2BH3A

Zn substituted e. coli aminopeptidase p in complex with product
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 161
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bh3A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bh3A02
3IG4A 1M35A 3PEBA 5CDEA 2GU7A 1WY2A 5CNXA 1R58A 2EA2A 3QOCA 5CDVA 2GGCA 2Q96A 4IKTA 3S6BA 1WKMA 1YW7A 5FCFA 2P99A 2BWYA 2DFIA 3D27A 2BHDA 2BHBA 5E5BA 2P98A 1QZYA 1MATA 3I7MA 1QXZA 4FKCA 3IU9A 4FLJA 5E2CA 1O0XA 1XGMA 4S2TP 4U6WA 1JAWA 1CHMA 2V3XA 1C21A 2GU5A 2B3KA 2BWWA 1BOAA 2GG2A 4FO8A 2Q8KA 2BN7A 3FMQA 2Q95A 3PKEA 3PKBA 4FLLA 3MR1A 3CB6A 1BN5A 4QR8A 5D6EA 1B59A 5JI6A 1WL9A 4U6EA 3PKAA 4U75A 4ZNGA 3BIQA 2V3ZA 3CTZA 1KQ9A 4R60A 3Q6DA 2GG8A 4PNCA 4JUQA 2ZSGA 5JFRA 2V6CA 4U71A 4RZZA 1XGSA 4ZWUA 5CE6A 4IPAA 1WLRA 1C23A 2GU4A 2B3HA 2Q94A 2BWVA 4U73A 2P9AA 2GZ5A 1W2MA 2BB7A 2OAZA 1XGOA 3L7GA 2MATA 2BWSA 3FMRA 3IU8A 1YVMA 5CLSA 5FCHA 2EVMA 3OVKA 2Q92A 2BHAA 4IF7A 4U6ZA 3L24A 1XNZA 4U1BA 1YW8A 2V3YA 1WBQA 3BITA 3IL0A 4S2RP 3PKDA 4RGZ1 4FLIA 4U6CA 4U70A 4U69A 3BIPA 4PV4A 2EVCA 4A6VA 1A16A 2GA2A 1B6AA 2EA4A 4IU6A 4RZYA 2GGBA 2OKNA 3TB5A 1XGNA 3CB5A 3PKCA 1WN1A 2EVOA 4IECA 4MATA 1QXWA 4S01A 2BWUA 4IKSA 2GG0A 4KM3A 1C22A 3RORA 2NQ6A 5D6FA 4Z7MA 1WL6A 4ZWOA 4IKRA 3MX6A 4FUKA 4A6WA 3IU7A 1KQ0A 4EGEA 4U6JA 1Y1NA 1YJ3A 3MATA 1PV9A 2IW2A 2HOWA 4S00A 3FM3A 4B28A 4HXXA 3OOOA 3TAVA 1QXYA 2GTXA 3O5VA 5CIKA 1C27A 2Q93A 4FLKA 2BWXA 1YW9A 2GU6A 4IDYA 5JHUA 1W7VA 5CDLA 4OOKA 2NQ7A 1N51A 2ADUA 2GG3A 2GG7A 2BHCA 3RVAA 1R5HA 4ZWPA 3PN9A 2B3LA 2G6PA 2GG5A 2GG9A 2BH3A 4FO7A 1KP0A 2BWTA 4IKUA 4U76A 1C24A 1R5GA
chains in the Genus database with same CATH superfamily
3IG4A 1M35A 3PEBA 5CDEA 2GU7A 1WY2A 5CNXA 1R58A 2EA2A 3QOCA 5CDVA 2GGCA 2Q96A 4IKTA 3S6BA 1WKMA 1YW7A 5FCFA 2P99A 2BWYA 2DFIA 3D27A 2BHDA 2BHBA 5E5BA 2P98A 1QZYA 1MATA 3I7MA 1QXZA 4FKCA 3IU9A 4FLJA 5E2CA 1O0XA 1XGMA 4S2TP 4U6WA 1JAWA 1CHMA 2V3XA 1C21A 2GU5A 2B3KA 2BWWA 1BOAA 2GG2A 4FO8A 2Q8KA 2BN7A 3FMQA 2Q95A 3PKEA 3PKBA 4FLLA 3MR1A 3CB6A 1BN5A 4QR8A 5D6EA 1B59A 5JI6A 1WL9A 4U6EA 3PKAA 4U75A 4ZNGA 3BIQA 2V3ZA 3CTZA 1KQ9A 4R60A 3Q6DA 2GG8A 4PNCA 4JUQA 2ZSGA 5JFRA 2V6CA 4U71A 4RZZA 1XGSA 4ZWUA 5CE6A 4IPAA 1WLRA 1C23A 2GU4A 2B3HA 2Q94A 2BWVA 4U73A 2P9AA 2GZ5A 1W2MA 2BB7A 2OAZA 1XGOA 3L7GA 2MATA 2BWSA 3FMRA 3IU8A 1YVMA 5CLSA 5FCHA 2EVMA 3OVKA 2Q92A 2BHAA 4IF7A 4U6ZA 3L24A 1XNZA 4U1BA 1YW8A 2V3YA 1WBQA 3BITA 3IL0A 4S2RP 3PKDA 4RGZ1 4FLIA 4U6CA 4U70A 4U69A 3BIPA 4PV4A 2EVCA 4A6VA 1A16A 2GA2A 1B6AA 2EA4A 4IU6A 4RZYA 2GGBA 2OKNA 3TB5A 1XGNA 3CB5A 3PKCA 1WN1A 2EVOA 4IECA 4MATA 1QXWA 4S01A 2BWUA 4IKSA 2GG0A 4KM3A 1C22A 3RORA 2NQ6A 5D6FA 4Z7MA 1WL6A 4ZWOA 4IKRA 3MX6A 4FUKA 4A6WA 3IU7A 1KQ0A 4EGEA 4U6JA 1Y1NA 1YJ3A 3MATA 1PV9A 2IW2A 2HOWA 4S00A 3FM3A 4B28A 4HXXA 3OOOA 3TAVA 1QXYA 2GTXA 3O5VA 5CIKA 1C27A 2Q93A 4FLKA 2BWXA 1YW9A 2GU6A 4IDYA 5JHUA 1W7VA 5CDLA 4OOKA 2NQ7A 1N51A 2ADUA 2GG3A 2GG7A 2BHCA 3RVAA 1R5HA 4ZWPA 3PN9A 2B3LA 2G6PA 2GG5A 2GG9A 2BH3A 4FO7A 1KP0A 2BWTA 4IKUA 4U76A 1C24A 1R5GA
chains in the Genus database with same CATH topology
3IG4A 1M35A 3PEBA 5CDEA 2GU7A 1WY2A 5CNXA 1R58A 2EA2A 3QOCA 5CDVA 2GGCA 2Q96A 4IKTA 3S6BA 1WKMA 1YW7A 5FCFA 2P99A 2BWYA 2DFIA 3D27A 2BHDA 2BHBA 5E5BA 2P98A 1QZYA 1MATA 3I7MA 1QXZA 4FKCA 3IU9A 4FLJA 5E2CA 1O0XA 1XGMA 4S2TP 4U6WA 1JAWA 1CHMA 2V3XA 1C21A 2GU5A 2B3KA 2BWWA 1BOAA 2GG2A 4FO8A 2Q8KA 2BN7A 3FMQA 2Q95A 3PKEA 3PKBA 4FLLA 3MR1A 3CB6A 1BN5A 4QR8A 5D6EA 1B59A 5JI6A 1WL9A 4U6EA 3PKAA 4U75A 4ZNGA 3BIQA 2V3ZA 3CTZA 1KQ9A 4R60A 3Q6DA 2GG8A 4PNCA 4JUQA 2ZSGA 5JFRA 2V6CA 4U71A 4RZZA 1XGSA 4ZWUA 5CE6A 4IPAA 1WLRA 1C23A 2GU4A 2B3HA 2Q94A 2BWVA 4U73A 2P9AA 2GZ5A 1W2MA 2BB7A 2OAZA 1XGOA 3L7GA 2MATA 2BWSA 3FMRA 3IU8A 1YVMA 5CLSA 5FCHA 2EVMA 3OVKA 2Q92A 2BHAA 4IF7A 4U6ZA 3L24A 1XNZA 4U1BA 1YW8A 2V3YA 1WBQA 3BITA 3IL0A 4S2RP 3PKDA 4RGZ1 4FLIA 4U6CA 4U70A 4U69A 3BIPA 4PV4A 2EVCA 4A6VA 1A16A 2GA2A 1B6AA 2EA4A 4IU6A 4RZYA 2GGBA 2OKNA 3TB5A 1XGNA 3CB5A 3PKCA 1WN1A 2EVOA 4IECA 4MATA 1QXWA 4S01A 2BWUA 4IKSA 2GG0A 4KM3A 1C22A 3RORA 2NQ6A 5D6FA 4Z7MA 1WL6A 4ZWOA 4IKRA 3MX6A 4FUKA 4A6WA 3IU7A 1KQ0A 4EGEA 4U6JA 1Y1NA 1YJ3A 3MATA 1PV9A 2IW2A 2HOWA 4S00A 3FM3A 4B28A 4HXXA 3OOOA 3TAVA 1QXYA 2GTXA 3O5VA 5CIKA 1C27A 2Q93A 4FLKA 2BWXA 1YW9A 2GU6A 4IDYA 5JHUA 1W7VA 5CDLA 4OOKA 2NQ7A 1N51A 2ADUA 2GG3A 2GG7A 2BHCA 3RVAA 1R5HA 4ZWPA 3PN9A 2B3LA 2G6PA 2GG5A 2GG9A 2BH3A 4FO7A 1KP0A 2BWTA 4IKUA 4U76A 1C24A 1R5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG4 A;  1M35 A;  3PEB A;  5CDE A;  2GU7 A;  1WY2 A;  5CNX A;  1R58 A;  2EA2 A;  3QOC A;  5CDV A;  2GGC A;  2Q96 A;  4IKT A;  3S6B A;  1WKM A;  1YW7 A;  5FCF A;  2P99 A;  2BWY A;  2DFI A;  3D27 A;  2BHD A;  2BHB A;  5E5B A;  2P98 A;  1QZY A;  1MAT A;  3I7M A;  1QXZ A;  4FKC A;  3IU9 A;  4FLJ A;  5E2C A;  1O0X A;  1XGM A;  4S2T P;  4U6W A;  1JAW A;  1CHM A;  2V3X A;  1C21 A;  2GU5 A;  2B3K A;  2BWW A;  1BOA A;  2GG2 A;  4FO8 A;  2Q8K A;  2BN7 A;  3FMQ A;  2Q95 A;  3PKE A;  3PKB A;  4FLL A;  3MR1 A;  3CB6 A;  1BN5 A;  4QR8 A;  5D6E A;  1B59 A;  5JI6 A;  1WL9 A;  4U6E A;  3PKA A;  4U75 A;  4ZNG A;  3BIQ A;  2V3Z A;  3CTZ A;  1KQ9 A;  4R60 A;  3Q6D A;  2GG8 A;  4PNC A;  4JUQ A;  2ZSG A;  5JFR A;  2V6C A;  4U71 A;  4RZZ A;  1XGS A;  4ZWU A;  5CE6 A;  4IPA A;  1WLR A;  1C23 A;  2GU4 A;  2B3H A;  2Q94 A;  2BWV A;  4U73 A;  2P9A A;  2GZ5 A;  1W2M A;  2BB7 A;  2OAZ A;  1XGO A;  3L7G A;  2MAT A;  2BWS A;  3FMR A;  3IU8 A;  1YVM A;  5CLS A;  5FCH A;  2EVM A;  3OVK A;  2Q92 A;  2BHA A;  4IF7 A;  4U6Z A;  3L24 A;  1XNZ A;  4U1B A;  1YW8 A;  2V3Y A;  1WBQ A;  3BIT A;  3IL0 A;  4S2R P;  3PKD A;  4RGZ 1;  4FLI A;  4U6C A;  4U70 A;  4U69 A;  3BIP A;  4PV4 A;  2EVC A;  4A6V A;  1A16 A;  2GA2 A;  1B6A A;  2EA4 A;  4IU6 A;  4RZY A;  2GGB A;  2OKN A;  3TB5 A;  1XGN A;  3CB5 A;  3PKC A;  1WN1 A;  2EVO A;  4IEC A;  4MAT A;  1QXW A;  4S01 A;  2BWU A;  4IKS A;  2GG0 A;  4KM3 A;  1C22 A;  3ROR A;  2NQ6 A;  5D6F A;  4Z7M A;  1WL6 A;  4ZWO A;  4IKR A;  3MX6 A;  4FUK A;  4A6W A;  3IU7 A;  1KQ0 A;  4EGE A;  4U6J A;  1Y1N A;  1YJ3 A;  3MAT A;  1PV9 A;  2IW2 A;  2HOW A;  4S00 A;  3FM3 A;  4B28 A;  4HXX A;  3OOO A;  3TAV A;  1QXY A;  2GTX A;  3O5V A;  5CIK A;  1C27 A;  2Q93 A;  4FLK A;  2BWX A;  1YW9 A;  2GU6 A;  4IDY A;  5JHU A;  1W7V A;  5CDL A;  4OOK A;  2NQ7 A;  1N51 A;  2ADU A;  2GG3 A;  2GG7 A;  2BHC A;  3RVA A;  1R5H A;  4ZWP A;  3PN9 A;  2B3L A;  2G6P A;  2GG5 A;  2GG9 A;  2BH3 A;  4FO7 A;  1KP0 A;  2BWT A;  4IKU A;  4U76 A;  1C24 A;  1R5G A; 
#chains in the Genus database with same CATH topology
 3IG4 A;  1M35 A;  3PEB A;  5CDE A;  2GU7 A;  1WY2 A;  5CNX A;  1R58 A;  2EA2 A;  3QOC A;  5CDV A;  2GGC A;  2Q96 A;  4IKT A;  3S6B A;  1WKM A;  1YW7 A;  5FCF A;  2P99 A;  2BWY A;  2DFI A;  3D27 A;  2BHD A;  2BHB A;  5E5B A;  2P98 A;  1QZY A;  1MAT A;  3I7M A;  1QXZ A;  4FKC A;  3IU9 A;  4FLJ A;  5E2C A;  1O0X A;  1XGM A;  4S2T P;  4U6W A;  1JAW A;  1CHM A;  2V3X A;  1C21 A;  2GU5 A;  2B3K A;  2BWW A;  1BOA A;  2GG2 A;  4FO8 A;  2Q8K A;  2BN7 A;  3FMQ A;  2Q95 A;  3PKE A;  3PKB A;  4FLL A;  3MR1 A;  3CB6 A;  1BN5 A;  4QR8 A;  5D6E A;  1B59 A;  5JI6 A;  1WL9 A;  4U6E A;  3PKA A;  4U75 A;  4ZNG A;  3BIQ A;  2V3Z A;  3CTZ A;  1KQ9 A;  4R60 A;  3Q6D A;  2GG8 A;  4PNC A;  4JUQ A;  2ZSG A;  5JFR A;  2V6C A;  4U71 A;  4RZZ A;  1XGS A;  4ZWU A;  5CE6 A;  4IPA A;  1WLR A;  1C23 A;  2GU4 A;  2B3H A;  2Q94 A;  2BWV A;  4U73 A;  2P9A A;  2GZ5 A;  1W2M A;  2BB7 A;  2OAZ A;  1XGO A;  3L7G A;  2MAT A;  2BWS A;  3FMR A;  3IU8 A;  1YVM A;  5CLS A;  5FCH A;  2EVM A;  3OVK A;  2Q92 A;  2BHA A;  4IF7 A;  4U6Z A;  3L24 A;  1XNZ A;  4U1B A;  1YW8 A;  2V3Y A;  1WBQ A;  3BIT A;  3IL0 A;  4S2R P;  3PKD A;  4RGZ 1;  4FLI A;  4U6C A;  4U70 A;  4U69 A;  3BIP A;  4PV4 A;  2EVC A;  4A6V A;  1A16 A;  2GA2 A;  1B6A A;  2EA4 A;  4IU6 A;  4RZY A;  2GGB A;  2OKN A;  3TB5 A;  1XGN A;  3CB5 A;  3PKC A;  1WN1 A;  2EVO A;  4IEC A;  4MAT A;  1QXW A;  4S01 A;  2BWU A;  4IKS A;  2GG0 A;  4KM3 A;  1C22 A;  3ROR A;  2NQ6 A;  5D6F A;  4Z7M A;  1WL6 A;  4ZWO A;  4IKR A;  3MX6 A;  4FUK A;  4A6W A;  3IU7 A;  1KQ0 A;  4EGE A;  4U6J A;  1Y1N A;  1YJ3 A;  3MAT A;  1PV9 A;  2IW2 A;  2HOW A;  4S00 A;  3FM3 A;  4B28 A;  4HXX A;  3OOO A;  3TAV A;  1QXY A;  2GTX A;  3O5V A;  5CIK A;  1C27 A;  2Q93 A;  4FLK A;  2BWX A;  1YW9 A;  2GU6 A;  4IDY A;  5JHU A;  1W7V A;  5CDL A;  4OOK A;  2NQ7 A;  1N51 A;  2ADU A;  2GG3 A;  2GG7 A;  2BHC A;  3RVA A;  1R5H A;  4ZWP A;  3PN9 A;  2B3L A;  2G6P A;  2GG5 A;  2GG9 A;  2BH3 A;  4FO7 A;  1KP0 A;  2BWT A;  4IKU A;  4U76 A;  1C24 A;  1R5G A; 
#chains in the Genus database with same CATH homology
 3IG4 A;  1M35 A;  3PEB A;  5CDE A;  2GU7 A;  1WY2 A;  5CNX A;  1R58 A;  2EA2 A;  3QOC A;  5CDV A;  2GGC A;  2Q96 A;  4IKT A;  3S6B A;  1WKM A;  1YW7 A;  5FCF A;  2P99 A;  2BWY A;  2DFI A;  3D27 A;  2BHD A;  2BHB A;  5E5B A;  2P98 A;  1QZY A;  1MAT A;  3I7M A;  1QXZ A;  4FKC A;  3IU9 A;  4FLJ A;  5E2C A;  1O0X A;  1XGM A;  4S2T P;  4U6W A;  1JAW A;  1CHM A;  2V3X A;  1C21 A;  2GU5 A;  2B3K A;  2BWW A;  1BOA A;  2GG2 A;  4FO8 A;  2Q8K A;  2BN7 A;  3FMQ A;  2Q95 A;  3PKE A;  3PKB A;  4FLL A;  3MR1 A;  3CB6 A;  1BN5 A;  4QR8 A;  5D6E A;  1B59 A;  5JI6 A;  1WL9 A;  4U6E A;  3PKA A;  4U75 A;  4ZNG A;  3BIQ A;  2V3Z A;  3CTZ A;  1KQ9 A;  4R60 A;  3Q6D A;  2GG8 A;  4PNC A;  4JUQ A;  2ZSG A;  5JFR A;  2V6C A;  4U71 A;  4RZZ A;  1XGS A;  4ZWU A;  5CE6 A;  4IPA A;  1WLR A;  1C23 A;  2GU4 A;  2B3H A;  2Q94 A;  2BWV A;  4U73 A;  2P9A A;  2GZ5 A;  1W2M A;  2BB7 A;  2OAZ A;  1XGO A;  3L7G A;  2MAT A;  2BWS A;  3FMR A;  3IU8 A;  1YVM A;  5CLS A;  5FCH A;  2EVM A;  3OVK A;  2Q92 A;  2BHA A;  4IF7 A;  4U6Z A;  3L24 A;  1XNZ A;  4U1B A;  1YW8 A;  2V3Y A;  1WBQ A;  3BIT A;  3IL0 A;  4S2R P;  3PKD A;  4RGZ 1;  4FLI A;  4U6C A;  4U70 A;  4U69 A;  3BIP A;  4PV4 A;  2EVC A;  4A6V A;  1A16 A;  2GA2 A;  1B6A A;  2EA4 A;  4IU6 A;  4RZY A;  2GGB A;  2OKN A;  3TB5 A;  1XGN A;  3CB5 A;  3PKC A;  1WN1 A;  2EVO A;  4IEC A;  4MAT A;  1QXW A;  4S01 A;  2BWU A;  4IKS A;  2GG0 A;  4KM3 A;  1C22 A;  3ROR A;  2NQ6 A;  5D6F A;  4Z7M A;  1WL6 A;  4ZWO A;  4IKR A;  3MX6 A;  4FUK A;  4A6W A;  3IU7 A;  1KQ0 A;  4EGE A;  4U6J A;  1Y1N A;  1YJ3 A;  3MAT A;  1PV9 A;  2IW2 A;  2HOW A;  4S00 A;  3FM3 A;  4B28 A;  4HXX A;  3OOO A;  3TAV A;  1QXY A;  2GTX A;  3O5V A;  5CIK A;  1C27 A;  2Q93 A;  4FLK A;  2BWX A;  1YW9 A;  2GU6 A;  4IDY A;  5JHU A;  1W7V A;  5CDL A;  4OOK A;  2NQ7 A;  1N51 A;  2ADU A;  2GG3 A;  2GG7 A;  2BHC A;  3RVA A;  1R5H A;  4ZWP A;  3PN9 A;  2B3L A;  2G6P A;  2GG5 A;  2GG9 A;  2BH3 A;  4FO7 A;  1KP0 A;  2BWT A;  4IKU A;  4U76 A;  1C24 A;  1R5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...