2BH3A

Zn substituted e. coli aminopeptidase p in complex with product
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
total genus 161
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bh3A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bh3A02
2ZSGA 5CDLA 4U69A 3PKCA 2NQ7A 3D27A 4FO7A 5JFRA 4EGEA 2B3HA 2Q94A 2BH3A 3FM3A 3O5VA 4S2TP 4R60A 2G6PA 2Q93A 4ZWOA 2NQ6A 3RVAA 2GG7A 3OOOA 2BN7A 3IL0A 5E5BA 4U70A 2DFIA 2EVMA 4ZWUA 1YW9A 2GG3A 2GU6A 2MATA 2Q92A 4IU6A 3RORA 2BHCA 3CB6A 2B3LA 1M35A 2GZ5A 3TB5A 1A16A 2BWWA 1XGSA 3MX6A 1QXYA 3PKEA 4Z7MA 2HOWA 4IKTA 4S01A 3CTZA 2GGCA 2BHAA 2P99A 4IF7A 4PV4A 1WY2A 5E2CA 3BITA 2ADUA 1C21A 2GG0A 2GU7A 3L24A 3PKAA 2GG8A 5FCFA 5JHUA 4IPAA 4RZYA 5D6EA 3PKBA 3PN9A 4FLLA 3BIQA 4FKCA 1JAWA 2GU5A 2V3ZA 2BWVA 2Q95A 4S2RP 1YW7A 5JI6A 3FMRA 4U71A 1C27A 3I7MA 3BIPA 3S6BA 2EA2A 5CDVA 1XGMA 3MR1A 3IU7A 4IKSA 4FO8A 2V3XA 1BOAA 4RGZ1 4HXXA 3TAVA 3FMQA 2IW2A 3IU8A 1WBQA 1WN1A 1Y1NA 1O0XA 2GGBA 2GG2A 2P9AA 1C23A 1B6AA 2GG5A 4IKRA 2BB7A 3PKDA 4U75A 3Q6DA 2Q8KA 5CE6A 5FCHA 1YVMA 4MATA 2GTXA 1BN5A 3IU9A 2V3YA 5CLSA 1W7VA 4U6CA 4U6ZA 1C22A 2BHBA 1N51A 4JUQA 2BWXA 2BHDA 4B28A 3PEBA 2BWSA 4ZWPA 1R5HA 1WL9A 1B59A 1YJ3A 4KM3A 3QOCA 1W2MA 1QXWA 4OOKA 2V6CA 1WLRA 3IG4A 4IECA 2GU4A 1XNZA 1C24A 2P98A 4U1BA 4FLIA 4U76A 1KQ0A 4FLJA 1QZYA 1R5GA 4U6EA 1MATA 4IDYA 4U6WA 1QXZA 2EVOA 1KQ9A 4RZZA 2GG9A 5D6FA 4QR8A 2Q96A 4A6WA 2EA4A 5CIKA 4FUKA 2BWTA 2EVCA 1YW8A 4IKUA 3L7GA 4U6JA 4PNCA 4ZNGA 4S00A 5CDEA 1WKMA 3CB5A 1R58A 2GA2A 1XGOA 1XGNA 1PV9A 4U73A 2OKNA 2OAZA 4FLKA 2B3KA 4A6VA 1KP0A 3MATA 1WL6A 3OVKA 5CNXA 2BWYA 1CHMA 2BWUA
chains in the Genus database with same CATH superfamily
2ZSGA 5CDLA 4U69A 3PKCA 2NQ7A 3D27A 4FO7A 5JFRA 4EGEA 2B3HA 2Q94A 2BH3A 3FM3A 3O5VA 4S2TP 4R60A 2G6PA 2Q93A 4ZWOA 2NQ6A 3RVAA 2GG7A 3OOOA 2BN7A 3IL0A 5E5BA 4U70A 2DFIA 2EVMA 4ZWUA 1YW9A 2GG3A 2GU6A 2MATA 2Q92A 4IU6A 3RORA 2BHCA 3CB6A 2B3LA 1M35A 2GZ5A 3TB5A 1A16A 2BWWA 1XGSA 3MX6A 1QXYA 3PKEA 4Z7MA 2HOWA 4IKTA 4S01A 3CTZA 2GGCA 2BHAA 2P99A 4IF7A 4PV4A 1WY2A 5E2CA 3BITA 2ADUA 1C21A 2GG0A 2GU7A 3L24A 3PKAA 2GG8A 5FCFA 5JHUA 4IPAA 4RZYA 5D6EA 3PKBA 3PN9A 4FLLA 3BIQA 4FKCA 1JAWA 2GU5A 2V3ZA 2BWVA 2Q95A 4S2RP 1YW7A 5JI6A 3FMRA 4U71A 1C27A 3I7MA 3BIPA 3S6BA 2EA2A 5CDVA 1XGMA 3MR1A 3IU7A 4IKSA 4FO8A 2V3XA 1BOAA 4RGZ1 4HXXA 3TAVA 3FMQA 2IW2A 3IU8A 1WBQA 1WN1A 1Y1NA 1O0XA 2GGBA 2GG2A 2P9AA 1C23A 1B6AA 2GG5A 4IKRA 2BB7A 3PKDA 4U75A 3Q6DA 2Q8KA 5CE6A 5FCHA 1YVMA 4MATA 2GTXA 1BN5A 3IU9A 2V3YA 5CLSA 1W7VA 4U6CA 4U6ZA 1C22A 2BHBA 1N51A 4JUQA 2BWXA 2BHDA 4B28A 3PEBA 2BWSA 4ZWPA 1R5HA 1WL9A 1B59A 1YJ3A 4KM3A 3QOCA 1W2MA 1QXWA 4OOKA 2V6CA 1WLRA 3IG4A 4IECA 2GU4A 1XNZA 1C24A 2P98A 4U1BA 4FLIA 4U76A 1KQ0A 4FLJA 1QZYA 1R5GA 4U6EA 1MATA 4IDYA 4U6WA 1QXZA 2EVOA 1KQ9A 4RZZA 2GG9A 5D6FA 4QR8A 2Q96A 4A6WA 2EA4A 5CIKA 4FUKA 2BWTA 2EVCA 1YW8A 4IKUA 3L7GA 4U6JA 4PNCA 4ZNGA 4S00A 5CDEA 1WKMA 3CB5A 1R58A 2GA2A 1XGOA 1XGNA 1PV9A 4U73A 2OKNA 2OAZA 4FLKA 2B3KA 4A6VA 1KP0A 3MATA 1WL6A 3OVKA 5CNXA 2BWYA 1CHMA 2BWUA
chains in the Genus database with same CATH topology
2ZSGA 5CDLA 4U69A 3PKCA 2NQ7A 3D27A 4FO7A 5JFRA 4EGEA 2B3HA 2Q94A 2BH3A 3FM3A 3O5VA 4S2TP 4R60A 2G6PA 2Q93A 4ZWOA 2NQ6A 3RVAA 2GG7A 3OOOA 2BN7A 3IL0A 5E5BA 4U70A 2DFIA 2EVMA 4ZWUA 1YW9A 2GG3A 2GU6A 2MATA 2Q92A 4IU6A 3RORA 2BHCA 3CB6A 2B3LA 1M35A 2GZ5A 3TB5A 1A16A 2BWWA 1XGSA 3MX6A 1QXYA 3PKEA 4Z7MA 2HOWA 4IKTA 4S01A 3CTZA 2GGCA 2BHAA 2P99A 4IF7A 4PV4A 1WY2A 5E2CA 3BITA 2ADUA 1C21A 2GG0A 2GU7A 3L24A 3PKAA 2GG8A 5FCFA 5JHUA 4IPAA 4RZYA 5D6EA 3PKBA 3PN9A 4FLLA 3BIQA 4FKCA 1JAWA 2GU5A 2V3ZA 2BWVA 2Q95A 4S2RP 1YW7A 5JI6A 3FMRA 4U71A 1C27A 3I7MA 3BIPA 3S6BA 2EA2A 5CDVA 1XGMA 3MR1A 3IU7A 4IKSA 4FO8A 2V3XA 1BOAA 4RGZ1 4HXXA 3TAVA 3FMQA 2IW2A 3IU8A 1WBQA 1WN1A 1Y1NA 1O0XA 2GGBA 2GG2A 2P9AA 1C23A 1B6AA 2GG5A 4IKRA 2BB7A 3PKDA 4U75A 3Q6DA 2Q8KA 5CE6A 5FCHA 1YVMA 4MATA 2GTXA 1BN5A 3IU9A 2V3YA 5CLSA 1W7VA 4U6CA 4U6ZA 1C22A 2BHBA 1N51A 4JUQA 2BWXA 2BHDA 4B28A 3PEBA 2BWSA 4ZWPA 1R5HA 1WL9A 1B59A 1YJ3A 4KM3A 3QOCA 1W2MA 1QXWA 4OOKA 2V6CA 1WLRA 3IG4A 4IECA 2GU4A 1XNZA 1C24A 2P98A 4U1BA 4FLIA 4U76A 1KQ0A 4FLJA 1QZYA 1R5GA 4U6EA 1MATA 4IDYA 4U6WA 1QXZA 2EVOA 1KQ9A 4RZZA 2GG9A 5D6FA 4QR8A 2Q96A 4A6WA 2EA4A 5CIKA 4FUKA 2BWTA 2EVCA 1YW8A 4IKUA 3L7GA 4U6JA 4PNCA 4ZNGA 4S00A 5CDEA 1WKMA 3CB5A 1R58A 2GA2A 1XGOA 1XGNA 1PV9A 4U73A 2OKNA 2OAZA 4FLKA 2B3KA 4A6VA 1KP0A 3MATA 1WL6A 3OVKA 5CNXA 2BWYA 1CHMA 2BWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZSG A;  5CDL A;  4U69 A;  3PKC A;  2NQ7 A;  3D27 A;  4FO7 A;  5JFR A;  4EGE A;  2B3H A;  2Q94 A;  2BH3 A;  3FM3 A;  3O5V A;  4S2T P;  4R60 A;  2G6P A;  2Q93 A;  4ZWO A;  2NQ6 A;  3RVA A;  2GG7 A;  3OOO A;  2BN7 A;  3IL0 A;  5E5B A;  4U70 A;  2DFI A;  2EVM A;  4ZWU A;  1YW9 A;  2GG3 A;  2GU6 A;  2MAT A;  2Q92 A;  4IU6 A;  3ROR A;  2BHC A;  3CB6 A;  2B3L A;  1M35 A;  2GZ5 A;  3TB5 A;  1A16 A;  2BWW A;  1XGS A;  3MX6 A;  1QXY A;  3PKE A;  4Z7M A;  2HOW A;  4IKT A;  4S01 A;  3CTZ A;  2GGC A;  2BHA A;  2P99 A;  4IF7 A;  4PV4 A;  1WY2 A;  5E2C A;  3BIT A;  2ADU A;  1C21 A;  2GG0 A;  2GU7 A;  3L24 A;  3PKA A;  2GG8 A;  5FCF A;  5JHU A;  4IPA A;  4RZY A;  5D6E A;  3PKB A;  3PN9 A;  4FLL A;  3BIQ A;  4FKC A;  1JAW A;  2GU5 A;  2V3Z A;  2BWV A;  2Q95 A;  4S2R P;  1YW7 A;  5JI6 A;  3FMR A;  4U71 A;  1C27 A;  3I7M A;  3BIP A;  3S6B A;  2EA2 A;  5CDV A;  1XGM A;  3MR1 A;  3IU7 A;  4IKS A;  4FO8 A;  2V3X A;  1BOA A;  4RGZ 1;  4HXX A;  3TAV A;  3FMQ A;  2IW2 A;  3IU8 A;  1WBQ A;  1WN1 A;  1Y1N A;  1O0X A;  2GGB A;  2GG2 A;  2P9A A;  1C23 A;  1B6A A;  2GG5 A;  4IKR A;  2BB7 A;  3PKD A;  4U75 A;  3Q6D A;  2Q8K A;  5CE6 A;  5FCH A;  1YVM A;  4MAT A;  2GTX A;  1BN5 A;  3IU9 A;  2V3Y A;  5CLS A;  1W7V A;  4U6C A;  4U6Z A;  1C22 A;  2BHB A;  1N51 A;  4JUQ A;  2BWX A;  2BHD A;  4B28 A;  3PEB A;  2BWS A;  4ZWP A;  1R5H A;  1WL9 A;  1B59 A;  1YJ3 A;  4KM3 A;  3QOC A;  1W2M A;  1QXW A;  4OOK A;  2V6C A;  1WLR A;  3IG4 A;  4IEC A;  2GU4 A;  1XNZ A;  1C24 A;  2P98 A;  4U1B A;  4FLI A;  4U76 A;  1KQ0 A;  4FLJ A;  1QZY A;  1R5G A;  4U6E A;  1MAT A;  4IDY A;  4U6W A;  1QXZ A;  2EVO A;  1KQ9 A;  4RZZ A;  2GG9 A;  5D6F A;  4QR8 A;  2Q96 A;  4A6W A;  2EA4 A;  5CIK A;  4FUK A;  2BWT A;  2EVC A;  1YW8 A;  4IKU A;  3L7G A;  4U6J A;  4PNC A;  4ZNG A;  4S00 A;  5CDE A;  1WKM A;  3CB5 A;  1R58 A;  2GA2 A;  1XGO A;  1XGN A;  1PV9 A;  4U73 A;  2OKN A;  2OAZ A;  4FLK A;  2B3K A;  4A6V A;  1KP0 A;  3MAT A;  1WL6 A;  3OVK A;  5CNX A;  2BWY A;  1CHM A;  2BWU A; 
#chains in the Genus database with same CATH topology
 2ZSG A;  5CDL A;  4U69 A;  3PKC A;  2NQ7 A;  3D27 A;  4FO7 A;  5JFR A;  4EGE A;  2B3H A;  2Q94 A;  2BH3 A;  3FM3 A;  3O5V A;  4S2T P;  4R60 A;  2G6P A;  2Q93 A;  4ZWO A;  2NQ6 A;  3RVA A;  2GG7 A;  3OOO A;  2BN7 A;  3IL0 A;  5E5B A;  4U70 A;  2DFI A;  2EVM A;  4ZWU A;  1YW9 A;  2GG3 A;  2GU6 A;  2MAT A;  2Q92 A;  4IU6 A;  3ROR A;  2BHC A;  3CB6 A;  2B3L A;  1M35 A;  2GZ5 A;  3TB5 A;  1A16 A;  2BWW A;  1XGS A;  3MX6 A;  1QXY A;  3PKE A;  4Z7M A;  2HOW A;  4IKT A;  4S01 A;  3CTZ A;  2GGC A;  2BHA A;  2P99 A;  4IF7 A;  4PV4 A;  1WY2 A;  5E2C A;  3BIT A;  2ADU A;  1C21 A;  2GG0 A;  2GU7 A;  3L24 A;  3PKA A;  2GG8 A;  5FCF A;  5JHU A;  4IPA A;  4RZY A;  5D6E A;  3PKB A;  3PN9 A;  4FLL A;  3BIQ A;  4FKC A;  1JAW A;  2GU5 A;  2V3Z A;  2BWV A;  2Q95 A;  4S2R P;  1YW7 A;  5JI6 A;  3FMR A;  4U71 A;  1C27 A;  3I7M A;  3BIP A;  3S6B A;  2EA2 A;  5CDV A;  1XGM A;  3MR1 A;  3IU7 A;  4IKS A;  4FO8 A;  2V3X A;  1BOA A;  4RGZ 1;  4HXX A;  3TAV A;  3FMQ A;  2IW2 A;  3IU8 A;  1WBQ A;  1WN1 A;  1Y1N A;  1O0X A;  2GGB A;  2GG2 A;  2P9A A;  1C23 A;  1B6A A;  2GG5 A;  4IKR A;  2BB7 A;  3PKD A;  4U75 A;  3Q6D A;  2Q8K A;  5CE6 A;  5FCH A;  1YVM A;  4MAT A;  2GTX A;  1BN5 A;  3IU9 A;  2V3Y A;  5CLS A;  1W7V A;  4U6C A;  4U6Z A;  1C22 A;  2BHB A;  1N51 A;  4JUQ A;  2BWX A;  2BHD A;  4B28 A;  3PEB A;  2BWS A;  4ZWP A;  1R5H A;  1WL9 A;  1B59 A;  1YJ3 A;  4KM3 A;  3QOC A;  1W2M A;  1QXW A;  4OOK A;  2V6C A;  1WLR A;  3IG4 A;  4IEC A;  2GU4 A;  1XNZ A;  1C24 A;  2P98 A;  4U1B A;  4FLI A;  4U76 A;  1KQ0 A;  4FLJ A;  1QZY A;  1R5G A;  4U6E A;  1MAT A;  4IDY A;  4U6W A;  1QXZ A;  2EVO A;  1KQ9 A;  4RZZ A;  2GG9 A;  5D6F A;  4QR8 A;  2Q96 A;  4A6W A;  2EA4 A;  5CIK A;  4FUK A;  2BWT A;  2EVC A;  1YW8 A;  4IKU A;  3L7G A;  4U6J A;  4PNC A;  4ZNG A;  4S00 A;  5CDE A;  1WKM A;  3CB5 A;  1R58 A;  2GA2 A;  1XGO A;  1XGN A;  1PV9 A;  4U73 A;  2OKN A;  2OAZ A;  4FLK A;  2B3K A;  4A6V A;  1KP0 A;  3MAT A;  1WL6 A;  3OVK A;  5CNX A;  2BWY A;  1CHM A;  2BWU A; 
#chains in the Genus database with same CATH homology
 2ZSG A;  5CDL A;  4U69 A;  3PKC A;  2NQ7 A;  3D27 A;  4FO7 A;  5JFR A;  4EGE A;  2B3H A;  2Q94 A;  2BH3 A;  3FM3 A;  3O5V A;  4S2T P;  4R60 A;  2G6P A;  2Q93 A;  4ZWO A;  2NQ6 A;  3RVA A;  2GG7 A;  3OOO A;  2BN7 A;  3IL0 A;  5E5B A;  4U70 A;  2DFI A;  2EVM A;  4ZWU A;  1YW9 A;  2GG3 A;  2GU6 A;  2MAT A;  2Q92 A;  4IU6 A;  3ROR A;  2BHC A;  3CB6 A;  2B3L A;  1M35 A;  2GZ5 A;  3TB5 A;  1A16 A;  2BWW A;  1XGS A;  3MX6 A;  1QXY A;  3PKE A;  4Z7M A;  2HOW A;  4IKT A;  4S01 A;  3CTZ A;  2GGC A;  2BHA A;  2P99 A;  4IF7 A;  4PV4 A;  1WY2 A;  5E2C A;  3BIT A;  2ADU A;  1C21 A;  2GG0 A;  2GU7 A;  3L24 A;  3PKA A;  2GG8 A;  5FCF A;  5JHU A;  4IPA A;  4RZY A;  5D6E A;  3PKB A;  3PN9 A;  4FLL A;  3BIQ A;  4FKC A;  1JAW A;  2GU5 A;  2V3Z A;  2BWV A;  2Q95 A;  4S2R P;  1YW7 A;  5JI6 A;  3FMR A;  4U71 A;  1C27 A;  3I7M A;  3BIP A;  3S6B A;  2EA2 A;  5CDV A;  1XGM A;  3MR1 A;  3IU7 A;  4IKS A;  4FO8 A;  2V3X A;  1BOA A;  4RGZ 1;  4HXX A;  3TAV A;  3FMQ A;  2IW2 A;  3IU8 A;  1WBQ A;  1WN1 A;  1Y1N A;  1O0X A;  2GGB A;  2GG2 A;  2P9A A;  1C23 A;  1B6A A;  2GG5 A;  4IKR A;  2BB7 A;  3PKD A;  4U75 A;  3Q6D A;  2Q8K A;  5CE6 A;  5FCH A;  1YVM A;  4MAT A;  2GTX A;  1BN5 A;  3IU9 A;  2V3Y A;  5CLS A;  1W7V A;  4U6C A;  4U6Z A;  1C22 A;  2BHB A;  1N51 A;  4JUQ A;  2BWX A;  2BHD A;  4B28 A;  3PEB A;  2BWS A;  4ZWP A;  1R5H A;  1WL9 A;  1B59 A;  1YJ3 A;  4KM3 A;  3QOC A;  1W2M A;  1QXW A;  4OOK A;  2V6C A;  1WLR A;  3IG4 A;  4IEC A;  2GU4 A;  1XNZ A;  1C24 A;  2P98 A;  4U1B A;  4FLI A;  4U76 A;  1KQ0 A;  4FLJ A;  1QZY A;  1R5G A;  4U6E A;  1MAT A;  4IDY A;  4U6W A;  1QXZ A;  2EVO A;  1KQ9 A;  4RZZ A;  2GG9 A;  5D6F A;  4QR8 A;  2Q96 A;  4A6W A;  2EA4 A;  5CIK A;  4FUK A;  2BWT A;  2EVC A;  1YW8 A;  4IKU A;  3L7G A;  4U6J A;  4PNC A;  4ZNG A;  4S00 A;  5CDE A;  1WKM A;  3CB5 A;  1R58 A;  2GA2 A;  1XGO A;  1XGN A;  1PV9 A;  4U73 A;  2OKN A;  2OAZ A;  4FLK A;  2B3K A;  4A6V A;  1KP0 A;  3MAT A;  1WL6 A;  3OVK A;  5CNX A;  2BWY A;  1CHM A;  2BWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...