2BWTA

Asp260ala escherichia coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIAAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE P
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwtA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwtA02
1YW8A 2GU6A 1C27A 2GG9A 4U6ZA 3IL0A 5CIKA 4IF7A 5FCHA 4S01A 3PEBA 5D6FA 4IKSA 3S6BA 1BN5A 4IKRA 1XGOA 2BWXA 4IECA 4IDYA 3BIQA 1WLRA 4U6WA 2GG5A 1WY2A 1B6AA 1WL9A 1QXZA 3PKCA 4FKCA 2GU4A 4KM3A 3PKEA 3L7GA 1B59A 2BN7A 1W2MA 2P9AA 2HOWA 4B28A 3PN9A 1O0XA 2IW2A 3CTZA 4ZWOA 2EVOA 1BOAA 4FLKA 4IKUA 4FLJA 3RORA 3MX6A 2NQ7A 2P99A 3PKAA 2P98A 4S00A 4MATA 1C22A 3TAVA 4U69A 3FM3A 4U6CA 1W7VA 1C23A 5E5BA 3L24A 2BHBA 4U6EA 2GG8A 1KP0A 4Z7MA 5JHUA 3PKBA 4ZWPA 4U71A 1YW7A 2OAZA 1KQ9A 3OVKA 3OOOA 3CB6A 2Q93A 2G6PA 2EVCA 1WL6A 1WKMA 2ADUA 3PKDA 4R60A 4U73A 2MATA 4FO8A 3MR1A 2B3HA 3IU9A 3CB5A 4ZWUA 1WN1A 4FLIA 2BWWA 4IKTA 5CLSA 4JUQA 5E2CA 3I7MA 1XGMA 2B3KA 2GTXA 4FO7A 3QOCA 5CDEA 2Q94A 2V6CA 2GZ5A 1C21A 4HXXA 1WBQA 1XNZA 1JAWA 4IU6A 1MATA 5CDVA 1QXYA 2BWUA 1XGSA 2EA4A 2Q96A 4PNCA 5D6EA 2Q92A 2GG0A 4PV4A 1YVMA 1R5HA 2GGBA 2EVMA 2BWTA 2GU5A 2NQ6A 2V3XA 1CHMA 2BH3A 1XGNA 2EA2A 3FMQA 4IPAA 1Y1NA 3O5VA 2BWVA 4S2RP 5JFRA 5JI6A 4FLLA 1KQ0A 2DFIA 2BHCA 2BWYA 3Q6DA 3TB5A 4RZZA 2GG3A 2Q95A 5CNXA 1YJ3A 2V3YA 2GU7A 4A6VA 3D27A 1A16A 2BWSA 1N51A 2BB7A 3FMRA 5CE6A 1C24A 4U75A 2BHAA 2V3ZA 2GG2A 2GGCA 4QR8A 4A6WA 4RZYA 1QZYA 4S2TP 4RGZ1 5FCFA 3MATA 2GA2A 1QXWA 1PV9A 3BIPA 1YW9A 4U6JA 5CDLA 1R58A 4U76A 4FUKA 1M35A 3BITA 2GG7A 1R5GA 4OOKA 3IU7A 4EGEA 2B3LA 4U1BA 4U70A 3RVAA 4ZNGA 2Q8KA 2OKNA 3IG4A 2ZSGA 2BHDA 3IU8A
chains in the Genus database with same CATH superfamily
1YW8A 2GU6A 1C27A 2GG9A 4U6ZA 3IL0A 5CIKA 4IF7A 5FCHA 4S01A 3PEBA 5D6FA 4IKSA 3S6BA 1BN5A 4IKRA 1XGOA 2BWXA 4IECA 4IDYA 3BIQA 1WLRA 4U6WA 2GG5A 1WY2A 1B6AA 1WL9A 1QXZA 3PKCA 4FKCA 2GU4A 4KM3A 3PKEA 3L7GA 1B59A 2BN7A 1W2MA 2P9AA 2HOWA 4B28A 3PN9A 1O0XA 2IW2A 3CTZA 4ZWOA 2EVOA 1BOAA 4FLKA 4IKUA 4FLJA 3RORA 3MX6A 2NQ7A 2P99A 3PKAA 2P98A 4S00A 4MATA 1C22A 3TAVA 4U69A 3FM3A 4U6CA 1W7VA 1C23A 5E5BA 3L24A 2BHBA 4U6EA 2GG8A 1KP0A 4Z7MA 5JHUA 3PKBA 4ZWPA 4U71A 1YW7A 2OAZA 1KQ9A 3OVKA 3OOOA 3CB6A 2Q93A 2G6PA 2EVCA 1WL6A 1WKMA 2ADUA 3PKDA 4R60A 4U73A 2MATA 4FO8A 3MR1A 2B3HA 3IU9A 3CB5A 4ZWUA 1WN1A 4FLIA 2BWWA 4IKTA 5CLSA 4JUQA 5E2CA 3I7MA 1XGMA 2B3KA 2GTXA 4FO7A 3QOCA 5CDEA 2Q94A 2V6CA 2GZ5A 1C21A 4HXXA 1WBQA 1XNZA 1JAWA 4IU6A 1MATA 5CDVA 1QXYA 2BWUA 1XGSA 2EA4A 2Q96A 4PNCA 5D6EA 2Q92A 2GG0A 4PV4A 1YVMA 1R5HA 2GGBA 2EVMA 2BWTA 2GU5A 2NQ6A 2V3XA 1CHMA 2BH3A 1XGNA 2EA2A 3FMQA 4IPAA 1Y1NA 3O5VA 2BWVA 4S2RP 5JFRA 5JI6A 4FLLA 1KQ0A 2DFIA 2BHCA 2BWYA 3Q6DA 3TB5A 4RZZA 2GG3A 2Q95A 5CNXA 1YJ3A 2V3YA 2GU7A 4A6VA 3D27A 1A16A 2BWSA 1N51A 2BB7A 3FMRA 5CE6A 1C24A 4U75A 2BHAA 2V3ZA 2GG2A 2GGCA 4QR8A 4A6WA 4RZYA 1QZYA 4S2TP 4RGZ1 5FCFA 3MATA 2GA2A 1QXWA 1PV9A 3BIPA 1YW9A 4U6JA 5CDLA 1R58A 4U76A 4FUKA 1M35A 3BITA 2GG7A 1R5GA 4OOKA 3IU7A 4EGEA 2B3LA 4U1BA 4U70A 3RVAA 4ZNGA 2Q8KA 2OKNA 3IG4A 2ZSGA 2BHDA 3IU8A
chains in the Genus database with same CATH topology
1YW8A 2GU6A 1C27A 2GG9A 4U6ZA 3IL0A 5CIKA 4IF7A 5FCHA 4S01A 3PEBA 5D6FA 4IKSA 3S6BA 1BN5A 4IKRA 1XGOA 2BWXA 4IECA 4IDYA 3BIQA 1WLRA 4U6WA 2GG5A 1WY2A 1B6AA 1WL9A 1QXZA 3PKCA 4FKCA 2GU4A 4KM3A 3PKEA 3L7GA 1B59A 2BN7A 1W2MA 2P9AA 2HOWA 4B28A 3PN9A 1O0XA 2IW2A 3CTZA 4ZWOA 2EVOA 1BOAA 4FLKA 4IKUA 4FLJA 3RORA 3MX6A 2NQ7A 2P99A 3PKAA 2P98A 4S00A 4MATA 1C22A 3TAVA 4U69A 3FM3A 4U6CA 1W7VA 1C23A 5E5BA 3L24A 2BHBA 4U6EA 2GG8A 1KP0A 4Z7MA 5JHUA 3PKBA 4ZWPA 4U71A 1YW7A 2OAZA 1KQ9A 3OVKA 3OOOA 3CB6A 2Q93A 2G6PA 2EVCA 1WL6A 1WKMA 2ADUA 3PKDA 4R60A 4U73A 2MATA 4FO8A 3MR1A 2B3HA 3IU9A 3CB5A 4ZWUA 1WN1A 4FLIA 2BWWA 4IKTA 5CLSA 4JUQA 5E2CA 3I7MA 1XGMA 2B3KA 2GTXA 4FO7A 3QOCA 5CDEA 2Q94A 2V6CA 2GZ5A 1C21A 4HXXA 1WBQA 1XNZA 1JAWA 4IU6A 1MATA 5CDVA 1QXYA 2BWUA 1XGSA 2EA4A 2Q96A 4PNCA 5D6EA 2Q92A 2GG0A 4PV4A 1YVMA 1R5HA 2GGBA 2EVMA 2BWTA 2GU5A 2NQ6A 2V3XA 1CHMA 2BH3A 1XGNA 2EA2A 3FMQA 4IPAA 1Y1NA 3O5VA 2BWVA 4S2RP 5JFRA 5JI6A 4FLLA 1KQ0A 2DFIA 2BHCA 2BWYA 3Q6DA 3TB5A 4RZZA 2GG3A 2Q95A 5CNXA 1YJ3A 2V3YA 2GU7A 4A6VA 3D27A 1A16A 2BWSA 1N51A 2BB7A 3FMRA 5CE6A 1C24A 4U75A 2BHAA 2V3ZA 2GG2A 2GGCA 4QR8A 4A6WA 4RZYA 1QZYA 4S2TP 4RGZ1 5FCFA 3MATA 2GA2A 1QXWA 1PV9A 3BIPA 1YW9A 4U6JA 5CDLA 1R58A 4U76A 4FUKA 1M35A 3BITA 2GG7A 1R5GA 4OOKA 3IU7A 4EGEA 2B3LA 4U1BA 4U70A 3RVAA 4ZNGA 2Q8KA 2OKNA 3IG4A 2ZSGA 2BHDA 3IU8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW8 A;  2GU6 A;  1C27 A;  2GG9 A;  4U6Z A;  3IL0 A;  5CIK A;  4IF7 A;  5FCH A;  4S01 A;  3PEB A;  5D6F A;  4IKS A;  3S6B A;  1BN5 A;  4IKR A;  1XGO A;  2BWX A;  4IEC A;  4IDY A;  3BIQ A;  1WLR A;  4U6W A;  2GG5 A;  1WY2 A;  1B6A A;  1WL9 A;  1QXZ A;  3PKC A;  4FKC A;  2GU4 A;  4KM3 A;  3PKE A;  3L7G A;  1B59 A;  2BN7 A;  1W2M A;  2P9A A;  2HOW A;  4B28 A;  3PN9 A;  1O0X A;  2IW2 A;  3CTZ A;  4ZWO A;  2EVO A;  1BOA A;  4FLK A;  4IKU A;  4FLJ A;  3ROR A;  3MX6 A;  2NQ7 A;  2P99 A;  3PKA A;  2P98 A;  4S00 A;  4MAT A;  1C22 A;  3TAV A;  4U69 A;  3FM3 A;  4U6C A;  1W7V A;  1C23 A;  5E5B A;  3L24 A;  2BHB A;  4U6E A;  2GG8 A;  1KP0 A;  4Z7M A;  5JHU A;  3PKB A;  4ZWP A;  4U71 A;  1YW7 A;  2OAZ A;  1KQ9 A;  3OVK A;  3OOO A;  3CB6 A;  2Q93 A;  2G6P A;  2EVC A;  1WL6 A;  1WKM A;  2ADU A;  3PKD A;  4R60 A;  4U73 A;  2MAT A;  4FO8 A;  3MR1 A;  2B3H A;  3IU9 A;  3CB5 A;  4ZWU A;  1WN1 A;  4FLI A;  2BWW A;  4IKT A;  5CLS A;  4JUQ A;  5E2C A;  3I7M A;  1XGM A;  2B3K A;  2GTX A;  4FO7 A;  3QOC A;  5CDE A;  2Q94 A;  2V6C A;  2GZ5 A;  1C21 A;  4HXX A;  1WBQ A;  1XNZ A;  1JAW A;  4IU6 A;  1MAT A;  5CDV A;  1QXY A;  2BWU A;  1XGS A;  2EA4 A;  2Q96 A;  4PNC A;  5D6E A;  2Q92 A;  2GG0 A;  4PV4 A;  1YVM A;  1R5H A;  2GGB A;  2EVM A;  2BWT A;  2GU5 A;  2NQ6 A;  2V3X A;  1CHM A;  2BH3 A;  1XGN A;  2EA2 A;  3FMQ A;  4IPA A;  1Y1N A;  3O5V A;  2BWV A;  4S2R P;  5JFR A;  5JI6 A;  4FLL A;  1KQ0 A;  2DFI A;  2BHC A;  2BWY A;  3Q6D A;  3TB5 A;  4RZZ A;  2GG3 A;  2Q95 A;  5CNX A;  1YJ3 A;  2V3Y A;  2GU7 A;  4A6V A;  3D27 A;  1A16 A;  2BWS A;  1N51 A;  2BB7 A;  3FMR A;  5CE6 A;  1C24 A;  4U75 A;  2BHA A;  2V3Z A;  2GG2 A;  2GGC A;  4QR8 A;  4A6W A;  4RZY A;  1QZY A;  4S2T P;  4RGZ 1;  5FCF A;  3MAT A;  2GA2 A;  1QXW A;  1PV9 A;  3BIP A;  1YW9 A;  4U6J A;  5CDL A;  1R58 A;  4U76 A;  4FUK A;  1M35 A;  3BIT A;  2GG7 A;  1R5G A;  4OOK A;  3IU7 A;  4EGE A;  2B3L A;  4U1B A;  4U70 A;  3RVA A;  4ZNG A;  2Q8K A;  2OKN A;  3IG4 A;  2ZSG A;  2BHD A;  3IU8 A; 
#chains in the Genus database with same CATH topology
 1YW8 A;  2GU6 A;  1C27 A;  2GG9 A;  4U6Z A;  3IL0 A;  5CIK A;  4IF7 A;  5FCH A;  4S01 A;  3PEB A;  5D6F A;  4IKS A;  3S6B A;  1BN5 A;  4IKR A;  1XGO A;  2BWX A;  4IEC A;  4IDY A;  3BIQ A;  1WLR A;  4U6W A;  2GG5 A;  1WY2 A;  1B6A A;  1WL9 A;  1QXZ A;  3PKC A;  4FKC A;  2GU4 A;  4KM3 A;  3PKE A;  3L7G A;  1B59 A;  2BN7 A;  1W2M A;  2P9A A;  2HOW A;  4B28 A;  3PN9 A;  1O0X A;  2IW2 A;  3CTZ A;  4ZWO A;  2EVO A;  1BOA A;  4FLK A;  4IKU A;  4FLJ A;  3ROR A;  3MX6 A;  2NQ7 A;  2P99 A;  3PKA A;  2P98 A;  4S00 A;  4MAT A;  1C22 A;  3TAV A;  4U69 A;  3FM3 A;  4U6C A;  1W7V A;  1C23 A;  5E5B A;  3L24 A;  2BHB A;  4U6E A;  2GG8 A;  1KP0 A;  4Z7M A;  5JHU A;  3PKB A;  4ZWP A;  4U71 A;  1YW7 A;  2OAZ A;  1KQ9 A;  3OVK A;  3OOO A;  3CB6 A;  2Q93 A;  2G6P A;  2EVC A;  1WL6 A;  1WKM A;  2ADU A;  3PKD A;  4R60 A;  4U73 A;  2MAT A;  4FO8 A;  3MR1 A;  2B3H A;  3IU9 A;  3CB5 A;  4ZWU A;  1WN1 A;  4FLI A;  2BWW A;  4IKT A;  5CLS A;  4JUQ A;  5E2C A;  3I7M A;  1XGM A;  2B3K A;  2GTX A;  4FO7 A;  3QOC A;  5CDE A;  2Q94 A;  2V6C A;  2GZ5 A;  1C21 A;  4HXX A;  1WBQ A;  1XNZ A;  1JAW A;  4IU6 A;  1MAT A;  5CDV A;  1QXY A;  2BWU A;  1XGS A;  2EA4 A;  2Q96 A;  4PNC A;  5D6E A;  2Q92 A;  2GG0 A;  4PV4 A;  1YVM A;  1R5H A;  2GGB A;  2EVM A;  2BWT A;  2GU5 A;  2NQ6 A;  2V3X A;  1CHM A;  2BH3 A;  1XGN A;  2EA2 A;  3FMQ A;  4IPA A;  1Y1N A;  3O5V A;  2BWV A;  4S2R P;  5JFR A;  5JI6 A;  4FLL A;  1KQ0 A;  2DFI A;  2BHC A;  2BWY A;  3Q6D A;  3TB5 A;  4RZZ A;  2GG3 A;  2Q95 A;  5CNX A;  1YJ3 A;  2V3Y A;  2GU7 A;  4A6V A;  3D27 A;  1A16 A;  2BWS A;  1N51 A;  2BB7 A;  3FMR A;  5CE6 A;  1C24 A;  4U75 A;  2BHA A;  2V3Z A;  2GG2 A;  2GGC A;  4QR8 A;  4A6W A;  4RZY A;  1QZY A;  4S2T P;  4RGZ 1;  5FCF A;  3MAT A;  2GA2 A;  1QXW A;  1PV9 A;  3BIP A;  1YW9 A;  4U6J A;  5CDL A;  1R58 A;  4U76 A;  4FUK A;  1M35 A;  3BIT A;  2GG7 A;  1R5G A;  4OOK A;  3IU7 A;  4EGE A;  2B3L A;  4U1B A;  4U70 A;  3RVA A;  4ZNG A;  2Q8K A;  2OKN A;  3IG4 A;  2ZSG A;  2BHD A;  3IU8 A; 
#chains in the Genus database with same CATH homology
 1YW8 A;  2GU6 A;  1C27 A;  2GG9 A;  4U6Z A;  3IL0 A;  5CIK A;  4IF7 A;  5FCH A;  4S01 A;  3PEB A;  5D6F A;  4IKS A;  3S6B A;  1BN5 A;  4IKR A;  1XGO A;  2BWX A;  4IEC A;  4IDY A;  3BIQ A;  1WLR A;  4U6W A;  2GG5 A;  1WY2 A;  1B6A A;  1WL9 A;  1QXZ A;  3PKC A;  4FKC A;  2GU4 A;  4KM3 A;  3PKE A;  3L7G A;  1B59 A;  2BN7 A;  1W2M A;  2P9A A;  2HOW A;  4B28 A;  3PN9 A;  1O0X A;  2IW2 A;  3CTZ A;  4ZWO A;  2EVO A;  1BOA A;  4FLK A;  4IKU A;  4FLJ A;  3ROR A;  3MX6 A;  2NQ7 A;  2P99 A;  3PKA A;  2P98 A;  4S00 A;  4MAT A;  1C22 A;  3TAV A;  4U69 A;  3FM3 A;  4U6C A;  1W7V A;  1C23 A;  5E5B A;  3L24 A;  2BHB A;  4U6E A;  2GG8 A;  1KP0 A;  4Z7M A;  5JHU A;  3PKB A;  4ZWP A;  4U71 A;  1YW7 A;  2OAZ A;  1KQ9 A;  3OVK A;  3OOO A;  3CB6 A;  2Q93 A;  2G6P A;  2EVC A;  1WL6 A;  1WKM A;  2ADU A;  3PKD A;  4R60 A;  4U73 A;  2MAT A;  4FO8 A;  3MR1 A;  2B3H A;  3IU9 A;  3CB5 A;  4ZWU A;  1WN1 A;  4FLI A;  2BWW A;  4IKT A;  5CLS A;  4JUQ A;  5E2C A;  3I7M A;  1XGM A;  2B3K A;  2GTX A;  4FO7 A;  3QOC A;  5CDE A;  2Q94 A;  2V6C A;  2GZ5 A;  1C21 A;  4HXX A;  1WBQ A;  1XNZ A;  1JAW A;  4IU6 A;  1MAT A;  5CDV A;  1QXY A;  2BWU A;  1XGS A;  2EA4 A;  2Q96 A;  4PNC A;  5D6E A;  2Q92 A;  2GG0 A;  4PV4 A;  1YVM A;  1R5H A;  2GGB A;  2EVM A;  2BWT A;  2GU5 A;  2NQ6 A;  2V3X A;  1CHM A;  2BH3 A;  1XGN A;  2EA2 A;  3FMQ A;  4IPA A;  1Y1N A;  3O5V A;  2BWV A;  4S2R P;  5JFR A;  5JI6 A;  4FLL A;  1KQ0 A;  2DFI A;  2BHC A;  2BWY A;  3Q6D A;  3TB5 A;  4RZZ A;  2GG3 A;  2Q95 A;  5CNX A;  1YJ3 A;  2V3Y A;  2GU7 A;  4A6V A;  3D27 A;  1A16 A;  2BWS A;  1N51 A;  2BB7 A;  3FMR A;  5CE6 A;  1C24 A;  4U75 A;  2BHA A;  2V3Z A;  2GG2 A;  2GGC A;  4QR8 A;  4A6W A;  4RZY A;  1QZY A;  4S2T P;  4RGZ 1;  5FCF A;  3MAT A;  2GA2 A;  1QXW A;  1PV9 A;  3BIP A;  1YW9 A;  4U6J A;  5CDL A;  1R58 A;  4U76 A;  4FUK A;  1M35 A;  3BIT A;  2GG7 A;  1R5G A;  4OOK A;  3IU7 A;  4EGE A;  2B3L A;  4U1B A;  4U70 A;  3RVA A;  4ZNG A;  2Q8K A;  2OKN A;  3IG4 A;  2ZSG A;  2BHD A;  3IU8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...