2BWTA

Asp260ala escherichia coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIAAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwtA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwtA02
2GG2A 2BHDA 4RGZ1 2Q8KA 3O5VA 2BWSA 2EA2A 4IU6A 4A6VA 3PKAA 3CB6A 3OVKA 2P9AA 5CLSA 2ADUA 2GG9A 4U75A 2GGCA 4S2RP 3FMQA 2GG3A 2GG0A 2P99A 3IG4A 2EVMA 1WBQA 2NQ7A 3I7MA 1R58A 2IW2A 4B28A 1B59A 2BHBA 5CDVA 2GG5A 1C24A 1KQ0A 5CDLA 2EVCA 4JUQA 3PKCA 1C22A 1WY2A 3QOCA 1YW9A 4IKSA 4IKRA 3TAVA 4PNCA 4U70A 3PKBA 1YW7A 1C21A 3MX6A 2BWTA 4S00A 3PKEA 1KP0A 1R5HA 1MATA 2BN7A 1YJ3A 3TB5A 4Z7MA 4FLIA 4A6WA 4RZYA 5CIKA 4S01A 3PN9A 2OAZA 5E2CA 2MATA 1CHMA 2Q95A 4ZWPA 1Y1NA 4IKTA 3IU9A 2GA2A 2G6PA 4ZWOA 1XGMA 2Q96A 4ZWUA 2HOWA 4R60A 4U6ZA 1YVMA 5D6EA 4HXXA 3IU7A 4FKCA 1BN5A 3IU8A 1WLRA 1WL9A 2BWVA 5JI6A 4U6WA 3BIQA 3CTZA 2V6CA 2B3HA 1A16A 2ZSGA 5CE6A 2Q93A 3FM3A 3FMRA 4FUKA 4IECA 4IDYA 4IKUA 4U6CA 4U76A 4FO8A 3S6BA 4FLKA 3CB5A 3MR1A 1XGNA 3BITA 2Q94A 5JHUA 2GTXA 4U1BA 1JAWA 1C27A 2V3XA 2EA4A 1PV9A 3L7GA 1C23A 2BHCA 2GGBA 1XGOA 1W7VA 2GU7A 2P98A 2V3YA 4S2TP 4MATA 2Q92A 3D27A 3BIPA 5JFRA 3L24A 1B6AA 3PEBA 5E5BA 1QXZA 2GG8A 4QR8A 2BWWA 5CDEA 1W2MA 2BWYA 4IPAA 4RZZA 1M35A 3RVAA 4PV4A 1O0XA 1WN1A 3RORA 2BH3A 2B3LA 2GZ5A 4IF7A 1QXYA 4U73A 1XGSA 3PKDA 2BWXA 2B3KA 1N51A 5FCFA 3MATA 1WL6A 4ZNGA 4U71A 5D6FA 4FLLA 1QZYA 4FO7A 2V3ZA 4U6EA 1QXWA 4U69A 1BOAA 4OOKA 2EVOA 2BHAA 2DFIA 1XNZA 3Q6DA 4EGEA 5FCHA 3IL0A 1WKMA 1KQ9A 3OOOA 1YW8A 2BWUA 2GU6A 5CNXA 4KM3A 2OKNA 2BB7A 2NQ6A 1R5GA 2GG7A 4U6JA 4FLJA 2GU4A 2GU5A
chains in the Genus database with same CATH superfamily
2GG2A 2BHDA 4RGZ1 2Q8KA 3O5VA 2BWSA 2EA2A 4IU6A 4A6VA 3PKAA 3CB6A 3OVKA 2P9AA 5CLSA 2ADUA 2GG9A 4U75A 2GGCA 4S2RP 3FMQA 2GG3A 2GG0A 2P99A 3IG4A 2EVMA 1WBQA 2NQ7A 3I7MA 1R58A 2IW2A 4B28A 1B59A 2BHBA 5CDVA 2GG5A 1C24A 1KQ0A 5CDLA 2EVCA 4JUQA 3PKCA 1C22A 1WY2A 3QOCA 1YW9A 4IKSA 4IKRA 3TAVA 4PNCA 4U70A 3PKBA 1YW7A 1C21A 3MX6A 2BWTA 4S00A 3PKEA 1KP0A 1R5HA 1MATA 2BN7A 1YJ3A 3TB5A 4Z7MA 4FLIA 4A6WA 4RZYA 5CIKA 4S01A 3PN9A 2OAZA 5E2CA 2MATA 1CHMA 2Q95A 4ZWPA 1Y1NA 4IKTA 3IU9A 2GA2A 2G6PA 4ZWOA 1XGMA 2Q96A 4ZWUA 2HOWA 4R60A 4U6ZA 1YVMA 5D6EA 4HXXA 3IU7A 4FKCA 1BN5A 3IU8A 1WLRA 1WL9A 2BWVA 5JI6A 4U6WA 3BIQA 3CTZA 2V6CA 2B3HA 1A16A 2ZSGA 5CE6A 2Q93A 3FM3A 3FMRA 4FUKA 4IECA 4IDYA 4IKUA 4U6CA 4U76A 4FO8A 3S6BA 4FLKA 3CB5A 3MR1A 1XGNA 3BITA 2Q94A 5JHUA 2GTXA 4U1BA 1JAWA 1C27A 2V3XA 2EA4A 1PV9A 3L7GA 1C23A 2BHCA 2GGBA 1XGOA 1W7VA 2GU7A 2P98A 2V3YA 4S2TP 4MATA 2Q92A 3D27A 3BIPA 5JFRA 3L24A 1B6AA 3PEBA 5E5BA 1QXZA 2GG8A 4QR8A 2BWWA 5CDEA 1W2MA 2BWYA 4IPAA 4RZZA 1M35A 3RVAA 4PV4A 1O0XA 1WN1A 3RORA 2BH3A 2B3LA 2GZ5A 4IF7A 1QXYA 4U73A 1XGSA 3PKDA 2BWXA 2B3KA 1N51A 5FCFA 3MATA 1WL6A 4ZNGA 4U71A 5D6FA 4FLLA 1QZYA 4FO7A 2V3ZA 4U6EA 1QXWA 4U69A 1BOAA 4OOKA 2EVOA 2BHAA 2DFIA 1XNZA 3Q6DA 4EGEA 5FCHA 3IL0A 1WKMA 1KQ9A 3OOOA 1YW8A 2BWUA 2GU6A 5CNXA 4KM3A 2OKNA 2BB7A 2NQ6A 1R5GA 2GG7A 4U6JA 4FLJA 2GU4A 2GU5A
chains in the Genus database with same CATH topology
2GG2A 2BHDA 4RGZ1 2Q8KA 3O5VA 2BWSA 2EA2A 4IU6A 4A6VA 3PKAA 3CB6A 3OVKA 2P9AA 5CLSA 2ADUA 2GG9A 4U75A 2GGCA 4S2RP 3FMQA 2GG3A 2GG0A 2P99A 3IG4A 2EVMA 1WBQA 2NQ7A 3I7MA 1R58A 2IW2A 4B28A 1B59A 2BHBA 5CDVA 2GG5A 1C24A 1KQ0A 5CDLA 2EVCA 4JUQA 3PKCA 1C22A 1WY2A 3QOCA 1YW9A 4IKSA 4IKRA 3TAVA 4PNCA 4U70A 3PKBA 1YW7A 1C21A 3MX6A 2BWTA 4S00A 3PKEA 1KP0A 1R5HA 1MATA 2BN7A 1YJ3A 3TB5A 4Z7MA 4FLIA 4A6WA 4RZYA 5CIKA 4S01A 3PN9A 2OAZA 5E2CA 2MATA 1CHMA 2Q95A 4ZWPA 1Y1NA 4IKTA 3IU9A 2GA2A 2G6PA 4ZWOA 1XGMA 2Q96A 4ZWUA 2HOWA 4R60A 4U6ZA 1YVMA 5D6EA 4HXXA 3IU7A 4FKCA 1BN5A 3IU8A 1WLRA 1WL9A 2BWVA 5JI6A 4U6WA 3BIQA 3CTZA 2V6CA 2B3HA 1A16A 2ZSGA 5CE6A 2Q93A 3FM3A 3FMRA 4FUKA 4IECA 4IDYA 4IKUA 4U6CA 4U76A 4FO8A 3S6BA 4FLKA 3CB5A 3MR1A 1XGNA 3BITA 2Q94A 5JHUA 2GTXA 4U1BA 1JAWA 1C27A 2V3XA 2EA4A 1PV9A 3L7GA 1C23A 2BHCA 2GGBA 1XGOA 1W7VA 2GU7A 2P98A 2V3YA 4S2TP 4MATA 2Q92A 3D27A 3BIPA 5JFRA 3L24A 1B6AA 3PEBA 5E5BA 1QXZA 2GG8A 4QR8A 2BWWA 5CDEA 1W2MA 2BWYA 4IPAA 4RZZA 1M35A 3RVAA 4PV4A 1O0XA 1WN1A 3RORA 2BH3A 2B3LA 2GZ5A 4IF7A 1QXYA 4U73A 1XGSA 3PKDA 2BWXA 2B3KA 1N51A 5FCFA 3MATA 1WL6A 4ZNGA 4U71A 5D6FA 4FLLA 1QZYA 4FO7A 2V3ZA 4U6EA 1QXWA 4U69A 1BOAA 4OOKA 2EVOA 2BHAA 2DFIA 1XNZA 3Q6DA 4EGEA 5FCHA 3IL0A 1WKMA 1KQ9A 3OOOA 1YW8A 2BWUA 2GU6A 5CNXA 4KM3A 2OKNA 2BB7A 2NQ6A 1R5GA 2GG7A 4U6JA 4FLJA 2GU4A 2GU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG2 A;  2BHD A;  4RGZ 1;  2Q8K A;  3O5V A;  2BWS A;  2EA2 A;  4IU6 A;  4A6V A;  3PKA A;  3CB6 A;  3OVK A;  2P9A A;  5CLS A;  2ADU A;  2GG9 A;  4U75 A;  2GGC A;  4S2R P;  3FMQ A;  2GG3 A;  2GG0 A;  2P99 A;  3IG4 A;  2EVM A;  1WBQ A;  2NQ7 A;  3I7M A;  1R58 A;  2IW2 A;  4B28 A;  1B59 A;  2BHB A;  5CDV A;  2GG5 A;  1C24 A;  1KQ0 A;  5CDL A;  2EVC A;  4JUQ A;  3PKC A;  1C22 A;  1WY2 A;  3QOC A;  1YW9 A;  4IKS A;  4IKR A;  3TAV A;  4PNC A;  4U70 A;  3PKB A;  1YW7 A;  1C21 A;  3MX6 A;  2BWT A;  4S00 A;  3PKE A;  1KP0 A;  1R5H A;  1MAT A;  2BN7 A;  1YJ3 A;  3TB5 A;  4Z7M A;  4FLI A;  4A6W A;  4RZY A;  5CIK A;  4S01 A;  3PN9 A;  2OAZ A;  5E2C A;  2MAT A;  1CHM A;  2Q95 A;  4ZWP A;  1Y1N A;  4IKT A;  3IU9 A;  2GA2 A;  2G6P A;  4ZWO A;  1XGM A;  2Q96 A;  4ZWU A;  2HOW A;  4R60 A;  4U6Z A;  1YVM A;  5D6E A;  4HXX A;  3IU7 A;  4FKC A;  1BN5 A;  3IU8 A;  1WLR A;  1WL9 A;  2BWV A;  5JI6 A;  4U6W A;  3BIQ A;  3CTZ A;  2V6C A;  2B3H A;  1A16 A;  2ZSG A;  5CE6 A;  2Q93 A;  3FM3 A;  3FMR A;  4FUK A;  4IEC A;  4IDY A;  4IKU A;  4U6C A;  4U76 A;  4FO8 A;  3S6B A;  4FLK A;  3CB5 A;  3MR1 A;  1XGN A;  3BIT A;  2Q94 A;  5JHU A;  2GTX A;  4U1B A;  1JAW A;  1C27 A;  2V3X A;  2EA4 A;  1PV9 A;  3L7G A;  1C23 A;  2BHC A;  2GGB A;  1XGO A;  1W7V A;  2GU7 A;  2P98 A;  2V3Y A;  4S2T P;  4MAT A;  2Q92 A;  3D27 A;  3BIP A;  5JFR A;  3L24 A;  1B6A A;  3PEB A;  5E5B A;  1QXZ A;  2GG8 A;  4QR8 A;  2BWW A;  5CDE A;  1W2M A;  2BWY A;  4IPA A;  4RZZ A;  1M35 A;  3RVA A;  4PV4 A;  1O0X A;  1WN1 A;  3ROR A;  2BH3 A;  2B3L A;  2GZ5 A;  4IF7 A;  1QXY A;  4U73 A;  1XGS A;  3PKD A;  2BWX A;  2B3K A;  1N51 A;  5FCF A;  3MAT A;  1WL6 A;  4ZNG A;  4U71 A;  5D6F A;  4FLL A;  1QZY A;  4FO7 A;  2V3Z A;  4U6E A;  1QXW A;  4U69 A;  1BOA A;  4OOK A;  2EVO A;  2BHA A;  2DFI A;  1XNZ A;  3Q6D A;  4EGE A;  5FCH A;  3IL0 A;  1WKM A;  1KQ9 A;  3OOO A;  1YW8 A;  2BWU A;  2GU6 A;  5CNX A;  4KM3 A;  2OKN A;  2BB7 A;  2NQ6 A;  1R5G A;  2GG7 A;  4U6J A;  4FLJ A;  2GU4 A;  2GU5 A; 
#chains in the Genus database with same CATH topology
 2GG2 A;  2BHD A;  4RGZ 1;  2Q8K A;  3O5V A;  2BWS A;  2EA2 A;  4IU6 A;  4A6V A;  3PKA A;  3CB6 A;  3OVK A;  2P9A A;  5CLS A;  2ADU A;  2GG9 A;  4U75 A;  2GGC A;  4S2R P;  3FMQ A;  2GG3 A;  2GG0 A;  2P99 A;  3IG4 A;  2EVM A;  1WBQ A;  2NQ7 A;  3I7M A;  1R58 A;  2IW2 A;  4B28 A;  1B59 A;  2BHB A;  5CDV A;  2GG5 A;  1C24 A;  1KQ0 A;  5CDL A;  2EVC A;  4JUQ A;  3PKC A;  1C22 A;  1WY2 A;  3QOC A;  1YW9 A;  4IKS A;  4IKR A;  3TAV A;  4PNC A;  4U70 A;  3PKB A;  1YW7 A;  1C21 A;  3MX6 A;  2BWT A;  4S00 A;  3PKE A;  1KP0 A;  1R5H A;  1MAT A;  2BN7 A;  1YJ3 A;  3TB5 A;  4Z7M A;  4FLI A;  4A6W A;  4RZY A;  5CIK A;  4S01 A;  3PN9 A;  2OAZ A;  5E2C A;  2MAT A;  1CHM A;  2Q95 A;  4ZWP A;  1Y1N A;  4IKT A;  3IU9 A;  2GA2 A;  2G6P A;  4ZWO A;  1XGM A;  2Q96 A;  4ZWU A;  2HOW A;  4R60 A;  4U6Z A;  1YVM A;  5D6E A;  4HXX A;  3IU7 A;  4FKC A;  1BN5 A;  3IU8 A;  1WLR A;  1WL9 A;  2BWV A;  5JI6 A;  4U6W A;  3BIQ A;  3CTZ A;  2V6C A;  2B3H A;  1A16 A;  2ZSG A;  5CE6 A;  2Q93 A;  3FM3 A;  3FMR A;  4FUK A;  4IEC A;  4IDY A;  4IKU A;  4U6C A;  4U76 A;  4FO8 A;  3S6B A;  4FLK A;  3CB5 A;  3MR1 A;  1XGN A;  3BIT A;  2Q94 A;  5JHU A;  2GTX A;  4U1B A;  1JAW A;  1C27 A;  2V3X A;  2EA4 A;  1PV9 A;  3L7G A;  1C23 A;  2BHC A;  2GGB A;  1XGO A;  1W7V A;  2GU7 A;  2P98 A;  2V3Y A;  4S2T P;  4MAT A;  2Q92 A;  3D27 A;  3BIP A;  5JFR A;  3L24 A;  1B6A A;  3PEB A;  5E5B A;  1QXZ A;  2GG8 A;  4QR8 A;  2BWW A;  5CDE A;  1W2M A;  2BWY A;  4IPA A;  4RZZ A;  1M35 A;  3RVA A;  4PV4 A;  1O0X A;  1WN1 A;  3ROR A;  2BH3 A;  2B3L A;  2GZ5 A;  4IF7 A;  1QXY A;  4U73 A;  1XGS A;  3PKD A;  2BWX A;  2B3K A;  1N51 A;  5FCF A;  3MAT A;  1WL6 A;  4ZNG A;  4U71 A;  5D6F A;  4FLL A;  1QZY A;  4FO7 A;  2V3Z A;  4U6E A;  1QXW A;  4U69 A;  1BOA A;  4OOK A;  2EVO A;  2BHA A;  2DFI A;  1XNZ A;  3Q6D A;  4EGE A;  5FCH A;  3IL0 A;  1WKM A;  1KQ9 A;  3OOO A;  1YW8 A;  2BWU A;  2GU6 A;  5CNX A;  4KM3 A;  2OKN A;  2BB7 A;  2NQ6 A;  1R5G A;  2GG7 A;  4U6J A;  4FLJ A;  2GU4 A;  2GU5 A; 
#chains in the Genus database with same CATH homology
 2GG2 A;  2BHD A;  4RGZ 1;  2Q8K A;  3O5V A;  2BWS A;  2EA2 A;  4IU6 A;  4A6V A;  3PKA A;  3CB6 A;  3OVK A;  2P9A A;  5CLS A;  2ADU A;  2GG9 A;  4U75 A;  2GGC A;  4S2R P;  3FMQ A;  2GG3 A;  2GG0 A;  2P99 A;  3IG4 A;  2EVM A;  1WBQ A;  2NQ7 A;  3I7M A;  1R58 A;  2IW2 A;  4B28 A;  1B59 A;  2BHB A;  5CDV A;  2GG5 A;  1C24 A;  1KQ0 A;  5CDL A;  2EVC A;  4JUQ A;  3PKC A;  1C22 A;  1WY2 A;  3QOC A;  1YW9 A;  4IKS A;  4IKR A;  3TAV A;  4PNC A;  4U70 A;  3PKB A;  1YW7 A;  1C21 A;  3MX6 A;  2BWT A;  4S00 A;  3PKE A;  1KP0 A;  1R5H A;  1MAT A;  2BN7 A;  1YJ3 A;  3TB5 A;  4Z7M A;  4FLI A;  4A6W A;  4RZY A;  5CIK A;  4S01 A;  3PN9 A;  2OAZ A;  5E2C A;  2MAT A;  1CHM A;  2Q95 A;  4ZWP A;  1Y1N A;  4IKT A;  3IU9 A;  2GA2 A;  2G6P A;  4ZWO A;  1XGM A;  2Q96 A;  4ZWU A;  2HOW A;  4R60 A;  4U6Z A;  1YVM A;  5D6E A;  4HXX A;  3IU7 A;  4FKC A;  1BN5 A;  3IU8 A;  1WLR A;  1WL9 A;  2BWV A;  5JI6 A;  4U6W A;  3BIQ A;  3CTZ A;  2V6C A;  2B3H A;  1A16 A;  2ZSG A;  5CE6 A;  2Q93 A;  3FM3 A;  3FMR A;  4FUK A;  4IEC A;  4IDY A;  4IKU A;  4U6C A;  4U76 A;  4FO8 A;  3S6B A;  4FLK A;  3CB5 A;  3MR1 A;  1XGN A;  3BIT A;  2Q94 A;  5JHU A;  2GTX A;  4U1B A;  1JAW A;  1C27 A;  2V3X A;  2EA4 A;  1PV9 A;  3L7G A;  1C23 A;  2BHC A;  2GGB A;  1XGO A;  1W7V A;  2GU7 A;  2P98 A;  2V3Y A;  4S2T P;  4MAT A;  2Q92 A;  3D27 A;  3BIP A;  5JFR A;  3L24 A;  1B6A A;  3PEB A;  5E5B A;  1QXZ A;  2GG8 A;  4QR8 A;  2BWW A;  5CDE A;  1W2M A;  2BWY A;  4IPA A;  4RZZ A;  1M35 A;  3RVA A;  4PV4 A;  1O0X A;  1WN1 A;  3ROR A;  2BH3 A;  2B3L A;  2GZ5 A;  4IF7 A;  1QXY A;  4U73 A;  1XGS A;  3PKD A;  2BWX A;  2B3K A;  1N51 A;  5FCF A;  3MAT A;  1WL6 A;  4ZNG A;  4U71 A;  5D6F A;  4FLL A;  1QZY A;  4FO7 A;  2V3Z A;  4U6E A;  1QXW A;  4U69 A;  1BOA A;  4OOK A;  2EVO A;  2BHA A;  2DFI A;  1XNZ A;  3Q6D A;  4EGE A;  5FCH A;  3IL0 A;  1WKM A;  1KQ9 A;  3OOO A;  1YW8 A;  2BWU A;  2GU6 A;  5CNX A;  4KM3 A;  2OKN A;  2BB7 A;  2NQ6 A;  1R5G A;  2GG7 A;  4U6J A;  4FLJ A;  2GU4 A;  2GU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...