2BWTA

Asp260ala escherichia coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIAAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwtA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwtA02
3D27A 4MATA 2BH3A 1R5GA 5CLSA 2GU4A 4IKSA 3OOOA 2GA2A 2BHBA 4R60A 4PV4A 1KQ9A 1QXZA 4U71A 2Q95A 2V6CA 4U6EA 4OOKA 4RZYA 2Q96A 2EVCA 4IU6A 2EVMA 1WL6A 2Q92A 4FLJA 4QR8A 3CB5A 2GG9A 2BWUA 2P98A 4RZZA 3TB5A 4U6JA 1XNZA 5CNXA 2GZ5A 2B3LA 4U6ZA 3FM3A 2BHCA 3FMRA 4FKCA 4B28A 2HOWA 1C23A 1XGSA 4IKRA 4KM3A 2BWYA 2BHDA 2ZSGA 1QXYA 2B3KA 3IU8A 3PN9A 1XGNA 4U6WA 5CDLA 4U69A 2V3YA 3L24A 1XGOA 5CE6A 2EA2A 4U6CA 5E2CA 4U1BA 4Z7MA 1O0XA 1WN1A 4U73A 1YW7A 1KQ0A 2BWSA 2GG8A 1WKMA 2NQ7A 4U76A 2ADUA 1W7VA 2GG3A 2B3HA 2GG0A 4FO7A 3IU9A 1R5HA 3PKAA 5D6EA 5FCHA 3CB6A 2BWWA 2Q93A 2Q94A 3TAVA 1YJ3A 5CDEA 2GU7A 4U75A 1WY2A 1N51A 4FLKA 2BN7A 4A6WA 2BWXA 3IL0A 5JI6A 2GGBA 1B6AA 1W2MA 3MX6A 4IDYA 1YW9A 2OKNA 5JFRA 3PKBA 3PKDA 2G6PA 2GG7A 4FLIA 2GG2A 1BN5A 1Y1NA 1JAWA 4PNCA 3PEBA 4IECA 4ZWUA 1QXWA 4A6VA 4FLLA 2EVOA 4EGEA 3BIPA 1YVMA 2GU6A 4RGZ1 4FUKA 2P9AA 1R58A 2GTXA 3S6BA 4ZWPA 4IF7A 5CIKA 4S2RP 1B59A 4FO8A 5E5BA 2OAZA 3IG4A 4HXXA 3L7GA 1PV9A 1MATA 3FMQA 4IPAA 1C27A 1C22A 1WBQA 2BWVA 2GG5A 4U70A 2Q8KA 5D6FA 4ZNGA 2GGCA 1WLRA 3MATA 1XGMA 1A16A 5JHUA 1WL9A 3IU7A 3Q6DA 4S01A 1C21A 1KP0A 4S2TP 3CTZA 1C24A 3RVAA 1M35A 2MATA 2BWTA 5FCFA 4S00A 1CHMA 3I7MA 3PKCA 2V3XA 3QOCA 1YW8A 3PKEA 2EA4A 4IKTA 3MR1A 2V3ZA 1QZYA 2DFIA 4IKUA 4JUQA 3OVKA 2BHAA 2GU5A 3RORA 3O5VA 4ZWOA 3BIQA 3BITA 2BB7A 2IW2A 2NQ6A 2P99A 5CDVA 1BOAA
chains in the Genus database with same CATH superfamily
3D27A 4MATA 2BH3A 1R5GA 5CLSA 2GU4A 4IKSA 3OOOA 2GA2A 2BHBA 4R60A 4PV4A 1KQ9A 1QXZA 4U71A 2Q95A 2V6CA 4U6EA 4OOKA 4RZYA 2Q96A 2EVCA 4IU6A 2EVMA 1WL6A 2Q92A 4FLJA 4QR8A 3CB5A 2GG9A 2BWUA 2P98A 4RZZA 3TB5A 4U6JA 1XNZA 5CNXA 2GZ5A 2B3LA 4U6ZA 3FM3A 2BHCA 3FMRA 4FKCA 4B28A 2HOWA 1C23A 1XGSA 4IKRA 4KM3A 2BWYA 2BHDA 2ZSGA 1QXYA 2B3KA 3IU8A 3PN9A 1XGNA 4U6WA 5CDLA 4U69A 2V3YA 3L24A 1XGOA 5CE6A 2EA2A 4U6CA 5E2CA 4U1BA 4Z7MA 1O0XA 1WN1A 4U73A 1YW7A 1KQ0A 2BWSA 2GG8A 1WKMA 2NQ7A 4U76A 2ADUA 1W7VA 2GG3A 2B3HA 2GG0A 4FO7A 3IU9A 1R5HA 3PKAA 5D6EA 5FCHA 3CB6A 2BWWA 2Q93A 2Q94A 3TAVA 1YJ3A 5CDEA 2GU7A 4U75A 1WY2A 1N51A 4FLKA 2BN7A 4A6WA 2BWXA 3IL0A 5JI6A 2GGBA 1B6AA 1W2MA 3MX6A 4IDYA 1YW9A 2OKNA 5JFRA 3PKBA 3PKDA 2G6PA 2GG7A 4FLIA 2GG2A 1BN5A 1Y1NA 1JAWA 4PNCA 3PEBA 4IECA 4ZWUA 1QXWA 4A6VA 4FLLA 2EVOA 4EGEA 3BIPA 1YVMA 2GU6A 4RGZ1 4FUKA 2P9AA 1R58A 2GTXA 3S6BA 4ZWPA 4IF7A 5CIKA 4S2RP 1B59A 4FO8A 5E5BA 2OAZA 3IG4A 4HXXA 3L7GA 1PV9A 1MATA 3FMQA 4IPAA 1C27A 1C22A 1WBQA 2BWVA 2GG5A 4U70A 2Q8KA 5D6FA 4ZNGA 2GGCA 1WLRA 3MATA 1XGMA 1A16A 5JHUA 1WL9A 3IU7A 3Q6DA 4S01A 1C21A 1KP0A 4S2TP 3CTZA 1C24A 3RVAA 1M35A 2MATA 2BWTA 5FCFA 4S00A 1CHMA 3I7MA 3PKCA 2V3XA 3QOCA 1YW8A 3PKEA 2EA4A 4IKTA 3MR1A 2V3ZA 1QZYA 2DFIA 4IKUA 4JUQA 3OVKA 2BHAA 2GU5A 3RORA 3O5VA 4ZWOA 3BIQA 3BITA 2BB7A 2IW2A 2NQ6A 2P99A 5CDVA 1BOAA
chains in the Genus database with same CATH topology
3D27A 4MATA 2BH3A 1R5GA 5CLSA 2GU4A 4IKSA 3OOOA 2GA2A 2BHBA 4R60A 4PV4A 1KQ9A 1QXZA 4U71A 2Q95A 2V6CA 4U6EA 4OOKA 4RZYA 2Q96A 2EVCA 4IU6A 2EVMA 1WL6A 2Q92A 4FLJA 4QR8A 3CB5A 2GG9A 2BWUA 2P98A 4RZZA 3TB5A 4U6JA 1XNZA 5CNXA 2GZ5A 2B3LA 4U6ZA 3FM3A 2BHCA 3FMRA 4FKCA 4B28A 2HOWA 1C23A 1XGSA 4IKRA 4KM3A 2BWYA 2BHDA 2ZSGA 1QXYA 2B3KA 3IU8A 3PN9A 1XGNA 4U6WA 5CDLA 4U69A 2V3YA 3L24A 1XGOA 5CE6A 2EA2A 4U6CA 5E2CA 4U1BA 4Z7MA 1O0XA 1WN1A 4U73A 1YW7A 1KQ0A 2BWSA 2GG8A 1WKMA 2NQ7A 4U76A 2ADUA 1W7VA 2GG3A 2B3HA 2GG0A 4FO7A 3IU9A 1R5HA 3PKAA 5D6EA 5FCHA 3CB6A 2BWWA 2Q93A 2Q94A 3TAVA 1YJ3A 5CDEA 2GU7A 4U75A 1WY2A 1N51A 4FLKA 2BN7A 4A6WA 2BWXA 3IL0A 5JI6A 2GGBA 1B6AA 1W2MA 3MX6A 4IDYA 1YW9A 2OKNA 5JFRA 3PKBA 3PKDA 2G6PA 2GG7A 4FLIA 2GG2A 1BN5A 1Y1NA 1JAWA 4PNCA 3PEBA 4IECA 4ZWUA 1QXWA 4A6VA 4FLLA 2EVOA 4EGEA 3BIPA 1YVMA 2GU6A 4RGZ1 4FUKA 2P9AA 1R58A 2GTXA 3S6BA 4ZWPA 4IF7A 5CIKA 4S2RP 1B59A 4FO8A 5E5BA 2OAZA 3IG4A 4HXXA 3L7GA 1PV9A 1MATA 3FMQA 4IPAA 1C27A 1C22A 1WBQA 2BWVA 2GG5A 4U70A 2Q8KA 5D6FA 4ZNGA 2GGCA 1WLRA 3MATA 1XGMA 1A16A 5JHUA 1WL9A 3IU7A 3Q6DA 4S01A 1C21A 1KP0A 4S2TP 3CTZA 1C24A 3RVAA 1M35A 2MATA 2BWTA 5FCFA 4S00A 1CHMA 3I7MA 3PKCA 2V3XA 3QOCA 1YW8A 3PKEA 2EA4A 4IKTA 3MR1A 2V3ZA 1QZYA 2DFIA 4IKUA 4JUQA 3OVKA 2BHAA 2GU5A 3RORA 3O5VA 4ZWOA 3BIQA 3BITA 2BB7A 2IW2A 2NQ6A 2P99A 5CDVA 1BOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D27 A;  4MAT A;  2BH3 A;  1R5G A;  5CLS A;  2GU4 A;  4IKS A;  3OOO A;  2GA2 A;  2BHB A;  4R60 A;  4PV4 A;  1KQ9 A;  1QXZ A;  4U71 A;  2Q95 A;  2V6C A;  4U6E A;  4OOK A;  4RZY A;  2Q96 A;  2EVC A;  4IU6 A;  2EVM A;  1WL6 A;  2Q92 A;  4FLJ A;  4QR8 A;  3CB5 A;  2GG9 A;  2BWU A;  2P98 A;  4RZZ A;  3TB5 A;  4U6J A;  1XNZ A;  5CNX A;  2GZ5 A;  2B3L A;  4U6Z A;  3FM3 A;  2BHC A;  3FMR A;  4FKC A;  4B28 A;  2HOW A;  1C23 A;  1XGS A;  4IKR A;  4KM3 A;  2BWY A;  2BHD A;  2ZSG A;  1QXY A;  2B3K A;  3IU8 A;  3PN9 A;  1XGN A;  4U6W A;  5CDL A;  4U69 A;  2V3Y A;  3L24 A;  1XGO A;  5CE6 A;  2EA2 A;  4U6C A;  5E2C A;  4U1B A;  4Z7M A;  1O0X A;  1WN1 A;  4U73 A;  1YW7 A;  1KQ0 A;  2BWS A;  2GG8 A;  1WKM A;  2NQ7 A;  4U76 A;  2ADU A;  1W7V A;  2GG3 A;  2B3H A;  2GG0 A;  4FO7 A;  3IU9 A;  1R5H A;  3PKA A;  5D6E A;  5FCH A;  3CB6 A;  2BWW A;  2Q93 A;  2Q94 A;  3TAV A;  1YJ3 A;  5CDE A;  2GU7 A;  4U75 A;  1WY2 A;  1N51 A;  4FLK A;  2BN7 A;  4A6W A;  2BWX A;  3IL0 A;  5JI6 A;  2GGB A;  1B6A A;  1W2M A;  3MX6 A;  4IDY A;  1YW9 A;  2OKN A;  5JFR A;  3PKB A;  3PKD A;  2G6P A;  2GG7 A;  4FLI A;  2GG2 A;  1BN5 A;  1Y1N A;  1JAW A;  4PNC A;  3PEB A;  4IEC A;  4ZWU A;  1QXW A;  4A6V A;  4FLL A;  2EVO A;  4EGE A;  3BIP A;  1YVM A;  2GU6 A;  4RGZ 1;  4FUK A;  2P9A A;  1R58 A;  2GTX A;  3S6B A;  4ZWP A;  4IF7 A;  5CIK A;  4S2R P;  1B59 A;  4FO8 A;  5E5B A;  2OAZ A;  3IG4 A;  4HXX A;  3L7G A;  1PV9 A;  1MAT A;  3FMQ A;  4IPA A;  1C27 A;  1C22 A;  1WBQ A;  2BWV A;  2GG5 A;  4U70 A;  2Q8K A;  5D6F A;  4ZNG A;  2GGC A;  1WLR A;  3MAT A;  1XGM A;  1A16 A;  5JHU A;  1WL9 A;  3IU7 A;  3Q6D A;  4S01 A;  1C21 A;  1KP0 A;  4S2T P;  3CTZ A;  1C24 A;  3RVA A;  1M35 A;  2MAT A;  2BWT A;  5FCF A;  4S00 A;  1CHM A;  3I7M A;  3PKC A;  2V3X A;  3QOC A;  1YW8 A;  3PKE A;  2EA4 A;  4IKT A;  3MR1 A;  2V3Z A;  1QZY A;  2DFI A;  4IKU A;  4JUQ A;  3OVK A;  2BHA A;  2GU5 A;  3ROR A;  3O5V A;  4ZWO A;  3BIQ A;  3BIT A;  2BB7 A;  2IW2 A;  2NQ6 A;  2P99 A;  5CDV A;  1BOA A; 
#chains in the Genus database with same CATH topology
 3D27 A;  4MAT A;  2BH3 A;  1R5G A;  5CLS A;  2GU4 A;  4IKS A;  3OOO A;  2GA2 A;  2BHB A;  4R60 A;  4PV4 A;  1KQ9 A;  1QXZ A;  4U71 A;  2Q95 A;  2V6C A;  4U6E A;  4OOK A;  4RZY A;  2Q96 A;  2EVC A;  4IU6 A;  2EVM A;  1WL6 A;  2Q92 A;  4FLJ A;  4QR8 A;  3CB5 A;  2GG9 A;  2BWU A;  2P98 A;  4RZZ A;  3TB5 A;  4U6J A;  1XNZ A;  5CNX A;  2GZ5 A;  2B3L A;  4U6Z A;  3FM3 A;  2BHC A;  3FMR A;  4FKC A;  4B28 A;  2HOW A;  1C23 A;  1XGS A;  4IKR A;  4KM3 A;  2BWY A;  2BHD A;  2ZSG A;  1QXY A;  2B3K A;  3IU8 A;  3PN9 A;  1XGN A;  4U6W A;  5CDL A;  4U69 A;  2V3Y A;  3L24 A;  1XGO A;  5CE6 A;  2EA2 A;  4U6C A;  5E2C A;  4U1B A;  4Z7M A;  1O0X A;  1WN1 A;  4U73 A;  1YW7 A;  1KQ0 A;  2BWS A;  2GG8 A;  1WKM A;  2NQ7 A;  4U76 A;  2ADU A;  1W7V A;  2GG3 A;  2B3H A;  2GG0 A;  4FO7 A;  3IU9 A;  1R5H A;  3PKA A;  5D6E A;  5FCH A;  3CB6 A;  2BWW A;  2Q93 A;  2Q94 A;  3TAV A;  1YJ3 A;  5CDE A;  2GU7 A;  4U75 A;  1WY2 A;  1N51 A;  4FLK A;  2BN7 A;  4A6W A;  2BWX A;  3IL0 A;  5JI6 A;  2GGB A;  1B6A A;  1W2M A;  3MX6 A;  4IDY A;  1YW9 A;  2OKN A;  5JFR A;  3PKB A;  3PKD A;  2G6P A;  2GG7 A;  4FLI A;  2GG2 A;  1BN5 A;  1Y1N A;  1JAW A;  4PNC A;  3PEB A;  4IEC A;  4ZWU A;  1QXW A;  4A6V A;  4FLL A;  2EVO A;  4EGE A;  3BIP A;  1YVM A;  2GU6 A;  4RGZ 1;  4FUK A;  2P9A A;  1R58 A;  2GTX A;  3S6B A;  4ZWP A;  4IF7 A;  5CIK A;  4S2R P;  1B59 A;  4FO8 A;  5E5B A;  2OAZ A;  3IG4 A;  4HXX A;  3L7G A;  1PV9 A;  1MAT A;  3FMQ A;  4IPA A;  1C27 A;  1C22 A;  1WBQ A;  2BWV A;  2GG5 A;  4U70 A;  2Q8K A;  5D6F A;  4ZNG A;  2GGC A;  1WLR A;  3MAT A;  1XGM A;  1A16 A;  5JHU A;  1WL9 A;  3IU7 A;  3Q6D A;  4S01 A;  1C21 A;  1KP0 A;  4S2T P;  3CTZ A;  1C24 A;  3RVA A;  1M35 A;  2MAT A;  2BWT A;  5FCF A;  4S00 A;  1CHM A;  3I7M A;  3PKC A;  2V3X A;  3QOC A;  1YW8 A;  3PKE A;  2EA4 A;  4IKT A;  3MR1 A;  2V3Z A;  1QZY A;  2DFI A;  4IKU A;  4JUQ A;  3OVK A;  2BHA A;  2GU5 A;  3ROR A;  3O5V A;  4ZWO A;  3BIQ A;  3BIT A;  2BB7 A;  2IW2 A;  2NQ6 A;  2P99 A;  5CDV A;  1BOA A; 
#chains in the Genus database with same CATH homology
 3D27 A;  4MAT A;  2BH3 A;  1R5G A;  5CLS A;  2GU4 A;  4IKS A;  3OOO A;  2GA2 A;  2BHB A;  4R60 A;  4PV4 A;  1KQ9 A;  1QXZ A;  4U71 A;  2Q95 A;  2V6C A;  4U6E A;  4OOK A;  4RZY A;  2Q96 A;  2EVC A;  4IU6 A;  2EVM A;  1WL6 A;  2Q92 A;  4FLJ A;  4QR8 A;  3CB5 A;  2GG9 A;  2BWU A;  2P98 A;  4RZZ A;  3TB5 A;  4U6J A;  1XNZ A;  5CNX A;  2GZ5 A;  2B3L A;  4U6Z A;  3FM3 A;  2BHC A;  3FMR A;  4FKC A;  4B28 A;  2HOW A;  1C23 A;  1XGS A;  4IKR A;  4KM3 A;  2BWY A;  2BHD A;  2ZSG A;  1QXY A;  2B3K A;  3IU8 A;  3PN9 A;  1XGN A;  4U6W A;  5CDL A;  4U69 A;  2V3Y A;  3L24 A;  1XGO A;  5CE6 A;  2EA2 A;  4U6C A;  5E2C A;  4U1B A;  4Z7M A;  1O0X A;  1WN1 A;  4U73 A;  1YW7 A;  1KQ0 A;  2BWS A;  2GG8 A;  1WKM A;  2NQ7 A;  4U76 A;  2ADU A;  1W7V A;  2GG3 A;  2B3H A;  2GG0 A;  4FO7 A;  3IU9 A;  1R5H A;  3PKA A;  5D6E A;  5FCH A;  3CB6 A;  2BWW A;  2Q93 A;  2Q94 A;  3TAV A;  1YJ3 A;  5CDE A;  2GU7 A;  4U75 A;  1WY2 A;  1N51 A;  4FLK A;  2BN7 A;  4A6W A;  2BWX A;  3IL0 A;  5JI6 A;  2GGB A;  1B6A A;  1W2M A;  3MX6 A;  4IDY A;  1YW9 A;  2OKN A;  5JFR A;  3PKB A;  3PKD A;  2G6P A;  2GG7 A;  4FLI A;  2GG2 A;  1BN5 A;  1Y1N A;  1JAW A;  4PNC A;  3PEB A;  4IEC A;  4ZWU A;  1QXW A;  4A6V A;  4FLL A;  2EVO A;  4EGE A;  3BIP A;  1YVM A;  2GU6 A;  4RGZ 1;  4FUK A;  2P9A A;  1R58 A;  2GTX A;  3S6B A;  4ZWP A;  4IF7 A;  5CIK A;  4S2R P;  1B59 A;  4FO8 A;  5E5B A;  2OAZ A;  3IG4 A;  4HXX A;  3L7G A;  1PV9 A;  1MAT A;  3FMQ A;  4IPA A;  1C27 A;  1C22 A;  1WBQ A;  2BWV A;  2GG5 A;  4U70 A;  2Q8K A;  5D6F A;  4ZNG A;  2GGC A;  1WLR A;  3MAT A;  1XGM A;  1A16 A;  5JHU A;  1WL9 A;  3IU7 A;  3Q6D A;  4S01 A;  1C21 A;  1KP0 A;  4S2T P;  3CTZ A;  1C24 A;  3RVA A;  1M35 A;  2MAT A;  2BWT A;  5FCF A;  4S00 A;  1CHM A;  3I7M A;  3PKC A;  2V3X A;  3QOC A;  1YW8 A;  3PKE A;  2EA4 A;  4IKT A;  3MR1 A;  2V3Z A;  1QZY A;  2DFI A;  4IKU A;  4JUQ A;  3OVK A;  2BHA A;  2GU5 A;  3ROR A;  3O5V A;  4ZWO A;  3BIQ A;  3BIT A;  2BB7 A;  2IW2 A;  2NQ6 A;  2P99 A;  5CDV A;  1BOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...