2BWTA

Asp260ala escherichia coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIAAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwtA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwtA02
1C21A 1R5GA 3IU9A 5D6EA 4U6JA 4A6VA 1KQ0A 4IKRA 4RGZ1 4IF7A 4QR8A 1WKMA 4JUQA 5JFRA 4IU6A 2BWYA 1WY2A 1W7VA 5CDEA 3PKEA 2P98A 1R5HA 2HOWA 4FKCA 2Q95A 1BOAA 2EA4A 1M35A 5CIKA 4U6CA 4IKTA 1KQ9A 3I7MA 4S00A 4U75A 2GG2A 3PN9A 1B6AA 5CE6A 5JHUA 4U6ZA 2GG9A 1WLRA 1YW9A 4IDYA 3IL0A 5D6FA 2BWTA 1C22A 2V3YA 5JI6A 1QXYA 3OOOA 4KM3A 2BWUA 2GG0A 2BWVA 2BWXA 1YW8A 3IU8A 4RZYA 4FLIA 5CDLA 2Q94A 1JAWA 3RVAA 4U70A 2EVCA 4IECA 4FLKA 2V3XA 1C24A 2V3ZA 1QXZA 4MATA 5CLSA 2BHCA 1QZYA 3IU7A 4U69A 4ZWUA 2BHDA 2MATA 3L24A 2IW2A 5FCFA 2B3HA 4U76A 3CB5A 4FLLA 4RZZA 1R58A 3CTZA 2BWSA 1XGOA 2GA2A 1B59A 2Q96A 2BWWA 4R60A 2GU7A 3TB5A 2OKNA 1BN5A 3MATA 4U71A 2GU6A 3S6BA 4Z7MA 2P9AA 2Q93A 3BIPA 1C27A 1PV9A 2GG5A 5E5BA 2BHAA 2GTXA 1A16A 3CB6A 5E2CA 1YW7A 2NQ6A 2V6CA 1WL6A 2ZSGA 2BH3A 1KP0A 4S2RP 1YVMA 2BB7A 4IKSA 2EVMA 2NQ7A 4U6WA 3PKCA 1WN1A 3FM3A 4IPAA 1WBQA 2GU5A 3OVKA 2Q8KA 1XGNA 3MR1A 2BN7A 3RORA 1XGMA 4ZWPA 2Q92A 2GG3A 4HXXA 4PNCA 2GG8A 3TAVA 4B28A 2B3LA 3D27A 1WL9A 3L7GA 2G6PA 4FO7A 1QXWA 5CNXA 2GZ5A 4OOKA 3Q6DA 1O0XA 1XGSA 2P99A 1MATA 3MX6A 2GG7A 2EA2A 3PKAA 2ADUA 1Y1NA 2OAZA 4FUKA 3QOCA 1C23A 4IKUA 3O5VA 1XNZA 3FMQA 4S01A 2EVOA 4U6EA 4FO8A 4A6WA 1YJ3A 3PKDA 3IG4A 3BITA 4PV4A 2DFIA 4ZNGA 2GGBA 1N51A 2GGCA 3FMRA 1CHMA 3BIQA 3PKBA 4FLJA 5FCHA 1W2MA 2BHBA 2B3KA 4U73A 4ZWOA 5CDVA 4EGEA 4S2TP 2GU4A 3PEBA 4U1BA
chains in the Genus database with same CATH superfamily
1C21A 1R5GA 3IU9A 5D6EA 4U6JA 4A6VA 1KQ0A 4IKRA 4RGZ1 4IF7A 4QR8A 1WKMA 4JUQA 5JFRA 4IU6A 2BWYA 1WY2A 1W7VA 5CDEA 3PKEA 2P98A 1R5HA 2HOWA 4FKCA 2Q95A 1BOAA 2EA4A 1M35A 5CIKA 4U6CA 4IKTA 1KQ9A 3I7MA 4S00A 4U75A 2GG2A 3PN9A 1B6AA 5CE6A 5JHUA 4U6ZA 2GG9A 1WLRA 1YW9A 4IDYA 3IL0A 5D6FA 2BWTA 1C22A 2V3YA 5JI6A 1QXYA 3OOOA 4KM3A 2BWUA 2GG0A 2BWVA 2BWXA 1YW8A 3IU8A 4RZYA 4FLIA 5CDLA 2Q94A 1JAWA 3RVAA 4U70A 2EVCA 4IECA 4FLKA 2V3XA 1C24A 2V3ZA 1QXZA 4MATA 5CLSA 2BHCA 1QZYA 3IU7A 4U69A 4ZWUA 2BHDA 2MATA 3L24A 2IW2A 5FCFA 2B3HA 4U76A 3CB5A 4FLLA 4RZZA 1R58A 3CTZA 2BWSA 1XGOA 2GA2A 1B59A 2Q96A 2BWWA 4R60A 2GU7A 3TB5A 2OKNA 1BN5A 3MATA 4U71A 2GU6A 3S6BA 4Z7MA 2P9AA 2Q93A 3BIPA 1C27A 1PV9A 2GG5A 5E5BA 2BHAA 2GTXA 1A16A 3CB6A 5E2CA 1YW7A 2NQ6A 2V6CA 1WL6A 2ZSGA 2BH3A 1KP0A 4S2RP 1YVMA 2BB7A 4IKSA 2EVMA 2NQ7A 4U6WA 3PKCA 1WN1A 3FM3A 4IPAA 1WBQA 2GU5A 3OVKA 2Q8KA 1XGNA 3MR1A 2BN7A 3RORA 1XGMA 4ZWPA 2Q92A 2GG3A 4HXXA 4PNCA 2GG8A 3TAVA 4B28A 2B3LA 3D27A 1WL9A 3L7GA 2G6PA 4FO7A 1QXWA 5CNXA 2GZ5A 4OOKA 3Q6DA 1O0XA 1XGSA 2P99A 1MATA 3MX6A 2GG7A 2EA2A 3PKAA 2ADUA 1Y1NA 2OAZA 4FUKA 3QOCA 1C23A 4IKUA 3O5VA 1XNZA 3FMQA 4S01A 2EVOA 4U6EA 4FO8A 4A6WA 1YJ3A 3PKDA 3IG4A 3BITA 4PV4A 2DFIA 4ZNGA 2GGBA 1N51A 2GGCA 3FMRA 1CHMA 3BIQA 3PKBA 4FLJA 5FCHA 1W2MA 2BHBA 2B3KA 4U73A 4ZWOA 5CDVA 4EGEA 4S2TP 2GU4A 3PEBA 4U1BA
chains in the Genus database with same CATH topology
1C21A 1R5GA 3IU9A 5D6EA 4U6JA 4A6VA 1KQ0A 4IKRA 4RGZ1 4IF7A 4QR8A 1WKMA 4JUQA 5JFRA 4IU6A 2BWYA 1WY2A 1W7VA 5CDEA 3PKEA 2P98A 1R5HA 2HOWA 4FKCA 2Q95A 1BOAA 2EA4A 1M35A 5CIKA 4U6CA 4IKTA 1KQ9A 3I7MA 4S00A 4U75A 2GG2A 3PN9A 1B6AA 5CE6A 5JHUA 4U6ZA 2GG9A 1WLRA 1YW9A 4IDYA 3IL0A 5D6FA 2BWTA 1C22A 2V3YA 5JI6A 1QXYA 3OOOA 4KM3A 2BWUA 2GG0A 2BWVA 2BWXA 1YW8A 3IU8A 4RZYA 4FLIA 5CDLA 2Q94A 1JAWA 3RVAA 4U70A 2EVCA 4IECA 4FLKA 2V3XA 1C24A 2V3ZA 1QXZA 4MATA 5CLSA 2BHCA 1QZYA 3IU7A 4U69A 4ZWUA 2BHDA 2MATA 3L24A 2IW2A 5FCFA 2B3HA 4U76A 3CB5A 4FLLA 4RZZA 1R58A 3CTZA 2BWSA 1XGOA 2GA2A 1B59A 2Q96A 2BWWA 4R60A 2GU7A 3TB5A 2OKNA 1BN5A 3MATA 4U71A 2GU6A 3S6BA 4Z7MA 2P9AA 2Q93A 3BIPA 1C27A 1PV9A 2GG5A 5E5BA 2BHAA 2GTXA 1A16A 3CB6A 5E2CA 1YW7A 2NQ6A 2V6CA 1WL6A 2ZSGA 2BH3A 1KP0A 4S2RP 1YVMA 2BB7A 4IKSA 2EVMA 2NQ7A 4U6WA 3PKCA 1WN1A 3FM3A 4IPAA 1WBQA 2GU5A 3OVKA 2Q8KA 1XGNA 3MR1A 2BN7A 3RORA 1XGMA 4ZWPA 2Q92A 2GG3A 4HXXA 4PNCA 2GG8A 3TAVA 4B28A 2B3LA 3D27A 1WL9A 3L7GA 2G6PA 4FO7A 1QXWA 5CNXA 2GZ5A 4OOKA 3Q6DA 1O0XA 1XGSA 2P99A 1MATA 3MX6A 2GG7A 2EA2A 3PKAA 2ADUA 1Y1NA 2OAZA 4FUKA 3QOCA 1C23A 4IKUA 3O5VA 1XNZA 3FMQA 4S01A 2EVOA 4U6EA 4FO8A 4A6WA 1YJ3A 3PKDA 3IG4A 3BITA 4PV4A 2DFIA 4ZNGA 2GGBA 1N51A 2GGCA 3FMRA 1CHMA 3BIQA 3PKBA 4FLJA 5FCHA 1W2MA 2BHBA 2B3KA 4U73A 4ZWOA 5CDVA 4EGEA 4S2TP 2GU4A 3PEBA 4U1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C21 A;  1R5G A;  3IU9 A;  5D6E A;  4U6J A;  4A6V A;  1KQ0 A;  4IKR A;  4RGZ 1;  4IF7 A;  4QR8 A;  1WKM A;  4JUQ A;  5JFR A;  4IU6 A;  2BWY A;  1WY2 A;  1W7V A;  5CDE A;  3PKE A;  2P98 A;  1R5H A;  2HOW A;  4FKC A;  2Q95 A;  1BOA A;  2EA4 A;  1M35 A;  5CIK A;  4U6C A;  4IKT A;  1KQ9 A;  3I7M A;  4S00 A;  4U75 A;  2GG2 A;  3PN9 A;  1B6A A;  5CE6 A;  5JHU A;  4U6Z A;  2GG9 A;  1WLR A;  1YW9 A;  4IDY A;  3IL0 A;  5D6F A;  2BWT A;  1C22 A;  2V3Y A;  5JI6 A;  1QXY A;  3OOO A;  4KM3 A;  2BWU A;  2GG0 A;  2BWV A;  2BWX A;  1YW8 A;  3IU8 A;  4RZY A;  4FLI A;  5CDL A;  2Q94 A;  1JAW A;  3RVA A;  4U70 A;  2EVC A;  4IEC A;  4FLK A;  2V3X A;  1C24 A;  2V3Z A;  1QXZ A;  4MAT A;  5CLS A;  2BHC A;  1QZY A;  3IU7 A;  4U69 A;  4ZWU A;  2BHD A;  2MAT A;  3L24 A;  2IW2 A;  5FCF A;  2B3H A;  4U76 A;  3CB5 A;  4FLL A;  4RZZ A;  1R58 A;  3CTZ A;  2BWS A;  1XGO A;  2GA2 A;  1B59 A;  2Q96 A;  2BWW A;  4R60 A;  2GU7 A;  3TB5 A;  2OKN A;  1BN5 A;  3MAT A;  4U71 A;  2GU6 A;  3S6B A;  4Z7M A;  2P9A A;  2Q93 A;  3BIP A;  1C27 A;  1PV9 A;  2GG5 A;  5E5B A;  2BHA A;  2GTX A;  1A16 A;  3CB6 A;  5E2C A;  1YW7 A;  2NQ6 A;  2V6C A;  1WL6 A;  2ZSG A;  2BH3 A;  1KP0 A;  4S2R P;  1YVM A;  2BB7 A;  4IKS A;  2EVM A;  2NQ7 A;  4U6W A;  3PKC A;  1WN1 A;  3FM3 A;  4IPA A;  1WBQ A;  2GU5 A;  3OVK A;  2Q8K A;  1XGN A;  3MR1 A;  2BN7 A;  3ROR A;  1XGM A;  4ZWP A;  2Q92 A;  2GG3 A;  4HXX A;  4PNC A;  2GG8 A;  3TAV A;  4B28 A;  2B3L A;  3D27 A;  1WL9 A;  3L7G A;  2G6P A;  4FO7 A;  1QXW A;  5CNX A;  2GZ5 A;  4OOK A;  3Q6D A;  1O0X A;  1XGS A;  2P99 A;  1MAT A;  3MX6 A;  2GG7 A;  2EA2 A;  3PKA A;  2ADU A;  1Y1N A;  2OAZ A;  4FUK A;  3QOC A;  1C23 A;  4IKU A;  3O5V A;  1XNZ A;  3FMQ A;  4S01 A;  2EVO A;  4U6E A;  4FO8 A;  4A6W A;  1YJ3 A;  3PKD A;  3IG4 A;  3BIT A;  4PV4 A;  2DFI A;  4ZNG A;  2GGB A;  1N51 A;  2GGC A;  3FMR A;  1CHM A;  3BIQ A;  3PKB A;  4FLJ A;  5FCH A;  1W2M A;  2BHB A;  2B3K A;  4U73 A;  4ZWO A;  5CDV A;  4EGE A;  4S2T P;  2GU4 A;  3PEB A;  4U1B A; 
#chains in the Genus database with same CATH topology
 1C21 A;  1R5G A;  3IU9 A;  5D6E A;  4U6J A;  4A6V A;  1KQ0 A;  4IKR A;  4RGZ 1;  4IF7 A;  4QR8 A;  1WKM A;  4JUQ A;  5JFR A;  4IU6 A;  2BWY A;  1WY2 A;  1W7V A;  5CDE A;  3PKE A;  2P98 A;  1R5H A;  2HOW A;  4FKC A;  2Q95 A;  1BOA A;  2EA4 A;  1M35 A;  5CIK A;  4U6C A;  4IKT A;  1KQ9 A;  3I7M A;  4S00 A;  4U75 A;  2GG2 A;  3PN9 A;  1B6A A;  5CE6 A;  5JHU A;  4U6Z A;  2GG9 A;  1WLR A;  1YW9 A;  4IDY A;  3IL0 A;  5D6F A;  2BWT A;  1C22 A;  2V3Y A;  5JI6 A;  1QXY A;  3OOO A;  4KM3 A;  2BWU A;  2GG0 A;  2BWV A;  2BWX A;  1YW8 A;  3IU8 A;  4RZY A;  4FLI A;  5CDL A;  2Q94 A;  1JAW A;  3RVA A;  4U70 A;  2EVC A;  4IEC A;  4FLK A;  2V3X A;  1C24 A;  2V3Z A;  1QXZ A;  4MAT A;  5CLS A;  2BHC A;  1QZY A;  3IU7 A;  4U69 A;  4ZWU A;  2BHD A;  2MAT A;  3L24 A;  2IW2 A;  5FCF A;  2B3H A;  4U76 A;  3CB5 A;  4FLL A;  4RZZ A;  1R58 A;  3CTZ A;  2BWS A;  1XGO A;  2GA2 A;  1B59 A;  2Q96 A;  2BWW A;  4R60 A;  2GU7 A;  3TB5 A;  2OKN A;  1BN5 A;  3MAT A;  4U71 A;  2GU6 A;  3S6B A;  4Z7M A;  2P9A A;  2Q93 A;  3BIP A;  1C27 A;  1PV9 A;  2GG5 A;  5E5B A;  2BHA A;  2GTX A;  1A16 A;  3CB6 A;  5E2C A;  1YW7 A;  2NQ6 A;  2V6C A;  1WL6 A;  2ZSG A;  2BH3 A;  1KP0 A;  4S2R P;  1YVM A;  2BB7 A;  4IKS A;  2EVM A;  2NQ7 A;  4U6W A;  3PKC A;  1WN1 A;  3FM3 A;  4IPA A;  1WBQ A;  2GU5 A;  3OVK A;  2Q8K A;  1XGN A;  3MR1 A;  2BN7 A;  3ROR A;  1XGM A;  4ZWP A;  2Q92 A;  2GG3 A;  4HXX A;  4PNC A;  2GG8 A;  3TAV A;  4B28 A;  2B3L A;  3D27 A;  1WL9 A;  3L7G A;  2G6P A;  4FO7 A;  1QXW A;  5CNX A;  2GZ5 A;  4OOK A;  3Q6D A;  1O0X A;  1XGS A;  2P99 A;  1MAT A;  3MX6 A;  2GG7 A;  2EA2 A;  3PKA A;  2ADU A;  1Y1N A;  2OAZ A;  4FUK A;  3QOC A;  1C23 A;  4IKU A;  3O5V A;  1XNZ A;  3FMQ A;  4S01 A;  2EVO A;  4U6E A;  4FO8 A;  4A6W A;  1YJ3 A;  3PKD A;  3IG4 A;  3BIT A;  4PV4 A;  2DFI A;  4ZNG A;  2GGB A;  1N51 A;  2GGC A;  3FMR A;  1CHM A;  3BIQ A;  3PKB A;  4FLJ A;  5FCH A;  1W2M A;  2BHB A;  2B3K A;  4U73 A;  4ZWO A;  5CDV A;  4EGE A;  4S2T P;  2GU4 A;  3PEB A;  4U1B A; 
#chains in the Genus database with same CATH homology
 1C21 A;  1R5G A;  3IU9 A;  5D6E A;  4U6J A;  4A6V A;  1KQ0 A;  4IKR A;  4RGZ 1;  4IF7 A;  4QR8 A;  1WKM A;  4JUQ A;  5JFR A;  4IU6 A;  2BWY A;  1WY2 A;  1W7V A;  5CDE A;  3PKE A;  2P98 A;  1R5H A;  2HOW A;  4FKC A;  2Q95 A;  1BOA A;  2EA4 A;  1M35 A;  5CIK A;  4U6C A;  4IKT A;  1KQ9 A;  3I7M A;  4S00 A;  4U75 A;  2GG2 A;  3PN9 A;  1B6A A;  5CE6 A;  5JHU A;  4U6Z A;  2GG9 A;  1WLR A;  1YW9 A;  4IDY A;  3IL0 A;  5D6F A;  2BWT A;  1C22 A;  2V3Y A;  5JI6 A;  1QXY A;  3OOO A;  4KM3 A;  2BWU A;  2GG0 A;  2BWV A;  2BWX A;  1YW8 A;  3IU8 A;  4RZY A;  4FLI A;  5CDL A;  2Q94 A;  1JAW A;  3RVA A;  4U70 A;  2EVC A;  4IEC A;  4FLK A;  2V3X A;  1C24 A;  2V3Z A;  1QXZ A;  4MAT A;  5CLS A;  2BHC A;  1QZY A;  3IU7 A;  4U69 A;  4ZWU A;  2BHD A;  2MAT A;  3L24 A;  2IW2 A;  5FCF A;  2B3H A;  4U76 A;  3CB5 A;  4FLL A;  4RZZ A;  1R58 A;  3CTZ A;  2BWS A;  1XGO A;  2GA2 A;  1B59 A;  2Q96 A;  2BWW A;  4R60 A;  2GU7 A;  3TB5 A;  2OKN A;  1BN5 A;  3MAT A;  4U71 A;  2GU6 A;  3S6B A;  4Z7M A;  2P9A A;  2Q93 A;  3BIP A;  1C27 A;  1PV9 A;  2GG5 A;  5E5B A;  2BHA A;  2GTX A;  1A16 A;  3CB6 A;  5E2C A;  1YW7 A;  2NQ6 A;  2V6C A;  1WL6 A;  2ZSG A;  2BH3 A;  1KP0 A;  4S2R P;  1YVM A;  2BB7 A;  4IKS A;  2EVM A;  2NQ7 A;  4U6W A;  3PKC A;  1WN1 A;  3FM3 A;  4IPA A;  1WBQ A;  2GU5 A;  3OVK A;  2Q8K A;  1XGN A;  3MR1 A;  2BN7 A;  3ROR A;  1XGM A;  4ZWP A;  2Q92 A;  2GG3 A;  4HXX A;  4PNC A;  2GG8 A;  3TAV A;  4B28 A;  2B3L A;  3D27 A;  1WL9 A;  3L7G A;  2G6P A;  4FO7 A;  1QXW A;  5CNX A;  2GZ5 A;  4OOK A;  3Q6D A;  1O0X A;  1XGS A;  2P99 A;  1MAT A;  3MX6 A;  2GG7 A;  2EA2 A;  3PKA A;  2ADU A;  1Y1N A;  2OAZ A;  4FUK A;  3QOC A;  1C23 A;  4IKU A;  3O5V A;  1XNZ A;  3FMQ A;  4S01 A;  2EVO A;  4U6E A;  4FO8 A;  4A6W A;  1YJ3 A;  3PKD A;  3IG4 A;  3BIT A;  4PV4 A;  2DFI A;  4ZNG A;  2GGB A;  1N51 A;  2GGC A;  3FMR A;  1CHM A;  3BIQ A;  3PKB A;  4FLJ A;  5FCH A;  1W2M A;  2BHB A;  2B3K A;  4U73 A;  4ZWO A;  5CDV A;  4EGE A;  4S2T P;  2GU4 A;  3PEB A;  4U1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...