2BH3A

Zn substituted e. coli aminopeptidase p in complex with product
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 161
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bh3A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bh3A02
3PKBA 1WY2A 3BIPA 5D6EA 4FLKA 2GG9A 2G6PA 2EA2A 2ADUA 2EVMA 3D27A 3S6BA 2BHBA 2GA2A 3IU8A 2BWUA 2Q94A 3PKEA 2BWWA 4U76A 4U6CA 4RGZ1 2GU6A 3MATA 2NQ7A 4JUQA 4U6WA 2ZSGA 3TB5A 1KQ0A 3FM3A 5D6FA 3QOCA 1B59A 3OOOA 2DFIA 1C27A 1O0XA 1QZYA 1WKMA 3IU7A 1C24A 4PV4A 1A16A 2OAZA 1WN1A 2V3ZA 5CDLA 1Y1NA 2BWSA 2V3XA 5CLSA 5CNXA 3TAVA 2GG0A 2P99A 2GG7A 1BN5A 4EGEA 2Q8KA 2EVCA 3FMRA 5CE6A 5CDVA 3FMQA 4U6ZA 2EA4A 1PV9A 3I7MA 1WL6A 2GGCA 4KM3A 1QXWA 4IKTA 2P98A 3IG4A 3CB6A 4RZYA 2NQ6A 3BITA 4U73A 2B3HA 1YVMA 2BWVA 1WL9A 3MR1A 5CIKA 1YW9A 1R5GA 2Q96A 2EVOA 4FLJA 3RORA 4A6WA 1CHMA 4ZWOA 2BN7A 3MX6A 2BWXA 3L24A 2P9AA 4IKRA 5JFRA 1KP0A 3BIQA 4MATA 1YW8A 5JHUA 2HOWA 4FKCA 1W2MA 1W7VA 1MATA 1C21A 1N51A 4FO7A 4FLLA 4IU6A 4S2RP 1R5HA 2Q95A 2BWTA 1BOAA 2GG8A 1XGOA 2BH3A 5FCHA 4FO8A 2BHCA 3OVKA 4U69A 1KQ9A 4ZWPA 2IW2A 2B3LA 4HXXA 4U1BA 3PN9A 3Q6DA 5FCFA 4RZZA 1C22A 1YW7A 2GU5A 4QR8A 4A6VA 4U6EA 4U6JA 4Z7MA 5E2CA 1B6AA 3CTZA 2Q93A 3IL0A 2BHDA 3PKDA 2GG2A 1XNZA 4FUKA 4S00A 2B3KA 2BB7A 5E5BA 1C23A 4B28A 4OOKA 3PKCA 2GZ5A 1XGMA 2GG3A 2GU7A 4IF7A 1R58A 3RVAA 4S2TP 1WLRA 5CDEA 4U75A 4IPAA 5JI6A 4S01A 3IU9A 2GTXA 4ZNGA 2OKNA 4IECA 2GU4A 1XGNA 1JAWA 2V6CA 1QXZA 3L7GA 4U70A 1M35A 2V3YA 1XGSA 2Q92A 2BWYA 4IDYA 3CB5A 4PNCA 2GG5A 4R60A 1WBQA 2MATA 3PKAA 4ZWUA 4U71A 4FLIA 4IKSA 3O5VA 3PEBA 2BHAA 1QXYA 2GGBA 1YJ3A 4IKUA
chains in the Genus database with same CATH superfamily
3PKBA 1WY2A 3BIPA 5D6EA 4FLKA 2GG9A 2G6PA 2EA2A 2ADUA 2EVMA 3D27A 3S6BA 2BHBA 2GA2A 3IU8A 2BWUA 2Q94A 3PKEA 2BWWA 4U76A 4U6CA 4RGZ1 2GU6A 3MATA 2NQ7A 4JUQA 4U6WA 2ZSGA 3TB5A 1KQ0A 3FM3A 5D6FA 3QOCA 1B59A 3OOOA 2DFIA 1C27A 1O0XA 1QZYA 1WKMA 3IU7A 1C24A 4PV4A 1A16A 2OAZA 1WN1A 2V3ZA 5CDLA 1Y1NA 2BWSA 2V3XA 5CLSA 5CNXA 3TAVA 2GG0A 2P99A 2GG7A 1BN5A 4EGEA 2Q8KA 2EVCA 3FMRA 5CE6A 5CDVA 3FMQA 4U6ZA 2EA4A 1PV9A 3I7MA 1WL6A 2GGCA 4KM3A 1QXWA 4IKTA 2P98A 3IG4A 3CB6A 4RZYA 2NQ6A 3BITA 4U73A 2B3HA 1YVMA 2BWVA 1WL9A 3MR1A 5CIKA 1YW9A 1R5GA 2Q96A 2EVOA 4FLJA 3RORA 4A6WA 1CHMA 4ZWOA 2BN7A 3MX6A 2BWXA 3L24A 2P9AA 4IKRA 5JFRA 1KP0A 3BIQA 4MATA 1YW8A 5JHUA 2HOWA 4FKCA 1W2MA 1W7VA 1MATA 1C21A 1N51A 4FO7A 4FLLA 4IU6A 4S2RP 1R5HA 2Q95A 2BWTA 1BOAA 2GG8A 1XGOA 2BH3A 5FCHA 4FO8A 2BHCA 3OVKA 4U69A 1KQ9A 4ZWPA 2IW2A 2B3LA 4HXXA 4U1BA 3PN9A 3Q6DA 5FCFA 4RZZA 1C22A 1YW7A 2GU5A 4QR8A 4A6VA 4U6EA 4U6JA 4Z7MA 5E2CA 1B6AA 3CTZA 2Q93A 3IL0A 2BHDA 3PKDA 2GG2A 1XNZA 4FUKA 4S00A 2B3KA 2BB7A 5E5BA 1C23A 4B28A 4OOKA 3PKCA 2GZ5A 1XGMA 2GG3A 2GU7A 4IF7A 1R58A 3RVAA 4S2TP 1WLRA 5CDEA 4U75A 4IPAA 5JI6A 4S01A 3IU9A 2GTXA 4ZNGA 2OKNA 4IECA 2GU4A 1XGNA 1JAWA 2V6CA 1QXZA 3L7GA 4U70A 1M35A 2V3YA 1XGSA 2Q92A 2BWYA 4IDYA 3CB5A 4PNCA 2GG5A 4R60A 1WBQA 2MATA 3PKAA 4ZWUA 4U71A 4FLIA 4IKSA 3O5VA 3PEBA 2BHAA 1QXYA 2GGBA 1YJ3A 4IKUA
chains in the Genus database with same CATH topology
3PKBA 1WY2A 3BIPA 5D6EA 4FLKA 2GG9A 2G6PA 2EA2A 2ADUA 2EVMA 3D27A 3S6BA 2BHBA 2GA2A 3IU8A 2BWUA 2Q94A 3PKEA 2BWWA 4U76A 4U6CA 4RGZ1 2GU6A 3MATA 2NQ7A 4JUQA 4U6WA 2ZSGA 3TB5A 1KQ0A 3FM3A 5D6FA 3QOCA 1B59A 3OOOA 2DFIA 1C27A 1O0XA 1QZYA 1WKMA 3IU7A 1C24A 4PV4A 1A16A 2OAZA 1WN1A 2V3ZA 5CDLA 1Y1NA 2BWSA 2V3XA 5CLSA 5CNXA 3TAVA 2GG0A 2P99A 2GG7A 1BN5A 4EGEA 2Q8KA 2EVCA 3FMRA 5CE6A 5CDVA 3FMQA 4U6ZA 2EA4A 1PV9A 3I7MA 1WL6A 2GGCA 4KM3A 1QXWA 4IKTA 2P98A 3IG4A 3CB6A 4RZYA 2NQ6A 3BITA 4U73A 2B3HA 1YVMA 2BWVA 1WL9A 3MR1A 5CIKA 1YW9A 1R5GA 2Q96A 2EVOA 4FLJA 3RORA 4A6WA 1CHMA 4ZWOA 2BN7A 3MX6A 2BWXA 3L24A 2P9AA 4IKRA 5JFRA 1KP0A 3BIQA 4MATA 1YW8A 5JHUA 2HOWA 4FKCA 1W2MA 1W7VA 1MATA 1C21A 1N51A 4FO7A 4FLLA 4IU6A 4S2RP 1R5HA 2Q95A 2BWTA 1BOAA 2GG8A 1XGOA 2BH3A 5FCHA 4FO8A 2BHCA 3OVKA 4U69A 1KQ9A 4ZWPA 2IW2A 2B3LA 4HXXA 4U1BA 3PN9A 3Q6DA 5FCFA 4RZZA 1C22A 1YW7A 2GU5A 4QR8A 4A6VA 4U6EA 4U6JA 4Z7MA 5E2CA 1B6AA 3CTZA 2Q93A 3IL0A 2BHDA 3PKDA 2GG2A 1XNZA 4FUKA 4S00A 2B3KA 2BB7A 5E5BA 1C23A 4B28A 4OOKA 3PKCA 2GZ5A 1XGMA 2GG3A 2GU7A 4IF7A 1R58A 3RVAA 4S2TP 1WLRA 5CDEA 4U75A 4IPAA 5JI6A 4S01A 3IU9A 2GTXA 4ZNGA 2OKNA 4IECA 2GU4A 1XGNA 1JAWA 2V6CA 1QXZA 3L7GA 4U70A 1M35A 2V3YA 1XGSA 2Q92A 2BWYA 4IDYA 3CB5A 4PNCA 2GG5A 4R60A 1WBQA 2MATA 3PKAA 4ZWUA 4U71A 4FLIA 4IKSA 3O5VA 3PEBA 2BHAA 1QXYA 2GGBA 1YJ3A 4IKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PKB A;  1WY2 A;  3BIP A;  5D6E A;  4FLK A;  2GG9 A;  2G6P A;  2EA2 A;  2ADU A;  2EVM A;  3D27 A;  3S6B A;  2BHB A;  2GA2 A;  3IU8 A;  2BWU A;  2Q94 A;  3PKE A;  2BWW A;  4U76 A;  4U6C A;  4RGZ 1;  2GU6 A;  3MAT A;  2NQ7 A;  4JUQ A;  4U6W A;  2ZSG A;  3TB5 A;  1KQ0 A;  3FM3 A;  5D6F A;  3QOC A;  1B59 A;  3OOO A;  2DFI A;  1C27 A;  1O0X A;  1QZY A;  1WKM A;  3IU7 A;  1C24 A;  4PV4 A;  1A16 A;  2OAZ A;  1WN1 A;  2V3Z A;  5CDL A;  1Y1N A;  2BWS A;  2V3X A;  5CLS A;  5CNX A;  3TAV A;  2GG0 A;  2P99 A;  2GG7 A;  1BN5 A;  4EGE A;  2Q8K A;  2EVC A;  3FMR A;  5CE6 A;  5CDV A;  3FMQ A;  4U6Z A;  2EA4 A;  1PV9 A;  3I7M A;  1WL6 A;  2GGC A;  4KM3 A;  1QXW A;  4IKT A;  2P98 A;  3IG4 A;  3CB6 A;  4RZY A;  2NQ6 A;  3BIT A;  4U73 A;  2B3H A;  1YVM A;  2BWV A;  1WL9 A;  3MR1 A;  5CIK A;  1YW9 A;  1R5G A;  2Q96 A;  2EVO A;  4FLJ A;  3ROR A;  4A6W A;  1CHM A;  4ZWO A;  2BN7 A;  3MX6 A;  2BWX A;  3L24 A;  2P9A A;  4IKR A;  5JFR A;  1KP0 A;  3BIQ A;  4MAT A;  1YW8 A;  5JHU A;  2HOW A;  4FKC A;  1W2M A;  1W7V A;  1MAT A;  1C21 A;  1N51 A;  4FO7 A;  4FLL A;  4IU6 A;  4S2R P;  1R5H A;  2Q95 A;  2BWT A;  1BOA A;  2GG8 A;  1XGO A;  2BH3 A;  5FCH A;  4FO8 A;  2BHC A;  3OVK A;  4U69 A;  1KQ9 A;  4ZWP A;  2IW2 A;  2B3L A;  4HXX A;  4U1B A;  3PN9 A;  3Q6D A;  5FCF A;  4RZZ A;  1C22 A;  1YW7 A;  2GU5 A;  4QR8 A;  4A6V A;  4U6E A;  4U6J A;  4Z7M A;  5E2C A;  1B6A A;  3CTZ A;  2Q93 A;  3IL0 A;  2BHD A;  3PKD A;  2GG2 A;  1XNZ A;  4FUK A;  4S00 A;  2B3K A;  2BB7 A;  5E5B A;  1C23 A;  4B28 A;  4OOK A;  3PKC A;  2GZ5 A;  1XGM A;  2GG3 A;  2GU7 A;  4IF7 A;  1R58 A;  3RVA A;  4S2T P;  1WLR A;  5CDE A;  4U75 A;  4IPA A;  5JI6 A;  4S01 A;  3IU9 A;  2GTX A;  4ZNG A;  2OKN A;  4IEC A;  2GU4 A;  1XGN A;  1JAW A;  2V6C A;  1QXZ A;  3L7G A;  4U70 A;  1M35 A;  2V3Y A;  1XGS A;  2Q92 A;  2BWY A;  4IDY A;  3CB5 A;  4PNC A;  2GG5 A;  4R60 A;  1WBQ A;  2MAT A;  3PKA A;  4ZWU A;  4U71 A;  4FLI A;  4IKS A;  3O5V A;  3PEB A;  2BHA A;  1QXY A;  2GGB A;  1YJ3 A;  4IKU A; 
#chains in the Genus database with same CATH topology
 3PKB A;  1WY2 A;  3BIP A;  5D6E A;  4FLK A;  2GG9 A;  2G6P A;  2EA2 A;  2ADU A;  2EVM A;  3D27 A;  3S6B A;  2BHB A;  2GA2 A;  3IU8 A;  2BWU A;  2Q94 A;  3PKE A;  2BWW A;  4U76 A;  4U6C A;  4RGZ 1;  2GU6 A;  3MAT A;  2NQ7 A;  4JUQ A;  4U6W A;  2ZSG A;  3TB5 A;  1KQ0 A;  3FM3 A;  5D6F A;  3QOC A;  1B59 A;  3OOO A;  2DFI A;  1C27 A;  1O0X A;  1QZY A;  1WKM A;  3IU7 A;  1C24 A;  4PV4 A;  1A16 A;  2OAZ A;  1WN1 A;  2V3Z A;  5CDL A;  1Y1N A;  2BWS A;  2V3X A;  5CLS A;  5CNX A;  3TAV A;  2GG0 A;  2P99 A;  2GG7 A;  1BN5 A;  4EGE A;  2Q8K A;  2EVC A;  3FMR A;  5CE6 A;  5CDV A;  3FMQ A;  4U6Z A;  2EA4 A;  1PV9 A;  3I7M A;  1WL6 A;  2GGC A;  4KM3 A;  1QXW A;  4IKT A;  2P98 A;  3IG4 A;  3CB6 A;  4RZY A;  2NQ6 A;  3BIT A;  4U73 A;  2B3H A;  1YVM A;  2BWV A;  1WL9 A;  3MR1 A;  5CIK A;  1YW9 A;  1R5G A;  2Q96 A;  2EVO A;  4FLJ A;  3ROR A;  4A6W A;  1CHM A;  4ZWO A;  2BN7 A;  3MX6 A;  2BWX A;  3L24 A;  2P9A A;  4IKR A;  5JFR A;  1KP0 A;  3BIQ A;  4MAT A;  1YW8 A;  5JHU A;  2HOW A;  4FKC A;  1W2M A;  1W7V A;  1MAT A;  1C21 A;  1N51 A;  4FO7 A;  4FLL A;  4IU6 A;  4S2R P;  1R5H A;  2Q95 A;  2BWT A;  1BOA A;  2GG8 A;  1XGO A;  2BH3 A;  5FCH A;  4FO8 A;  2BHC A;  3OVK A;  4U69 A;  1KQ9 A;  4ZWP A;  2IW2 A;  2B3L A;  4HXX A;  4U1B A;  3PN9 A;  3Q6D A;  5FCF A;  4RZZ A;  1C22 A;  1YW7 A;  2GU5 A;  4QR8 A;  4A6V A;  4U6E A;  4U6J A;  4Z7M A;  5E2C A;  1B6A A;  3CTZ A;  2Q93 A;  3IL0 A;  2BHD A;  3PKD A;  2GG2 A;  1XNZ A;  4FUK A;  4S00 A;  2B3K A;  2BB7 A;  5E5B A;  1C23 A;  4B28 A;  4OOK A;  3PKC A;  2GZ5 A;  1XGM A;  2GG3 A;  2GU7 A;  4IF7 A;  1R58 A;  3RVA A;  4S2T P;  1WLR A;  5CDE A;  4U75 A;  4IPA A;  5JI6 A;  4S01 A;  3IU9 A;  2GTX A;  4ZNG A;  2OKN A;  4IEC A;  2GU4 A;  1XGN A;  1JAW A;  2V6C A;  1QXZ A;  3L7G A;  4U70 A;  1M35 A;  2V3Y A;  1XGS A;  2Q92 A;  2BWY A;  4IDY A;  3CB5 A;  4PNC A;  2GG5 A;  4R60 A;  1WBQ A;  2MAT A;  3PKA A;  4ZWU A;  4U71 A;  4FLI A;  4IKS A;  3O5V A;  3PEB A;  2BHA A;  1QXY A;  2GGB A;  1YJ3 A;  4IKU A; 
#chains in the Genus database with same CATH homology
 3PKB A;  1WY2 A;  3BIP A;  5D6E A;  4FLK A;  2GG9 A;  2G6P A;  2EA2 A;  2ADU A;  2EVM A;  3D27 A;  3S6B A;  2BHB A;  2GA2 A;  3IU8 A;  2BWU A;  2Q94 A;  3PKE A;  2BWW A;  4U76 A;  4U6C A;  4RGZ 1;  2GU6 A;  3MAT A;  2NQ7 A;  4JUQ A;  4U6W A;  2ZSG A;  3TB5 A;  1KQ0 A;  3FM3 A;  5D6F A;  3QOC A;  1B59 A;  3OOO A;  2DFI A;  1C27 A;  1O0X A;  1QZY A;  1WKM A;  3IU7 A;  1C24 A;  4PV4 A;  1A16 A;  2OAZ A;  1WN1 A;  2V3Z A;  5CDL A;  1Y1N A;  2BWS A;  2V3X A;  5CLS A;  5CNX A;  3TAV A;  2GG0 A;  2P99 A;  2GG7 A;  1BN5 A;  4EGE A;  2Q8K A;  2EVC A;  3FMR A;  5CE6 A;  5CDV A;  3FMQ A;  4U6Z A;  2EA4 A;  1PV9 A;  3I7M A;  1WL6 A;  2GGC A;  4KM3 A;  1QXW A;  4IKT A;  2P98 A;  3IG4 A;  3CB6 A;  4RZY A;  2NQ6 A;  3BIT A;  4U73 A;  2B3H A;  1YVM A;  2BWV A;  1WL9 A;  3MR1 A;  5CIK A;  1YW9 A;  1R5G A;  2Q96 A;  2EVO A;  4FLJ A;  3ROR A;  4A6W A;  1CHM A;  4ZWO A;  2BN7 A;  3MX6 A;  2BWX A;  3L24 A;  2P9A A;  4IKR A;  5JFR A;  1KP0 A;  3BIQ A;  4MAT A;  1YW8 A;  5JHU A;  2HOW A;  4FKC A;  1W2M A;  1W7V A;  1MAT A;  1C21 A;  1N51 A;  4FO7 A;  4FLL A;  4IU6 A;  4S2R P;  1R5H A;  2Q95 A;  2BWT A;  1BOA A;  2GG8 A;  1XGO A;  2BH3 A;  5FCH A;  4FO8 A;  2BHC A;  3OVK A;  4U69 A;  1KQ9 A;  4ZWP A;  2IW2 A;  2B3L A;  4HXX A;  4U1B A;  3PN9 A;  3Q6D A;  5FCF A;  4RZZ A;  1C22 A;  1YW7 A;  2GU5 A;  4QR8 A;  4A6V A;  4U6E A;  4U6J A;  4Z7M A;  5E2C A;  1B6A A;  3CTZ A;  2Q93 A;  3IL0 A;  2BHD A;  3PKD A;  2GG2 A;  1XNZ A;  4FUK A;  4S00 A;  2B3K A;  2BB7 A;  5E5B A;  1C23 A;  4B28 A;  4OOK A;  3PKC A;  2GZ5 A;  1XGM A;  2GG3 A;  2GU7 A;  4IF7 A;  1R58 A;  3RVA A;  4S2T P;  1WLR A;  5CDE A;  4U75 A;  4IPA A;  5JI6 A;  4S01 A;  3IU9 A;  2GTX A;  4ZNG A;  2OKN A;  4IEC A;  2GU4 A;  1XGN A;  1JAW A;  2V6C A;  1QXZ A;  3L7G A;  4U70 A;  1M35 A;  2V3Y A;  1XGS A;  2Q92 A;  2BWY A;  4IDY A;  3CB5 A;  4PNC A;  2GG5 A;  4R60 A;  1WBQ A;  2MAT A;  3PKA A;  4ZWU A;  4U71 A;  4FLI A;  4IKS A;  3O5V A;  3PEB A;  2BHA A;  1QXY A;  2GGB A;  1YJ3 A;  4IKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...