2BWTA

Asp260ala escherichia coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIAAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE P
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwtA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwtA02
5FCFA 4U76A 4ZWPA 2Q92A 4KM3A 3L7GA 3BIQA 4U73A 3I7MA 2BWVA 4QR8A 2BWSA 3MX6A 2GA2A 1N51A 2B3HA 2EVCA 2Q96A 1PV9A 4U71A 4EGEA 4ZWUA 2NQ6A 2MATA 1M35A 2BWXA 3PKDA 4U75A 2BWYA 4JUQA 2Q95A 2BHCA 1A16A 1CHMA 2V3ZA 2GGCA 4U6EA 3CB5A 5JFRA 2DFIA 1WN1A 1YW7A 4RZZA 1QXZA 4IKUA 2HOWA 4S2TP 4HXXA 4IDYA 5CDLA 4IKTA 3IL0A 1R58A 5CIKA 1W2MA 2V3YA 4S00A 2BHBA 3IU7A 2V3XA 4RGZ1 2BWTA 3BITA 5JHUA 2GU6A 1YVMA 3Q6DA 1WL9A 1XGNA 2EA2A 4U69A 1XNZA 3BIPA 5CNXA 5D6EA 1C22A 1C27A 1W7VA 2GG8A 4IU6A 3RVAA 4U6WA 3S6BA 5E2CA 2GU4A 3QOCA 1WL6A 1JAWA 2NQ7A 4MATA 1B6AA 5JI6A 4A6WA 2Q8KA 4PV4A 3OOOA 2BH3A 2BWUA 2P99A 3FMQA 4IKRA 2BB7A 3FMRA 3PKEA 4IKSA 4OOKA 3PKBA 4U6CA 4U6JA 1KQ0A 2Q94A 4FUKA 3PN9A 4FLIA 4A6VA 4IECA 5CE6A 4FLKA 3IU8A 3PKCA 2BWWA 2BHAA 4Z7MA 4FLLA 1XGOA 2EA4A 4U70A 2B3KA 1C24A 1QXWA 3TB5A 1R5GA 1R5HA 1XGSA 4FLJA 2B3LA 2EVOA 4PNCA 1WBQA 2GG9A 4RZYA 3CB6A 4ZWOA 2OAZA 1QZYA 4U1BA 3PEBA 4IF7A 3RORA 2BHDA 3PKAA 5D6FA 4R60A 2GGBA 4FKCA 1YW9A 2BN7A 3FM3A 1BOAA 3L24A 2GU7A 1BN5A 1C23A 5CLSA 5CDEA 3O5VA 1KP0A 4FO8A 1XGMA 2GG2A 2V6CA 5CDVA 4U6ZA 1B59A 4S2RP 2GTXA 4IPAA 2P98A 2IW2A 2GU5A 2ZSGA 5E5BA 1WKMA 2EVMA 1C21A 4B28A 2GG7A 2GG5A 3IU9A 3CTZA 1WLRA 4ZNGA 1Y1NA 4S01A 2Q93A 1WY2A 2G6PA 2GZ5A 3D27A 3TAVA 3MATA 1O0XA 3OVKA 1YJ3A 2GG0A 1MATA 5FCHA 1QXYA 1YW8A 2ADUA 2P9AA 3IG4A 4FO7A 2GG3A 3MR1A 1KQ9A 2OKNA
chains in the Genus database with same CATH superfamily
5FCFA 4U76A 4ZWPA 2Q92A 4KM3A 3L7GA 3BIQA 4U73A 3I7MA 2BWVA 4QR8A 2BWSA 3MX6A 2GA2A 1N51A 2B3HA 2EVCA 2Q96A 1PV9A 4U71A 4EGEA 4ZWUA 2NQ6A 2MATA 1M35A 2BWXA 3PKDA 4U75A 2BWYA 4JUQA 2Q95A 2BHCA 1A16A 1CHMA 2V3ZA 2GGCA 4U6EA 3CB5A 5JFRA 2DFIA 1WN1A 1YW7A 4RZZA 1QXZA 4IKUA 2HOWA 4S2TP 4HXXA 4IDYA 5CDLA 4IKTA 3IL0A 1R58A 5CIKA 1W2MA 2V3YA 4S00A 2BHBA 3IU7A 2V3XA 4RGZ1 2BWTA 3BITA 5JHUA 2GU6A 1YVMA 3Q6DA 1WL9A 1XGNA 2EA2A 4U69A 1XNZA 3BIPA 5CNXA 5D6EA 1C22A 1C27A 1W7VA 2GG8A 4IU6A 3RVAA 4U6WA 3S6BA 5E2CA 2GU4A 3QOCA 1WL6A 1JAWA 2NQ7A 4MATA 1B6AA 5JI6A 4A6WA 2Q8KA 4PV4A 3OOOA 2BH3A 2BWUA 2P99A 3FMQA 4IKRA 2BB7A 3FMRA 3PKEA 4IKSA 4OOKA 3PKBA 4U6CA 4U6JA 1KQ0A 2Q94A 4FUKA 3PN9A 4FLIA 4A6VA 4IECA 5CE6A 4FLKA 3IU8A 3PKCA 2BWWA 2BHAA 4Z7MA 4FLLA 1XGOA 2EA4A 4U70A 2B3KA 1C24A 1QXWA 3TB5A 1R5GA 1R5HA 1XGSA 4FLJA 2B3LA 2EVOA 4PNCA 1WBQA 2GG9A 4RZYA 3CB6A 4ZWOA 2OAZA 1QZYA 4U1BA 3PEBA 4IF7A 3RORA 2BHDA 3PKAA 5D6FA 4R60A 2GGBA 4FKCA 1YW9A 2BN7A 3FM3A 1BOAA 3L24A 2GU7A 1BN5A 1C23A 5CLSA 5CDEA 3O5VA 1KP0A 4FO8A 1XGMA 2GG2A 2V6CA 5CDVA 4U6ZA 1B59A 4S2RP 2GTXA 4IPAA 2P98A 2IW2A 2GU5A 2ZSGA 5E5BA 1WKMA 2EVMA 1C21A 4B28A 2GG7A 2GG5A 3IU9A 3CTZA 1WLRA 4ZNGA 1Y1NA 4S01A 2Q93A 1WY2A 2G6PA 2GZ5A 3D27A 3TAVA 3MATA 1O0XA 3OVKA 1YJ3A 2GG0A 1MATA 5FCHA 1QXYA 1YW8A 2ADUA 2P9AA 3IG4A 4FO7A 2GG3A 3MR1A 1KQ9A 2OKNA
chains in the Genus database with same CATH topology
5FCFA 4U76A 4ZWPA 2Q92A 4KM3A 3L7GA 3BIQA 4U73A 3I7MA 2BWVA 4QR8A 2BWSA 3MX6A 2GA2A 1N51A 2B3HA 2EVCA 2Q96A 1PV9A 4U71A 4EGEA 4ZWUA 2NQ6A 2MATA 1M35A 2BWXA 3PKDA 4U75A 2BWYA 4JUQA 2Q95A 2BHCA 1A16A 1CHMA 2V3ZA 2GGCA 4U6EA 3CB5A 5JFRA 2DFIA 1WN1A 1YW7A 4RZZA 1QXZA 4IKUA 2HOWA 4S2TP 4HXXA 4IDYA 5CDLA 4IKTA 3IL0A 1R58A 5CIKA 1W2MA 2V3YA 4S00A 2BHBA 3IU7A 2V3XA 4RGZ1 2BWTA 3BITA 5JHUA 2GU6A 1YVMA 3Q6DA 1WL9A 1XGNA 2EA2A 4U69A 1XNZA 3BIPA 5CNXA 5D6EA 1C22A 1C27A 1W7VA 2GG8A 4IU6A 3RVAA 4U6WA 3S6BA 5E2CA 2GU4A 3QOCA 1WL6A 1JAWA 2NQ7A 4MATA 1B6AA 5JI6A 4A6WA 2Q8KA 4PV4A 3OOOA 2BH3A 2BWUA 2P99A 3FMQA 4IKRA 2BB7A 3FMRA 3PKEA 4IKSA 4OOKA 3PKBA 4U6CA 4U6JA 1KQ0A 2Q94A 4FUKA 3PN9A 4FLIA 4A6VA 4IECA 5CE6A 4FLKA 3IU8A 3PKCA 2BWWA 2BHAA 4Z7MA 4FLLA 1XGOA 2EA4A 4U70A 2B3KA 1C24A 1QXWA 3TB5A 1R5GA 1R5HA 1XGSA 4FLJA 2B3LA 2EVOA 4PNCA 1WBQA 2GG9A 4RZYA 3CB6A 4ZWOA 2OAZA 1QZYA 4U1BA 3PEBA 4IF7A 3RORA 2BHDA 3PKAA 5D6FA 4R60A 2GGBA 4FKCA 1YW9A 2BN7A 3FM3A 1BOAA 3L24A 2GU7A 1BN5A 1C23A 5CLSA 5CDEA 3O5VA 1KP0A 4FO8A 1XGMA 2GG2A 2V6CA 5CDVA 4U6ZA 1B59A 4S2RP 2GTXA 4IPAA 2P98A 2IW2A 2GU5A 2ZSGA 5E5BA 1WKMA 2EVMA 1C21A 4B28A 2GG7A 2GG5A 3IU9A 3CTZA 1WLRA 4ZNGA 1Y1NA 4S01A 2Q93A 1WY2A 2G6PA 2GZ5A 3D27A 3TAVA 3MATA 1O0XA 3OVKA 1YJ3A 2GG0A 1MATA 5FCHA 1QXYA 1YW8A 2ADUA 2P9AA 3IG4A 4FO7A 2GG3A 3MR1A 1KQ9A 2OKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FCF A;  4U76 A;  4ZWP A;  2Q92 A;  4KM3 A;  3L7G A;  3BIQ A;  4U73 A;  3I7M A;  2BWV A;  4QR8 A;  2BWS A;  3MX6 A;  2GA2 A;  1N51 A;  2B3H A;  2EVC A;  2Q96 A;  1PV9 A;  4U71 A;  4EGE A;  4ZWU A;  2NQ6 A;  2MAT A;  1M35 A;  2BWX A;  3PKD A;  4U75 A;  2BWY A;  4JUQ A;  2Q95 A;  2BHC A;  1A16 A;  1CHM A;  2V3Z A;  2GGC A;  4U6E A;  3CB5 A;  5JFR A;  2DFI A;  1WN1 A;  1YW7 A;  4RZZ A;  1QXZ A;  4IKU A;  2HOW A;  4S2T P;  4HXX A;  4IDY A;  5CDL A;  4IKT A;  3IL0 A;  1R58 A;  5CIK A;  1W2M A;  2V3Y A;  4S00 A;  2BHB A;  3IU7 A;  2V3X A;  4RGZ 1;  2BWT A;  3BIT A;  5JHU A;  2GU6 A;  1YVM A;  3Q6D A;  1WL9 A;  1XGN A;  2EA2 A;  4U69 A;  1XNZ A;  3BIP A;  5CNX A;  5D6E A;  1C22 A;  1C27 A;  1W7V A;  2GG8 A;  4IU6 A;  3RVA A;  4U6W A;  3S6B A;  5E2C A;  2GU4 A;  3QOC A;  1WL6 A;  1JAW A;  2NQ7 A;  4MAT A;  1B6A A;  5JI6 A;  4A6W A;  2Q8K A;  4PV4 A;  3OOO A;  2BH3 A;  2BWU A;  2P99 A;  3FMQ A;  4IKR A;  2BB7 A;  3FMR A;  3PKE A;  4IKS A;  4OOK A;  3PKB A;  4U6C A;  4U6J A;  1KQ0 A;  2Q94 A;  4FUK A;  3PN9 A;  4FLI A;  4A6V A;  4IEC A;  5CE6 A;  4FLK A;  3IU8 A;  3PKC A;  2BWW A;  2BHA A;  4Z7M A;  4FLL A;  1XGO A;  2EA4 A;  4U70 A;  2B3K A;  1C24 A;  1QXW A;  3TB5 A;  1R5G A;  1R5H A;  1XGS A;  4FLJ A;  2B3L A;  2EVO A;  4PNC A;  1WBQ A;  2GG9 A;  4RZY A;  3CB6 A;  4ZWO A;  2OAZ A;  1QZY A;  4U1B A;  3PEB A;  4IF7 A;  3ROR A;  2BHD A;  3PKA A;  5D6F A;  4R60 A;  2GGB A;  4FKC A;  1YW9 A;  2BN7 A;  3FM3 A;  1BOA A;  3L24 A;  2GU7 A;  1BN5 A;  1C23 A;  5CLS A;  5CDE A;  3O5V A;  1KP0 A;  4FO8 A;  1XGM A;  2GG2 A;  2V6C A;  5CDV A;  4U6Z A;  1B59 A;  4S2R P;  2GTX A;  4IPA A;  2P98 A;  2IW2 A;  2GU5 A;  2ZSG A;  5E5B A;  1WKM A;  2EVM A;  1C21 A;  4B28 A;  2GG7 A;  2GG5 A;  3IU9 A;  3CTZ A;  1WLR A;  4ZNG A;  1Y1N A;  4S01 A;  2Q93 A;  1WY2 A;  2G6P A;  2GZ5 A;  3D27 A;  3TAV A;  3MAT A;  1O0X A;  3OVK A;  1YJ3 A;  2GG0 A;  1MAT A;  5FCH A;  1QXY A;  1YW8 A;  2ADU A;  2P9A A;  3IG4 A;  4FO7 A;  2GG3 A;  3MR1 A;  1KQ9 A;  2OKN A; 
#chains in the Genus database with same CATH topology
 5FCF A;  4U76 A;  4ZWP A;  2Q92 A;  4KM3 A;  3L7G A;  3BIQ A;  4U73 A;  3I7M A;  2BWV A;  4QR8 A;  2BWS A;  3MX6 A;  2GA2 A;  1N51 A;  2B3H A;  2EVC A;  2Q96 A;  1PV9 A;  4U71 A;  4EGE A;  4ZWU A;  2NQ6 A;  2MAT A;  1M35 A;  2BWX A;  3PKD A;  4U75 A;  2BWY A;  4JUQ A;  2Q95 A;  2BHC A;  1A16 A;  1CHM A;  2V3Z A;  2GGC A;  4U6E A;  3CB5 A;  5JFR A;  2DFI A;  1WN1 A;  1YW7 A;  4RZZ A;  1QXZ A;  4IKU A;  2HOW A;  4S2T P;  4HXX A;  4IDY A;  5CDL A;  4IKT A;  3IL0 A;  1R58 A;  5CIK A;  1W2M A;  2V3Y A;  4S00 A;  2BHB A;  3IU7 A;  2V3X A;  4RGZ 1;  2BWT A;  3BIT A;  5JHU A;  2GU6 A;  1YVM A;  3Q6D A;  1WL9 A;  1XGN A;  2EA2 A;  4U69 A;  1XNZ A;  3BIP A;  5CNX A;  5D6E A;  1C22 A;  1C27 A;  1W7V A;  2GG8 A;  4IU6 A;  3RVA A;  4U6W A;  3S6B A;  5E2C A;  2GU4 A;  3QOC A;  1WL6 A;  1JAW A;  2NQ7 A;  4MAT A;  1B6A A;  5JI6 A;  4A6W A;  2Q8K A;  4PV4 A;  3OOO A;  2BH3 A;  2BWU A;  2P99 A;  3FMQ A;  4IKR A;  2BB7 A;  3FMR A;  3PKE A;  4IKS A;  4OOK A;  3PKB A;  4U6C A;  4U6J A;  1KQ0 A;  2Q94 A;  4FUK A;  3PN9 A;  4FLI A;  4A6V A;  4IEC A;  5CE6 A;  4FLK A;  3IU8 A;  3PKC A;  2BWW A;  2BHA A;  4Z7M A;  4FLL A;  1XGO A;  2EA4 A;  4U70 A;  2B3K A;  1C24 A;  1QXW A;  3TB5 A;  1R5G A;  1R5H A;  1XGS A;  4FLJ A;  2B3L A;  2EVO A;  4PNC A;  1WBQ A;  2GG9 A;  4RZY A;  3CB6 A;  4ZWO A;  2OAZ A;  1QZY A;  4U1B A;  3PEB A;  4IF7 A;  3ROR A;  2BHD A;  3PKA A;  5D6F A;  4R60 A;  2GGB A;  4FKC A;  1YW9 A;  2BN7 A;  3FM3 A;  1BOA A;  3L24 A;  2GU7 A;  1BN5 A;  1C23 A;  5CLS A;  5CDE A;  3O5V A;  1KP0 A;  4FO8 A;  1XGM A;  2GG2 A;  2V6C A;  5CDV A;  4U6Z A;  1B59 A;  4S2R P;  2GTX A;  4IPA A;  2P98 A;  2IW2 A;  2GU5 A;  2ZSG A;  5E5B A;  1WKM A;  2EVM A;  1C21 A;  4B28 A;  2GG7 A;  2GG5 A;  3IU9 A;  3CTZ A;  1WLR A;  4ZNG A;  1Y1N A;  4S01 A;  2Q93 A;  1WY2 A;  2G6P A;  2GZ5 A;  3D27 A;  3TAV A;  3MAT A;  1O0X A;  3OVK A;  1YJ3 A;  2GG0 A;  1MAT A;  5FCH A;  1QXY A;  1YW8 A;  2ADU A;  2P9A A;  3IG4 A;  4FO7 A;  2GG3 A;  3MR1 A;  1KQ9 A;  2OKN A; 
#chains in the Genus database with same CATH homology
 5FCF A;  4U76 A;  4ZWP A;  2Q92 A;  4KM3 A;  3L7G A;  3BIQ A;  4U73 A;  3I7M A;  2BWV A;  4QR8 A;  2BWS A;  3MX6 A;  2GA2 A;  1N51 A;  2B3H A;  2EVC A;  2Q96 A;  1PV9 A;  4U71 A;  4EGE A;  4ZWU A;  2NQ6 A;  2MAT A;  1M35 A;  2BWX A;  3PKD A;  4U75 A;  2BWY A;  4JUQ A;  2Q95 A;  2BHC A;  1A16 A;  1CHM A;  2V3Z A;  2GGC A;  4U6E A;  3CB5 A;  5JFR A;  2DFI A;  1WN1 A;  1YW7 A;  4RZZ A;  1QXZ A;  4IKU A;  2HOW A;  4S2T P;  4HXX A;  4IDY A;  5CDL A;  4IKT A;  3IL0 A;  1R58 A;  5CIK A;  1W2M A;  2V3Y A;  4S00 A;  2BHB A;  3IU7 A;  2V3X A;  4RGZ 1;  2BWT A;  3BIT A;  5JHU A;  2GU6 A;  1YVM A;  3Q6D A;  1WL9 A;  1XGN A;  2EA2 A;  4U69 A;  1XNZ A;  3BIP A;  5CNX A;  5D6E A;  1C22 A;  1C27 A;  1W7V A;  2GG8 A;  4IU6 A;  3RVA A;  4U6W A;  3S6B A;  5E2C A;  2GU4 A;  3QOC A;  1WL6 A;  1JAW A;  2NQ7 A;  4MAT A;  1B6A A;  5JI6 A;  4A6W A;  2Q8K A;  4PV4 A;  3OOO A;  2BH3 A;  2BWU A;  2P99 A;  3FMQ A;  4IKR A;  2BB7 A;  3FMR A;  3PKE A;  4IKS A;  4OOK A;  3PKB A;  4U6C A;  4U6J A;  1KQ0 A;  2Q94 A;  4FUK A;  3PN9 A;  4FLI A;  4A6V A;  4IEC A;  5CE6 A;  4FLK A;  3IU8 A;  3PKC A;  2BWW A;  2BHA A;  4Z7M A;  4FLL A;  1XGO A;  2EA4 A;  4U70 A;  2B3K A;  1C24 A;  1QXW A;  3TB5 A;  1R5G A;  1R5H A;  1XGS A;  4FLJ A;  2B3L A;  2EVO A;  4PNC A;  1WBQ A;  2GG9 A;  4RZY A;  3CB6 A;  4ZWO A;  2OAZ A;  1QZY A;  4U1B A;  3PEB A;  4IF7 A;  3ROR A;  2BHD A;  3PKA A;  5D6F A;  4R60 A;  2GGB A;  4FKC A;  1YW9 A;  2BN7 A;  3FM3 A;  1BOA A;  3L24 A;  2GU7 A;  1BN5 A;  1C23 A;  5CLS A;  5CDE A;  3O5V A;  1KP0 A;  4FO8 A;  1XGM A;  2GG2 A;  2V6C A;  5CDV A;  4U6Z A;  1B59 A;  4S2R P;  2GTX A;  4IPA A;  2P98 A;  2IW2 A;  2GU5 A;  2ZSG A;  5E5B A;  1WKM A;  2EVM A;  1C21 A;  4B28 A;  2GG7 A;  2GG5 A;  3IU9 A;  3CTZ A;  1WLR A;  4ZNG A;  1Y1N A;  4S01 A;  2Q93 A;  1WY2 A;  2G6P A;  2GZ5 A;  3D27 A;  3TAV A;  3MAT A;  1O0X A;  3OVK A;  1YJ3 A;  2GG0 A;  1MAT A;  5FCH A;  1QXY A;  1YW8 A;  2ADU A;  2P9A A;  3IG4 A;  4FO7 A;  2GG3 A;  3MR1 A;  1KQ9 A;  2OKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...