSA 5CIKA 4FLJA 4U70A 4HXXA 4IKSA 1CHMA 2ZSGA 2GU6A 1M35A 3OVKA 1C24A 2GG2A 3FMRA 3Q6DA 4ZNGA 1XGMA 2B3HA 4U69A 3D27A 4U6JA 4U6WA 2Q8KA 2BWVA 1XGNA 3BITA 2DFIA 1R5GA 2EVOA 3PEBA 2BWWA 5CDEA 2EVMA 4FKCA 2GZ5A 4FLIA 2GG9A 3BIQA 2BWUA 5E5BA 5CDLA 4OOKA 4IKRA 5E2CA 2B3KA 1W2MA 1QXZA 4EGEA 4IU6A 2GG3A 1B59A 1WLRA 4RGZ1 1YW7A 2GG8A 2GTXA 4U6ZA 3BIPA 1YJ3A 5CNXA 2B3LA 2BN7A 3O5VA 1C21A 4RZZA 2GA2A 3IG4A 1QZYA 2Q92A 1XNZA 2P9AA 3S6BA 1BOAA 1N51A 1W7VA 3IL0A 5CDVA 1Y1NA 2EVCA 5D6FA 1KQ9A 3I7MA 3QOCA 3CB5A 1BN5A 3FMQA 1R58A 5CE6A 2Q94A 1WBQA 3PN9A 3IU8A 1B6AA 1KQ0A 4Z7MA 2ADUA 3FM3A 4R60A 4QR8A 2G6PA 2GGBA 3PKDA 4MATA 1QXWA 4IKUA 4S00A 2P98A 1YW9A 4KM3A 1KP0A 1PV9A 3CTZA 3TAVA 1WY2A 1A16A 1JAWA 1YVMA 1C22A 1MATA 5FCFA 5FCHA 5D6EA 5JFRA 4FO8A 4A6VA 3RVAA 4ZWPA 4U73A 1R5HA 2GU4A
chains in the Genus database with same CATH superfamily
4S01A 4U1BA 1C23A 4FO7A 2HOWA 3PKEA 4IPAA 3L24A 3PKBA 2BHDA 4U76A 3MR1A 1WN1A 3IU9A 4PNCA 3L7GA 2NQ7A 2V3YA 3PKAA 5JHUA 2Q96A 2MATA 2V6CA 4U71A 5JI6A 4RZYA 1XGOA 2BWTA 4S2TP 4B28A 1YW8A 2GG5A 3MATA 3RORA 1WKMA 2GU5A 2BHCA 4ZWUA 4FLKA 4U75A 2BWXA 1WL9A 1C27A 1XGSA 2P99A 2NQ6A 2BH3A 2OKNA 2V3XA 2EA4A 1QXYA 2OAZA 3MX6A 4PV4A 2Q95A 3CB6A 4FLLA 4IDYA 2BWSA 3OOOA 2GU7A 3IU7A 4JUQA 2BB7A 4U6EA 4IF7A 2IW2A 4A6WA 2BWYA 1WL6A 4S2RP 4IKTA 2BHBA 3PKCA 2Q93A 3TB5A 1O0XA 4ZWOA 2V3ZA 4IECA 2BHAA 4U6CA 4FUKA 2GG0A 2GG7A 2EA2A 2GGCA 5CLSA 5CIKA 4FLJA 4U70A 4HXXA 4IKSA 1CHMA 2ZSGA 2GU6A 1M35A 3OVKA 1C24A 2GG2A 3FMRA 3Q6DA 4ZNGA 1XGMA 2B3HA 4U69A 3D27A 4U6JA 4U6WA 2Q8KA 2BWVA 1XGNA 3BITA 2DFIA 1R5GA 2EVOA 3PEBA 2BWWA 5CDEA 2EVMA 4FKCA 2GZ5A 4FLIA 2GG9A 3BIQA 2BWUA 5E5BA 5CDLA 4OOKA 4IKRA 5E2CA 2B3KA 1W2MA 1QXZA 4EGEA 4IU6A 2GG3A 1B59A 1WLRA 4RGZ1 1YW7A 2GG8A 2GTXA 4U6ZA 3BIPA 1YJ3A 5CNXA 2B3LA 2BN7A 3O5VA 1C21A 4RZZA 2GA2A 3IG4A 1QZYA 2Q92A 1XNZA 2P9AA 3S6BA 1BOAA 1N51A 1W7VA 3IL0A 5CDVA 1Y1NA 2EVCA 5D6FA 1KQ9A 3I7MA 3QOCA 3CB5A 1BN5A 3FMQA 1R58A 5CE6A 2Q94A 1WBQA 3PN9A 3IU8A 1B6AA 1KQ0A 4Z7MA 2ADUA 3FM3A 4R60A 4QR8A 2G6PA 2GGBA 3PKDA 4MATA 1QXWA 4IKUA 4S00A 2P98A 1YW9A 4KM3A 1KP0A 1PV9A 3CTZA 3TAVA 1WY2A 1A16A 1JAWA 1YVMA 1C22A 1MATA 5FCFA 5FCHA 5D6EA 5JFRA 4FO8A 4A6VA 3RVAA 4ZWPA 4U73A 1R5HA 2GU4A
chains in the Genus database with same CATH topology
4S01A 4U1BA 1C23A 4FO7A 2HOWA 3PKEA 4IPAA 3L24A 3PKBA 2BHDA 4U76A 3MR1A 1WN1A 3IU9A 4PNCA 3L7GA 2NQ7A 2V3YA 3PKAA 5JHUA 2Q96A 2MATA 2V6CA 4U71A 5JI6A 4RZYA 1XGOA 2BWTA 4S2TP 4B28A 1YW8A 2GG5A 3MATA 3RORA 1WKMA 2GU5A 2BHCA 4ZWUA 4FLKA 4U75A 2BWXA 1WL9A 1C27A 1XGSA 2P99A 2NQ6A 2BH3A 2OKNA 2V3XA 2EA4A 1QXYA 2OAZA 3MX6A 4PV4A 2Q95A 3CB6A 4FLLA 4IDYA 2BWSA 3OOOA 2GU7A 3IU7A 4JUQA 2BB7A 4U6EA 4IF7A 2IW2A 4A6WA 2BWYA 1WL6A 4S2RP 4IKTA 2BHBA 3PKCA 2Q93A 3TB5A 1O0XA 4ZWOA 2V3ZA 4IECA 2BHAA 4U6CA 4FUKA 2GG0A 2GG7A 2EA2A 2GGCA 5CLSA 5CIKA 4FLJA 4U70A 4HXXA 4IKSA 1CHMA 2ZSGA 2GU6A 1M35A 3OVKA 1C24A 2GG2A 3FMRA 3Q6DA 4ZNGA 1XGMA 2B3HA 4U69A 3D27A 4U6JA 4U6WA 2Q8KA 2BWVA 1XGNA 3BITA 2DFIA 1R5GA 2EVOA 3PEBA 2BWWA 5CDEA 2EVMA 4FKCA 2GZ5A 4FLIA 2GG9A 3BIQA 2BWUA 5E5BA 5CDLA 4OOKA 4IKRA 5E2CA 2B3KA 1W2MA 1QXZA 4EGEA 4IU6A 2GG3A 1B59A 1WLRA 4RGZ1 1YW7A 2GG8A 2GTXA 4U6ZA 3BIPA 1YJ3A 5CNXA 2B3LA 2BN7A 3O5VA 1C21A 4RZZA 2GA2A 3IG4A 1QZYA 2Q92A 1XNZA 2P9AA 3S6BA 1BOAA 1N51A 1W7VA 3IL0A 5CDVA 1Y1NA 2EVCA 5D6FA 1KQ9A 3I7MA 3QOCA 3CB5A 1BN5A 3FMQA 1R58A 5CE6A 2Q94A 1WBQA 3PN9A 3IU8A 1B6AA 1KQ0A 4Z7MA 2ADUA 3FM3A 4R60A 4QR8A 2G6PA 2GGBA 3PKDA 4MATA 1QXWA 4IKUA 4S00A 2P98A 1YW9A 4KM3A 1KP0A 1PV9A 3CTZA 3TAVA 1WY2A 1A16A 1JAWA 1YVMA 1C22A 1MATA 5FCFA 5FCHA 5D6EA 5JFRA 4FO8A 4A6VA 3RVAA 4ZWPA 4U73A 1R5HA 2GU4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S01 A;  4U1B A;  1C23 A;  4FO7 A;  2HOW A;  3PKE A;  4IPA A;  3L24 A;  3PKB A;  2BHD A;  4U76 A;  3MR1 A;  1WN1 A;  3IU9 A;  4PNC A;  3L7G A;  2NQ7 A;  2V3Y A;  3PKA A;  5JHU A;  2Q96 A;  2MAT A;  2V6C A;  4U71 A;  5JI6 A;  4RZY A;  1XGO A;  2BWT A;  4S2T P;  4B28 A;  1YW8 A;  2GG5 A;  3MAT A;  3ROR A;  1WKM A;  2GU5 A;  2BHC A;  4ZWU A;  4FLK A;  4U75 A;  2BWX A;  1WL9 A;  1C27 A;  1XGS A;  2P99 A;  2NQ6 A;  2BH3 A;  2OKN A;  2V3X A;  2EA4 A;  1QXY A;  2OAZ A;  3MX6 A;  4PV4 A;  2Q95 A;  3CB6 A;  4FLL A;  4IDY A;  2BWS A;  3OOO A;  2GU7 A;  3IU7 A;  4JUQ A;  2BB7 A;  4U6E A;  4IF7 A;  2IW2 A;  4A6W A;  2BWY A;  1WL6 A;  4S2R P;  4IKT A;  2BHB A;  3PKC A;  2Q93 A;  3TB5 A;  1O0X A;  4ZWO A;  2V3Z A;  4IEC A;  2BHA A;  4U6C A;  4FUK A;  2GG0 A;  2GG7 A;  2EA2 A;  2GGC A;  5CLS A;  5CIK A;  4FLJ A;  4U70 A;  4HXX A;  4IKS A;  1CHM A;  2ZSG A;  2GU6 A;  1M35 A;  3OVK A;  1C24 A;  2GG2 A;  3FMR A;  3Q6D A;  4ZNG A;  1XGM A;  2B3H A;  4U69 A;  3D27 A;  4U6J A;  4U6W A;  2Q8K A;  2BWV A;  1XGN A;  3BIT A;  2DFI A;  1R5G A;  2EVO A;  3PEB A;  2BWW A;  5CDE A;  2EVM A;  4FKC A;  2GZ5 A;  4FLI A;  2GG9 A;  3BIQ A;  2BWU A;  5E5B A;  5CDL A;  4OOK A;  4IKR A;  5E2C A;  2B3K A;  1W2M A;  1QXZ A;  4EGE A;  4IU6 A;  2GG3 A;  1B59 A;  1WLR A;  4RGZ 1;  1YW7 A;  2GG8 A;  2GTX A;  4U6Z A;  3BIP A;  1YJ3 A;  5CNX A;  2B3L A;  2BN7 A;  3O5V A;  1C21 A;  4RZZ A;  2GA2 A;  3IG4 A;  1QZY A;  2Q92 A;  1XNZ A;  2P9A A;  3S6B A;  1BOA A;  1N51 A;  1W7V A;  3IL0 A;  5CDV A;  1Y1N A;  2EVC A;  5D6F A;  1KQ9 A;  3I7M A;  3QOC A;  3CB5 A;  1BN5 A;  3FMQ A;  1R58 A;  5CE6 A;  2Q94 A;  1WBQ A;  3PN9 A;  3IU8 A;  1B6A A;  1KQ0 A;  4Z7M A;  2ADU A;  3FM3 A;  4R60 A;  4QR8 A;  2G6P A;  2GGB A;  3PKD A;  4MAT A;  1QXW A;  4IKU A;  4S00 A;  2P98 A;  1YW9 A;  4KM3 A;  1KP0 A;  1PV9 A;  3CTZ A;  3TAV A;  1WY2 A;  1A16 A;  1JAW A;  1YVM A;  1C22 A;  1MAT A;  5FCF A;  5FCH A;  5D6E A;  5JFR A;  4FO8 A;  4A6V A;  3RVA A;  4ZWP A;  4U73 A;  1R5H A;  2GU4 A; 
#chains in the Genus database with same CATH topology
 4S01 A;  4U1B A;  1C23 A;  4FO7 A;  2HOW A;  3PKE A;  4IPA A;  3L24 A;  3PKB A;  2BHD A;  4U76 A;  3MR1 A;  1WN1 A;  3IU9 A;  4PNC A;  3L7G A;  2NQ7 A;  2V3Y A;  3PKA A;  5JHU A;  2Q96 A;  2MAT A;  2V6C A;  4U71 A;  5JI6 A;  4RZY A;  1XGO A;  2BWT A;  4S2T P;  4B28 A;  1YW8 A;  2GG5 A;  3MAT A;  3ROR A;  1WKM A;  2GU5 A;  2BHC A;  4ZWU A;  4FLK A;  4U75 A;  2BWX A;  1WL9 A;  1C27 A;  1XGS A;  2P99 A;  2NQ6 A;  2BH3 A;  2OKN A;  2V3X A;  2EA4 A;  1QXY A;  2OAZ A;  3MX6 A;  4PV4 A;  2Q95 A;  3CB6 A;  4FLL A;  4IDY A;  2BWS A;  3OOO A;  2GU7 A;  3IU7 A;  4JUQ A;  2BB7 A;  4U6E A;  4IF7 A;  2IW2 A;  4A6W A;  2BWY A;  1WL6 A;  4S2R P;  4IKT A;  2BHB A;  3PKC A;  2Q93 A;  3TB5 A;  1O0X A;  4ZWO A;  2V3Z A;  4IEC A;  2BHA A;  4U6C A;  4FUK A;  2GG0 A;  2GG7 A;  2EA2 A;  2GGC A;  5CLS A;  5CIK A;  4FLJ A;  4U70 A;  4HXX A;  4IKS A;  1CHM A;  2ZSG A;  2GU6 A;  1M35 A;  3OVK A;  1C24 A;  2GG2 A;  3FMR A;  3Q6D A;  4ZNG A;  1XGM A;  2B3H A;  4U69 A;  3D27 A;  4U6J A;  4U6W A;  2Q8K A;  2BWV A;  1XGN A;  3BIT A;  2DFI A;  1R5G A;  2EVO A;  3PEB A;  2BWW A;  5CDE A;  2EVM A;  4FKC A;  2GZ5 A;  4FLI A;  2GG9 A;  3BIQ A;  2BWU A;  5E5B A;  5CDL A;  4OOK A;  4IKR A;  5E2C A;  2B3K A;  1W2M A;  1QXZ A;  4EGE A;  4IU6 A;  2GG3 A;  1B59 A;  1WLR A;  4RGZ 1;  1YW7 A;  2GG8 A;  2GTX A;  4U6Z A;  3BIP A;  1YJ3 A;  5CNX A;  2B3L A;  2BN7 A;  3O5V A;  1C21 A;  4RZZ A;  2GA2 A;  3IG4 A;  1QZY A;  2Q92 A;  1XNZ A;  2P9A A;  3S6B A;  1BOA A;  1N51 A;  1W7V A;  3IL0 A;  5CDV A;  1Y1N A;  2EVC A;  5D6F A;  1KQ9 A;  3I7M A;  3QOC A;  3CB5 A;  1BN5 A;  3FMQ A;  1R58 A;  5CE6 A;  2Q94 A;  1WBQ A;  3PN9 A;  3IU8 A;  1B6A A;  1KQ0 A;  4Z7M A;  2ADU A;  3FM3 A;  4R60 A;  4QR8 A;  2G6P A;  2GGB A;  3PKD A;  4MAT A;  1QXW A;  4IKU A;  4S00 A;  2P98 A;  1YW9 A;  4KM3 A;  1KP0 A;  1PV9 A;  3CTZ A;  3TAV A;  1WY2 A;  1A16 A;  1JAW A;  1YVM A;  1C22 A;  1MAT A;  5FCF A;  5FCH A;  5D6E A;  5JFR A;  4FO8 A;  4A6V A;  3RVA A;  4ZWP A;  4U73 A;  1R5H A;  2GU4 A; 
#chains in the Genus database with same CATH homology
 4S01 A;  4U1B A;  1C23 A;  4FO7 A;  2HOW A;  3PKE A;  4IPA A;  3L24 A;  3PKB A;  2BHD A;  4U76 A;  3MR1 A;  1WN1 A;  3IU9 A;  4PNC A;  3L7G A;  2NQ7 A;  2V3Y A;  3PKA A;  5JHU A;  2Q96 A;  2MAT A;  2V6C A;  4U71 A;  5JI6 A;  4RZY A;  1XGO A;  2BWT A;  4S2T P;  4B28 A;  1YW8 A;  2GG5 A;  3MAT A;  3ROR A;  1WKM A;  2GU5 A;  2BHC A;  4ZWU A;  4FLK A;  4U75 A;  2BWX A;  1WL9 A;  1C27 A;  1XGS A;  2P99 A;  2NQ6 A;  2BH3 A;  2OKN A;  2V3X A;  2EA4 A;  1QXY A;  2OAZ A;  3MX6 A;  4PV4 A;  2Q95 A;  3CB6 A;  4FLL A;  4IDY A;  2BWS A;  3OOO A;  2GU7 A;  3IU7 A;  4JUQ A;  2BB7 A;  4U6E A;  4IF7 A;  2IW2 A;  4A6W A;  2BWY A;  1WL6 A;  4S2R P;  4IKT A;  2BHB A;  3PKC A;  2Q93 A;  3TB5 A;  1O0X A;  4ZWO A;  2V3Z A;  4IEC A;  2BHA A;  4U6C A;  4FUK A;  2GG0 A;  2GG7 A;  2EA2 A;  2GGC A;  5CLS A;  5CIK A;  4FLJ A;  4U70 A;  4HXX A;  4IKS A;  1CHM A;  2ZSG A;  2GU6 A;  1M35 A;  3OVK A;  1C24 A;  2GG2 A;  3FMR A;  3Q6D A;  4ZNG A;  1XGM A;  2B3H A;  4U69 A;  3D27 A;  4U6J A;  4U6W A;  2Q8K A;  2BWV A;  1XGN A;  3BIT A;  2DFI A;  1R5G A;  2EVO A;  3PEB A;  2BWW A;  5CDE A;  2EVM A;  4FKC A;  2GZ5 A;  4FLI A;  2GG9 A;  3BIQ A;  2BWU A;  5E5B A;  5CDL A;  4OOK A;  4IKR A;  5E2C A;  2B3K A;  1W2M A;  1QXZ A;  4EGE A;  4IU6 A;  2GG3 A;  1B59 A;  1WLR A;  4RGZ 1;  1YW7 A;  2GG8 A;  2GTX A;  4U6Z A;  3BIP A;  1YJ3 A;  5CNX A;  2B3L A;  2BN7 A;  3O5V A;  1C21 A;  4RZZ A;  2GA2 A;  3IG4 A;  1QZY A;  2Q92 A;  1XNZ A;  2P9A A;  3S6B A;  1BOA A;  1N51 A;  1W7V A;  3IL0 A;  5CDV A;  1Y1N A;  2EVC A;  5D6F A;  1KQ9 A;  3I7M A;  3QOC A;  3CB5 A;  1BN5 A;  3FMQ A;  1R58 A;  5CE6 A;  2Q94 A;  1WBQ A;  3PN9 A;  3IU8 A;  1B6A A;  1KQ0 A;  4Z7M A;  2ADU A;  3FM3 A;  4R60 A;  4QR8 A;  2G6P A;  2GGB A;  3PKD A;  4MAT A;  1QXW A;  4IKU A;  4S00 A;  2P98 A;  1YW9 A;  4KM3 A;  1KP0 A;  1PV9 A;  3CTZ A;  3TAV A;  1WY2 A;  1A16 A;  1JAW A;  1YVM A;  1C22 A;  1MAT A;  5FCF A;  5FCH A;  5D6E A;  5JFR A;  4FO8 A;  4A6V A;  3RVA A;  4ZWP A;  4U73 A;  1R5H A;  2GU4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...