2BH3A

Zn substituted e. coli aminopeptidase p in complex with product
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 161
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bh3A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bh3A02
2BWWA 2P99A 1C22A 1KQ9A 4S2RP 3FMQA 4FUKA 2GA2A 2GU6A 4IKTA 2Q95A 4IECA 5D6FA 1R58A 4U6ZA 5CNXA 1XNZA 1YVMA 2ZSGA 2EVOA 2BWXA 1YJ3A 3MATA 4EGEA 2GG5A 2BHDA 1R5GA 4ZNGA 5FCFA 4FLJA 1B59A 4RZYA 3OVKA 2BHAA 2Q94A 3IU8A 1C21A 2NQ6A 3PEBA 1QXYA 4A6VA 2BWYA 3O5VA 3Q6DA 4U70A 2BN7A 4S01A 1B6AA 1YW8A 2GZ5A 3TAVA 2GG2A 4PNCA 1CHMA 2OKNA 4R60A 1WKMA 2BB7A 2BHBA 3FMRA 4U76A 1XGSA 3CTZA 1QXWA 2GG7A 2V6CA 4KM3A 3RORA 4IKSA 2B3LA 4IPAA 1YW9A 2V3YA 3MR1A 5CLSA 3BIQA 3IU9A 4U73A 2GG9A 4U6WA 1WL6A 3IL0A 1PV9A 2IW2A 1KQ0A 2BWUA 2OAZA 5JFRA 3CB6A 3I7MA 3OOOA 1C24A 5D6EA 2GU4A 4S00A 3QOCA 4PV4A 1C23A 5E5BA 4HXXA 1M35A 4FLKA 2B3HA 4MATA 2MATA 3PKBA 4FLLA 1Y1NA 2GG3A 2GGCA 3D27A 3MX6A 4IKUA 1BN5A 2GU7A 5CDEA 4U6JA 2V3ZA 4A6WA 3PN9A 5CIKA 1N51A 1W7VA 3BITA 2ADUA 4FO8A 3IU7A 1KP0A 1YW7A 1XGNA 2GTXA 2GU5A 2Q96A 5E2CA 1C27A 1MATA 2EA4A 2P9AA 1WBQA 2Q92A 2DFIA 1W2MA 4FKCA 1BOAA 1A16A 5CDLA 1XGOA 2Q93A 2GG0A 3PKCA 4RGZ1 2HOWA 2B3KA 1R5HA 4U6CA 3PKEA 1WL9A 2BWTA 2EVCA 4U1BA 1XGMA 4RZZA 4ZWPA 2BH3A 4IDYA 5CE6A 3RVAA 1O0XA 4U69A 3L24A 4QR8A 4FLIA 4IF7A 3CB5A 4B28A 1WY2A 1QXZA 1QZYA 2G6PA 4U75A 3BIPA 5CDVA 5JI6A 4FO7A 2EVMA 2Q8KA 4U6EA 4IKRA 1WN1A 3S6BA 2NQ7A 4IU6A 4S2TP 3L7GA 2BHCA 2BWVA 2GG8A 4Z7MA 5FCHA 4OOKA 3IG4A 4U71A 2P98A 3PKDA 2BWSA 4JUQA 2GGBA 3TB5A 3PKAA 5JHUA 4ZWUA 2EA2A 2V3XA 1WLRA 1JAWA 4ZWOA 3FM3A
chains in the Genus database with same CATH superfamily
2BWWA 2P99A 1C22A 1KQ9A 4S2RP 3FMQA 4FUKA 2GA2A 2GU6A 4IKTA 2Q95A 4IECA 5D6FA 1R58A 4U6ZA 5CNXA 1XNZA 1YVMA 2ZSGA 2EVOA 2BWXA 1YJ3A 3MATA 4EGEA 2GG5A 2BHDA 1R5GA 4ZNGA 5FCFA 4FLJA 1B59A 4RZYA 3OVKA 2BHAA 2Q94A 3IU8A 1C21A 2NQ6A 3PEBA 1QXYA 4A6VA 2BWYA 3O5VA 3Q6DA 4U70A 2BN7A 4S01A 1B6AA 1YW8A 2GZ5A 3TAVA 2GG2A 4PNCA 1CHMA 2OKNA 4R60A 1WKMA 2BB7A 2BHBA 3FMRA 4U76A 1XGSA 3CTZA 1QXWA 2GG7A 2V6CA 4KM3A 3RORA 4IKSA 2B3LA 4IPAA 1YW9A 2V3YA 3MR1A 5CLSA 3BIQA 3IU9A 4U73A 2GG9A 4U6WA 1WL6A 3IL0A 1PV9A 2IW2A 1KQ0A 2BWUA 2OAZA 5JFRA 3CB6A 3I7MA 3OOOA 1C24A 5D6EA 2GU4A 4S00A 3QOCA 4PV4A 1C23A 5E5BA 4HXXA 1M35A 4FLKA 2B3HA 4MATA 2MATA 3PKBA 4FLLA 1Y1NA 2GG3A 2GGCA 3D27A 3MX6A 4IKUA 1BN5A 2GU7A 5CDEA 4U6JA 2V3ZA 4A6WA 3PN9A 5CIKA 1N51A 1W7VA 3BITA 2ADUA 4FO8A 3IU7A 1KP0A 1YW7A 1XGNA 2GTXA 2GU5A 2Q96A 5E2CA 1C27A 1MATA 2EA4A 2P9AA 1WBQA 2Q92A 2DFIA 1W2MA 4FKCA 1BOAA 1A16A 5CDLA 1XGOA 2Q93A 2GG0A 3PKCA 4RGZ1 2HOWA 2B3KA 1R5HA 4U6CA 3PKEA 1WL9A 2BWTA 2EVCA 4U1BA 1XGMA 4RZZA 4ZWPA 2BH3A 4IDYA 5CE6A 3RVAA 1O0XA 4U69A 3L24A 4QR8A 4FLIA 4IF7A 3CB5A 4B28A 1WY2A 1QXZA 1QZYA 2G6PA 4U75A 3BIPA 5CDVA 5JI6A 4FO7A 2EVMA 2Q8KA 4U6EA 4IKRA 1WN1A 3S6BA 2NQ7A 4IU6A 4S2TP 3L7GA 2BHCA 2BWVA 2GG8A 4Z7MA 5FCHA 4OOKA 3IG4A 4U71A 2P98A 3PKDA 2BWSA 4JUQA 2GGBA 3TB5A 3PKAA 5JHUA 4ZWUA 2EA2A 2V3XA 1WLRA 1JAWA 4ZWOA 3FM3A
chains in the Genus database with same CATH topology
2BWWA 2P99A 1C22A 1KQ9A 4S2RP 3FMQA 4FUKA 2GA2A 2GU6A 4IKTA 2Q95A 4IECA 5D6FA 1R58A 4U6ZA 5CNXA 1XNZA 1YVMA 2ZSGA 2EVOA 2BWXA 1YJ3A 3MATA 4EGEA 2GG5A 2BHDA 1R5GA 4ZNGA 5FCFA 4FLJA 1B59A 4RZYA 3OVKA 2BHAA 2Q94A 3IU8A 1C21A 2NQ6A 3PEBA 1QXYA 4A6VA 2BWYA 3O5VA 3Q6DA 4U70A 2BN7A 4S01A 1B6AA 1YW8A 2GZ5A 3TAVA 2GG2A 4PNCA 1CHMA 2OKNA 4R60A 1WKMA 2BB7A 2BHBA 3FMRA 4U76A 1XGSA 3CTZA 1QXWA 2GG7A 2V6CA 4KM3A 3RORA 4IKSA 2B3LA 4IPAA 1YW9A 2V3YA 3MR1A 5CLSA 3BIQA 3IU9A 4U73A 2GG9A 4U6WA 1WL6A 3IL0A 1PV9A 2IW2A 1KQ0A 2BWUA 2OAZA 5JFRA 3CB6A 3I7MA 3OOOA 1C24A 5D6EA 2GU4A 4S00A 3QOCA 4PV4A 1C23A 5E5BA 4HXXA 1M35A 4FLKA 2B3HA 4MATA 2MATA 3PKBA 4FLLA 1Y1NA 2GG3A 2GGCA 3D27A 3MX6A 4IKUA 1BN5A 2GU7A 5CDEA 4U6JA 2V3ZA 4A6WA 3PN9A 5CIKA 1N51A 1W7VA 3BITA 2ADUA 4FO8A 3IU7A 1KP0A 1YW7A 1XGNA 2GTXA 2GU5A 2Q96A 5E2CA 1C27A 1MATA 2EA4A 2P9AA 1WBQA 2Q92A 2DFIA 1W2MA 4FKCA 1BOAA 1A16A 5CDLA 1XGOA 2Q93A 2GG0A 3PKCA 4RGZ1 2HOWA 2B3KA 1R5HA 4U6CA 3PKEA 1WL9A 2BWTA 2EVCA 4U1BA 1XGMA 4RZZA 4ZWPA 2BH3A 4IDYA 5CE6A 3RVAA 1O0XA 4U69A 3L24A 4QR8A 4FLIA 4IF7A 3CB5A 4B28A 1WY2A 1QXZA 1QZYA 2G6PA 4U75A 3BIPA 5CDVA 5JI6A 4FO7A 2EVMA 2Q8KA 4U6EA 4IKRA 1WN1A 3S6BA 2NQ7A 4IU6A 4S2TP 3L7GA 2BHCA 2BWVA 2GG8A 4Z7MA 5FCHA 4OOKA 3IG4A 4U71A 2P98A 3PKDA 2BWSA 4JUQA 2GGBA 3TB5A 3PKAA 5JHUA 4ZWUA 2EA2A 2V3XA 1WLRA 1JAWA 4ZWOA 3FM3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWW A;  2P99 A;  1C22 A;  1KQ9 A;  4S2R P;  3FMQ A;  4FUK A;  2GA2 A;  2GU6 A;  4IKT A;  2Q95 A;  4IEC A;  5D6F A;  1R58 A;  4U6Z A;  5CNX A;  1XNZ A;  1YVM A;  2ZSG A;  2EVO A;  2BWX A;  1YJ3 A;  3MAT A;  4EGE A;  2GG5 A;  2BHD A;  1R5G A;  4ZNG A;  5FCF A;  4FLJ A;  1B59 A;  4RZY A;  3OVK A;  2BHA A;  2Q94 A;  3IU8 A;  1C21 A;  2NQ6 A;  3PEB A;  1QXY A;  4A6V A;  2BWY A;  3O5V A;  3Q6D A;  4U70 A;  2BN7 A;  4S01 A;  1B6A A;  1YW8 A;  2GZ5 A;  3TAV A;  2GG2 A;  4PNC A;  1CHM A;  2OKN A;  4R60 A;  1WKM A;  2BB7 A;  2BHB A;  3FMR A;  4U76 A;  1XGS A;  3CTZ A;  1QXW A;  2GG7 A;  2V6C A;  4KM3 A;  3ROR A;  4IKS A;  2B3L A;  4IPA A;  1YW9 A;  2V3Y A;  3MR1 A;  5CLS A;  3BIQ A;  3IU9 A;  4U73 A;  2GG9 A;  4U6W A;  1WL6 A;  3IL0 A;  1PV9 A;  2IW2 A;  1KQ0 A;  2BWU A;  2OAZ A;  5JFR A;  3CB6 A;  3I7M A;  3OOO A;  1C24 A;  5D6E A;  2GU4 A;  4S00 A;  3QOC A;  4PV4 A;  1C23 A;  5E5B A;  4HXX A;  1M35 A;  4FLK A;  2B3H A;  4MAT A;  2MAT A;  3PKB A;  4FLL A;  1Y1N A;  2GG3 A;  2GGC A;  3D27 A;  3MX6 A;  4IKU A;  1BN5 A;  2GU7 A;  5CDE A;  4U6J A;  2V3Z A;  4A6W A;  3PN9 A;  5CIK A;  1N51 A;  1W7V A;  3BIT A;  2ADU A;  4FO8 A;  3IU7 A;  1KP0 A;  1YW7 A;  1XGN A;  2GTX A;  2GU5 A;  2Q96 A;  5E2C A;  1C27 A;  1MAT A;  2EA4 A;  2P9A A;  1WBQ A;  2Q92 A;  2DFI A;  1W2M A;  4FKC A;  1BOA A;  1A16 A;  5CDL A;  1XGO A;  2Q93 A;  2GG0 A;  3PKC A;  4RGZ 1;  2HOW A;  2B3K A;  1R5H A;  4U6C A;  3PKE A;  1WL9 A;  2BWT A;  2EVC A;  4U1B A;  1XGM A;  4RZZ A;  4ZWP A;  2BH3 A;  4IDY A;  5CE6 A;  3RVA A;  1O0X A;  4U69 A;  3L24 A;  4QR8 A;  4FLI A;  4IF7 A;  3CB5 A;  4B28 A;  1WY2 A;  1QXZ A;  1QZY A;  2G6P A;  4U75 A;  3BIP A;  5CDV A;  5JI6 A;  4FO7 A;  2EVM A;  2Q8K A;  4U6E A;  4IKR A;  1WN1 A;  3S6B A;  2NQ7 A;  4IU6 A;  4S2T P;  3L7G A;  2BHC A;  2BWV A;  2GG8 A;  4Z7M A;  5FCH A;  4OOK A;  3IG4 A;  4U71 A;  2P98 A;  3PKD A;  2BWS A;  4JUQ A;  2GGB A;  3TB5 A;  3PKA A;  5JHU A;  4ZWU A;  2EA2 A;  2V3X A;  1WLR A;  1JAW A;  4ZWO A;  3FM3 A; 
#chains in the Genus database with same CATH topology
 2BWW A;  2P99 A;  1C22 A;  1KQ9 A;  4S2R P;  3FMQ A;  4FUK A;  2GA2 A;  2GU6 A;  4IKT A;  2Q95 A;  4IEC A;  5D6F A;  1R58 A;  4U6Z A;  5CNX A;  1XNZ A;  1YVM A;  2ZSG A;  2EVO A;  2BWX A;  1YJ3 A;  3MAT A;  4EGE A;  2GG5 A;  2BHD A;  1R5G A;  4ZNG A;  5FCF A;  4FLJ A;  1B59 A;  4RZY A;  3OVK A;  2BHA A;  2Q94 A;  3IU8 A;  1C21 A;  2NQ6 A;  3PEB A;  1QXY A;  4A6V A;  2BWY A;  3O5V A;  3Q6D A;  4U70 A;  2BN7 A;  4S01 A;  1B6A A;  1YW8 A;  2GZ5 A;  3TAV A;  2GG2 A;  4PNC A;  1CHM A;  2OKN A;  4R60 A;  1WKM A;  2BB7 A;  2BHB A;  3FMR A;  4U76 A;  1XGS A;  3CTZ A;  1QXW A;  2GG7 A;  2V6C A;  4KM3 A;  3ROR A;  4IKS A;  2B3L A;  4IPA A;  1YW9 A;  2V3Y A;  3MR1 A;  5CLS A;  3BIQ A;  3IU9 A;  4U73 A;  2GG9 A;  4U6W A;  1WL6 A;  3IL0 A;  1PV9 A;  2IW2 A;  1KQ0 A;  2BWU A;  2OAZ A;  5JFR A;  3CB6 A;  3I7M A;  3OOO A;  1C24 A;  5D6E A;  2GU4 A;  4S00 A;  3QOC A;  4PV4 A;  1C23 A;  5E5B A;  4HXX A;  1M35 A;  4FLK A;  2B3H A;  4MAT A;  2MAT A;  3PKB A;  4FLL A;  1Y1N A;  2GG3 A;  2GGC A;  3D27 A;  3MX6 A;  4IKU A;  1BN5 A;  2GU7 A;  5CDE A;  4U6J A;  2V3Z A;  4A6W A;  3PN9 A;  5CIK A;  1N51 A;  1W7V A;  3BIT A;  2ADU A;  4FO8 A;  3IU7 A;  1KP0 A;  1YW7 A;  1XGN A;  2GTX A;  2GU5 A;  2Q96 A;  5E2C A;  1C27 A;  1MAT A;  2EA4 A;  2P9A A;  1WBQ A;  2Q92 A;  2DFI A;  1W2M A;  4FKC A;  1BOA A;  1A16 A;  5CDL A;  1XGO A;  2Q93 A;  2GG0 A;  3PKC A;  4RGZ 1;  2HOW A;  2B3K A;  1R5H A;  4U6C A;  3PKE A;  1WL9 A;  2BWT A;  2EVC A;  4U1B A;  1XGM A;  4RZZ A;  4ZWP A;  2BH3 A;  4IDY A;  5CE6 A;  3RVA A;  1O0X A;  4U69 A;  3L24 A;  4QR8 A;  4FLI A;  4IF7 A;  3CB5 A;  4B28 A;  1WY2 A;  1QXZ A;  1QZY A;  2G6P A;  4U75 A;  3BIP A;  5CDV A;  5JI6 A;  4FO7 A;  2EVM A;  2Q8K A;  4U6E A;  4IKR A;  1WN1 A;  3S6B A;  2NQ7 A;  4IU6 A;  4S2T P;  3L7G A;  2BHC A;  2BWV A;  2GG8 A;  4Z7M A;  5FCH A;  4OOK A;  3IG4 A;  4U71 A;  2P98 A;  3PKD A;  2BWS A;  4JUQ A;  2GGB A;  3TB5 A;  3PKA A;  5JHU A;  4ZWU A;  2EA2 A;  2V3X A;  1WLR A;  1JAW A;  4ZWO A;  3FM3 A; 
#chains in the Genus database with same CATH homology
 2BWW A;  2P99 A;  1C22 A;  1KQ9 A;  4S2R P;  3FMQ A;  4FUK A;  2GA2 A;  2GU6 A;  4IKT A;  2Q95 A;  4IEC A;  5D6F A;  1R58 A;  4U6Z A;  5CNX A;  1XNZ A;  1YVM A;  2ZSG A;  2EVO A;  2BWX A;  1YJ3 A;  3MAT A;  4EGE A;  2GG5 A;  2BHD A;  1R5G A;  4ZNG A;  5FCF A;  4FLJ A;  1B59 A;  4RZY A;  3OVK A;  2BHA A;  2Q94 A;  3IU8 A;  1C21 A;  2NQ6 A;  3PEB A;  1QXY A;  4A6V A;  2BWY A;  3O5V A;  3Q6D A;  4U70 A;  2BN7 A;  4S01 A;  1B6A A;  1YW8 A;  2GZ5 A;  3TAV A;  2GG2 A;  4PNC A;  1CHM A;  2OKN A;  4R60 A;  1WKM A;  2BB7 A;  2BHB A;  3FMR A;  4U76 A;  1XGS A;  3CTZ A;  1QXW A;  2GG7 A;  2V6C A;  4KM3 A;  3ROR A;  4IKS A;  2B3L A;  4IPA A;  1YW9 A;  2V3Y A;  3MR1 A;  5CLS A;  3BIQ A;  3IU9 A;  4U73 A;  2GG9 A;  4U6W A;  1WL6 A;  3IL0 A;  1PV9 A;  2IW2 A;  1KQ0 A;  2BWU A;  2OAZ A;  5JFR A;  3CB6 A;  3I7M A;  3OOO A;  1C24 A;  5D6E A;  2GU4 A;  4S00 A;  3QOC A;  4PV4 A;  1C23 A;  5E5B A;  4HXX A;  1M35 A;  4FLK A;  2B3H A;  4MAT A;  2MAT A;  3PKB A;  4FLL A;  1Y1N A;  2GG3 A;  2GGC A;  3D27 A;  3MX6 A;  4IKU A;  1BN5 A;  2GU7 A;  5CDE A;  4U6J A;  2V3Z A;  4A6W A;  3PN9 A;  5CIK A;  1N51 A;  1W7V A;  3BIT A;  2ADU A;  4FO8 A;  3IU7 A;  1KP0 A;  1YW7 A;  1XGN A;  2GTX A;  2GU5 A;  2Q96 A;  5E2C A;  1C27 A;  1MAT A;  2EA4 A;  2P9A A;  1WBQ A;  2Q92 A;  2DFI A;  1W2M A;  4FKC A;  1BOA A;  1A16 A;  5CDL A;  1XGO A;  2Q93 A;  2GG0 A;  3PKC A;  4RGZ 1;  2HOW A;  2B3K A;  1R5H A;  4U6C A;  3PKE A;  1WL9 A;  2BWT A;  2EVC A;  4U1B A;  1XGM A;  4RZZ A;  4ZWP A;  2BH3 A;  4IDY A;  5CE6 A;  3RVA A;  1O0X A;  4U69 A;  3L24 A;  4QR8 A;  4FLI A;  4IF7 A;  3CB5 A;  4B28 A;  1WY2 A;  1QXZ A;  1QZY A;  2G6P A;  4U75 A;  3BIP A;  5CDV A;  5JI6 A;  4FO7 A;  2EVM A;  2Q8K A;  4U6E A;  4IKR A;  1WN1 A;  3S6B A;  2NQ7 A;  4IU6 A;  4S2T P;  3L7G A;  2BHC A;  2BWV A;  2GG8 A;  4Z7M A;  5FCH A;  4OOK A;  3IG4 A;  4U71 A;  2P98 A;  3PKD A;  2BWS A;  4JUQ A;  2GGB A;  3TB5 A;  3PKA A;  5JHU A;  4ZWU A;  2EA2 A;  2V3X A;  1WLR A;  1JAW A;  4ZWO A;  3FM3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...