2BWTA

Asp260ala escherichia coli aminopeptidase p
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIAAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 156
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwtA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwtA02
4FLIA 2Q8KA 1WBQA 4QR8A 5JI6A 2BWVA 1YW7A 4U73A 1Y1NA 5FCHA 1A16A 3CB6A 1BN5A 3OOOA 2B3HA 4EGEA 1C21A 4A6WA 1QZYA 4IKTA 3TB5A 3BIQA 4S01A 4MATA 2V3ZA 2Q93A 2IW2A 3PKAA 3CTZA 5FCFA 2EA2A 1C22A 2BWUA 3CB5A 3PEBA 4R60A 2DFIA 2BH3A 3IU8A 5CDLA 3IG4A 2GU5A 4IU6A 2BB7A 2G6PA 2GGBA 4U1BA 3TAVA 4ZNGA 4RZZA 5CDVA 2ZSGA 4U6CA 2NQ6A 1XGNA 1CHMA 4IKUA 3RVAA 2EVMA 4U69A 4U6JA 1KQ9A 1XGMA 4IKRA 3BIPA 1C23A 3I7MA 4ZWUA 3O5VA 4RGZ1 4S00A 5CNXA 1YW8A 4FLJA 5E5BA 2NQ7A 1WL9A 2GG3A 2V6CA 4U71A 4Z7MA 2BN7A 5CE6A 3IU9A 3PKCA 4PNCA 2OAZA 1WL6A 1XNZA 1JAWA 3MX6A 1YJ3A 2B3KA 1QXYA 2OKNA 3MATA 3PKBA 3L7GA 4U6EA 4ZWOA 3PKEA 2BWSA 4RZYA 4KM3A 2GG0A 1M35A 3L24A 1WLRA 1QXZA 1R5GA 1W7VA 3PN9A 5CIKA 1YVMA 2GG5A 2GU7A 3RORA 4A6VA 2BWTA 4U76A 1B6AA 3FMQA 1YW9A 1R5HA 4S2TP 4ZWPA 2EVOA 1C27A 2Q96A 3FMRA 3IL0A 2P99A 1XGSA 5CLSA 2GU6A 2BWYA 2GZ5A 1KQ0A 2BWXA 3IU7A 3Q6DA 4JUQA 3D27A 2P9AA 2B3LA 2BHAA 2GG9A 1B59A 2MATA 2Q92A 2GG8A 5CDEA 5D6EA 2V3YA 4FLLA 4U70A 3QOCA 2P98A 3OVKA 2BHBA 2GG2A 5D6FA 2ADUA 2BHDA 2Q94A 4IDYA 2GTXA 4IKSA 2V3XA 4FUKA 4U75A 2BWWA 1R58A 2GA2A 1QXWA 4IECA 5JFRA 4FO8A 1XGOA 1BOAA 1PV9A 2GG7A 1KP0A 4U6WA 4IPAA 3FM3A 2GGCA 2BHCA 4B28A 1W2MA 1N51A 4HXXA 4U6ZA 1MATA 3BITA 4FLKA 5JHUA 2Q95A 4IF7A 4S2RP 2GU4A 3PKDA 1O0XA 3MR1A 4OOKA 4FKCA 2HOWA 1C24A 4PV4A 2EVCA 3S6BA 1WKMA 2EA4A 1WY2A 4FO7A 1WN1A 5E2CA
chains in the Genus database with same CATH superfamily
4FLIA 2Q8KA 1WBQA 4QR8A 5JI6A 2BWVA 1YW7A 4U73A 1Y1NA 5FCHA 1A16A 3CB6A 1BN5A 3OOOA 2B3HA 4EGEA 1C21A 4A6WA 1QZYA 4IKTA 3TB5A 3BIQA 4S01A 4MATA 2V3ZA 2Q93A 2IW2A 3PKAA 3CTZA 5FCFA 2EA2A 1C22A 2BWUA 3CB5A 3PEBA 4R60A 2DFIA 2BH3A 3IU8A 5CDLA 3IG4A 2GU5A 4IU6A 2BB7A 2G6PA 2GGBA 4U1BA 3TAVA 4ZNGA 4RZZA 5CDVA 2ZSGA 4U6CA 2NQ6A 1XGNA 1CHMA 4IKUA 3RVAA 2EVMA 4U69A 4U6JA 1KQ9A 1XGMA 4IKRA 3BIPA 1C23A 3I7MA 4ZWUA 3O5VA 4RGZ1 4S00A 5CNXA 1YW8A 4FLJA 5E5BA 2NQ7A 1WL9A 2GG3A 2V6CA 4U71A 4Z7MA 2BN7A 5CE6A 3IU9A 3PKCA 4PNCA 2OAZA 1WL6A 1XNZA 1JAWA 3MX6A 1YJ3A 2B3KA 1QXYA 2OKNA 3MATA 3PKBA 3L7GA 4U6EA 4ZWOA 3PKEA 2BWSA 4RZYA 4KM3A 2GG0A 1M35A 3L24A 1WLRA 1QXZA 1R5GA 1W7VA 3PN9A 5CIKA 1YVMA 2GG5A 2GU7A 3RORA 4A6VA 2BWTA 4U76A 1B6AA 3FMQA 1YW9A 1R5HA 4S2TP 4ZWPA 2EVOA 1C27A 2Q96A 3FMRA 3IL0A 2P99A 1XGSA 5CLSA 2GU6A 2BWYA 2GZ5A 1KQ0A 2BWXA 3IU7A 3Q6DA 4JUQA 3D27A 2P9AA 2B3LA 2BHAA 2GG9A 1B59A 2MATA 2Q92A 2GG8A 5CDEA 5D6EA 2V3YA 4FLLA 4U70A 3QOCA 2P98A 3OVKA 2BHBA 2GG2A 5D6FA 2ADUA 2BHDA 2Q94A 4IDYA 2GTXA 4IKSA 2V3XA 4FUKA 4U75A 2BWWA 1R58A 2GA2A 1QXWA 4IECA 5JFRA 4FO8A 1XGOA 1BOAA 1PV9A 2GG7A 1KP0A 4U6WA 4IPAA 3FM3A 2GGCA 2BHCA 4B28A 1W2MA 1N51A 4HXXA 4U6ZA 1MATA 3BITA 4FLKA 5JHUA 2Q95A 4IF7A 4S2RP 2GU4A 3PKDA 1O0XA 3MR1A 4OOKA 4FKCA 2HOWA 1C24A 4PV4A 2EVCA 3S6BA 1WKMA 2EA4A 1WY2A 4FO7A 1WN1A 5E2CA
chains in the Genus database with same CATH topology
4FLIA 2Q8KA 1WBQA 4QR8A 5JI6A 2BWVA 1YW7A 4U73A 1Y1NA 5FCHA 1A16A 3CB6A 1BN5A 3OOOA 2B3HA 4EGEA 1C21A 4A6WA 1QZYA 4IKTA 3TB5A 3BIQA 4S01A 4MATA 2V3ZA 2Q93A 2IW2A 3PKAA 3CTZA 5FCFA 2EA2A 1C22A 2BWUA 3CB5A 3PEBA 4R60A 2DFIA 2BH3A 3IU8A 5CDLA 3IG4A 2GU5A 4IU6A 2BB7A 2G6PA 2GGBA 4U1BA 3TAVA 4ZNGA 4RZZA 5CDVA 2ZSGA 4U6CA 2NQ6A 1XGNA 1CHMA 4IKUA 3RVAA 2EVMA 4U69A 4U6JA 1KQ9A 1XGMA 4IKRA 3BIPA 1C23A 3I7MA 4ZWUA 3O5VA 4RGZ1 4S00A 5CNXA 1YW8A 4FLJA 5E5BA 2NQ7A 1WL9A 2GG3A 2V6CA 4U71A 4Z7MA 2BN7A 5CE6A 3IU9A 3PKCA 4PNCA 2OAZA 1WL6A 1XNZA 1JAWA 3MX6A 1YJ3A 2B3KA 1QXYA 2OKNA 3MATA 3PKBA 3L7GA 4U6EA 4ZWOA 3PKEA 2BWSA 4RZYA 4KM3A 2GG0A 1M35A 3L24A 1WLRA 1QXZA 1R5GA 1W7VA 3PN9A 5CIKA 1YVMA 2GG5A 2GU7A 3RORA 4A6VA 2BWTA 4U76A 1B6AA 3FMQA 1YW9A 1R5HA 4S2TP 4ZWPA 2EVOA 1C27A 2Q96A 3FMRA 3IL0A 2P99A 1XGSA 5CLSA 2GU6A 2BWYA 2GZ5A 1KQ0A 2BWXA 3IU7A 3Q6DA 4JUQA 3D27A 2P9AA 2B3LA 2BHAA 2GG9A 1B59A 2MATA 2Q92A 2GG8A 5CDEA 5D6EA 2V3YA 4FLLA 4U70A 3QOCA 2P98A 3OVKA 2BHBA 2GG2A 5D6FA 2ADUA 2BHDA 2Q94A 4IDYA 2GTXA 4IKSA 2V3XA 4FUKA 4U75A 2BWWA 1R58A 2GA2A 1QXWA 4IECA 5JFRA 4FO8A 1XGOA 1BOAA 1PV9A 2GG7A 1KP0A 4U6WA 4IPAA 3FM3A 2GGCA 2BHCA 4B28A 1W2MA 1N51A 4HXXA 4U6ZA 1MATA 3BITA 4FLKA 5JHUA 2Q95A 4IF7A 4S2RP 2GU4A 3PKDA 1O0XA 3MR1A 4OOKA 4FKCA 2HOWA 1C24A 4PV4A 2EVCA 3S6BA 1WKMA 2EA4A 1WY2A 4FO7A 1WN1A 5E2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLI A;  2Q8K A;  1WBQ A;  4QR8 A;  5JI6 A;  2BWV A;  1YW7 A;  4U73 A;  1Y1N A;  5FCH A;  1A16 A;  3CB6 A;  1BN5 A;  3OOO A;  2B3H A;  4EGE A;  1C21 A;  4A6W A;  1QZY A;  4IKT A;  3TB5 A;  3BIQ A;  4S01 A;  4MAT A;  2V3Z A;  2Q93 A;  2IW2 A;  3PKA A;  3CTZ A;  5FCF A;  2EA2 A;  1C22 A;  2BWU A;  3CB5 A;  3PEB A;  4R60 A;  2DFI A;  2BH3 A;  3IU8 A;  5CDL A;  3IG4 A;  2GU5 A;  4IU6 A;  2BB7 A;  2G6P A;  2GGB A;  4U1B A;  3TAV A;  4ZNG A;  4RZZ A;  5CDV A;  2ZSG A;  4U6C A;  2NQ6 A;  1XGN A;  1CHM A;  4IKU A;  3RVA A;  2EVM A;  4U69 A;  4U6J A;  1KQ9 A;  1XGM A;  4IKR A;  3BIP A;  1C23 A;  3I7M A;  4ZWU A;  3O5V A;  4RGZ 1;  4S00 A;  5CNX A;  1YW8 A;  4FLJ A;  5E5B A;  2NQ7 A;  1WL9 A;  2GG3 A;  2V6C A;  4U71 A;  4Z7M A;  2BN7 A;  5CE6 A;  3IU9 A;  3PKC A;  4PNC A;  2OAZ A;  1WL6 A;  1XNZ A;  1JAW A;  3MX6 A;  1YJ3 A;  2B3K A;  1QXY A;  2OKN A;  3MAT A;  3PKB A;  3L7G A;  4U6E A;  4ZWO A;  3PKE A;  2BWS A;  4RZY A;  4KM3 A;  2GG0 A;  1M35 A;  3L24 A;  1WLR A;  1QXZ A;  1R5G A;  1W7V A;  3PN9 A;  5CIK A;  1YVM A;  2GG5 A;  2GU7 A;  3ROR A;  4A6V A;  2BWT A;  4U76 A;  1B6A A;  3FMQ A;  1YW9 A;  1R5H A;  4S2T P;  4ZWP A;  2EVO A;  1C27 A;  2Q96 A;  3FMR A;  3IL0 A;  2P99 A;  1XGS A;  5CLS A;  2GU6 A;  2BWY A;  2GZ5 A;  1KQ0 A;  2BWX A;  3IU7 A;  3Q6D A;  4JUQ A;  3D27 A;  2P9A A;  2B3L A;  2BHA A;  2GG9 A;  1B59 A;  2MAT A;  2Q92 A;  2GG8 A;  5CDE A;  5D6E A;  2V3Y A;  4FLL A;  4U70 A;  3QOC A;  2P98 A;  3OVK A;  2BHB A;  2GG2 A;  5D6F A;  2ADU A;  2BHD A;  2Q94 A;  4IDY A;  2GTX A;  4IKS A;  2V3X A;  4FUK A;  4U75 A;  2BWW A;  1R58 A;  2GA2 A;  1QXW A;  4IEC A;  5JFR A;  4FO8 A;  1XGO A;  1BOA A;  1PV9 A;  2GG7 A;  1KP0 A;  4U6W A;  4IPA A;  3FM3 A;  2GGC A;  2BHC A;  4B28 A;  1W2M A;  1N51 A;  4HXX A;  4U6Z A;  1MAT A;  3BIT A;  4FLK A;  5JHU A;  2Q95 A;  4IF7 A;  4S2R P;  2GU4 A;  3PKD A;  1O0X A;  3MR1 A;  4OOK A;  4FKC A;  2HOW A;  1C24 A;  4PV4 A;  2EVC A;  3S6B A;  1WKM A;  2EA4 A;  1WY2 A;  4FO7 A;  1WN1 A;  5E2C A; 
#chains in the Genus database with same CATH topology
 4FLI A;  2Q8K A;  1WBQ A;  4QR8 A;  5JI6 A;  2BWV A;  1YW7 A;  4U73 A;  1Y1N A;  5FCH A;  1A16 A;  3CB6 A;  1BN5 A;  3OOO A;  2B3H A;  4EGE A;  1C21 A;  4A6W A;  1QZY A;  4IKT A;  3TB5 A;  3BIQ A;  4S01 A;  4MAT A;  2V3Z A;  2Q93 A;  2IW2 A;  3PKA A;  3CTZ A;  5FCF A;  2EA2 A;  1C22 A;  2BWU A;  3CB5 A;  3PEB A;  4R60 A;  2DFI A;  2BH3 A;  3IU8 A;  5CDL A;  3IG4 A;  2GU5 A;  4IU6 A;  2BB7 A;  2G6P A;  2GGB A;  4U1B A;  3TAV A;  4ZNG A;  4RZZ A;  5CDV A;  2ZSG A;  4U6C A;  2NQ6 A;  1XGN A;  1CHM A;  4IKU A;  3RVA A;  2EVM A;  4U69 A;  4U6J A;  1KQ9 A;  1XGM A;  4IKR A;  3BIP A;  1C23 A;  3I7M A;  4ZWU A;  3O5V A;  4RGZ 1;  4S00 A;  5CNX A;  1YW8 A;  4FLJ A;  5E5B A;  2NQ7 A;  1WL9 A;  2GG3 A;  2V6C A;  4U71 A;  4Z7M A;  2BN7 A;  5CE6 A;  3IU9 A;  3PKC A;  4PNC A;  2OAZ A;  1WL6 A;  1XNZ A;  1JAW A;  3MX6 A;  1YJ3 A;  2B3K A;  1QXY A;  2OKN A;  3MAT A;  3PKB A;  3L7G A;  4U6E A;  4ZWO A;  3PKE A;  2BWS A;  4RZY A;  4KM3 A;  2GG0 A;  1M35 A;  3L24 A;  1WLR A;  1QXZ A;  1R5G A;  1W7V A;  3PN9 A;  5CIK A;  1YVM A;  2GG5 A;  2GU7 A;  3ROR A;  4A6V A;  2BWT A;  4U76 A;  1B6A A;  3FMQ A;  1YW9 A;  1R5H A;  4S2T P;  4ZWP A;  2EVO A;  1C27 A;  2Q96 A;  3FMR A;  3IL0 A;  2P99 A;  1XGS A;  5CLS A;  2GU6 A;  2BWY A;  2GZ5 A;  1KQ0 A;  2BWX A;  3IU7 A;  3Q6D A;  4JUQ A;  3D27 A;  2P9A A;  2B3L A;  2BHA A;  2GG9 A;  1B59 A;  2MAT A;  2Q92 A;  2GG8 A;  5CDE A;  5D6E A;  2V3Y A;  4FLL A;  4U70 A;  3QOC A;  2P98 A;  3OVK A;  2BHB A;  2GG2 A;  5D6F A;  2ADU A;  2BHD A;  2Q94 A;  4IDY A;  2GTX A;  4IKS A;  2V3X A;  4FUK A;  4U75 A;  2BWW A;  1R58 A;  2GA2 A;  1QXW A;  4IEC A;  5JFR A;  4FO8 A;  1XGO A;  1BOA A;  1PV9 A;  2GG7 A;  1KP0 A;  4U6W A;  4IPA A;  3FM3 A;  2GGC A;  2BHC A;  4B28 A;  1W2M A;  1N51 A;  4HXX A;  4U6Z A;  1MAT A;  3BIT A;  4FLK A;  5JHU A;  2Q95 A;  4IF7 A;  4S2R P;  2GU4 A;  3PKD A;  1O0X A;  3MR1 A;  4OOK A;  4FKC A;  2HOW A;  1C24 A;  4PV4 A;  2EVC A;  3S6B A;  1WKM A;  2EA4 A;  1WY2 A;  4FO7 A;  1WN1 A;  5E2C A; 
#chains in the Genus database with same CATH homology
 4FLI A;  2Q8K A;  1WBQ A;  4QR8 A;  5JI6 A;  2BWV A;  1YW7 A;  4U73 A;  1Y1N A;  5FCH A;  1A16 A;  3CB6 A;  1BN5 A;  3OOO A;  2B3H A;  4EGE A;  1C21 A;  4A6W A;  1QZY A;  4IKT A;  3TB5 A;  3BIQ A;  4S01 A;  4MAT A;  2V3Z A;  2Q93 A;  2IW2 A;  3PKA A;  3CTZ A;  5FCF A;  2EA2 A;  1C22 A;  2BWU A;  3CB5 A;  3PEB A;  4R60 A;  2DFI A;  2BH3 A;  3IU8 A;  5CDL A;  3IG4 A;  2GU5 A;  4IU6 A;  2BB7 A;  2G6P A;  2GGB A;  4U1B A;  3TAV A;  4ZNG A;  4RZZ A;  5CDV A;  2ZSG A;  4U6C A;  2NQ6 A;  1XGN A;  1CHM A;  4IKU A;  3RVA A;  2EVM A;  4U69 A;  4U6J A;  1KQ9 A;  1XGM A;  4IKR A;  3BIP A;  1C23 A;  3I7M A;  4ZWU A;  3O5V A;  4RGZ 1;  4S00 A;  5CNX A;  1YW8 A;  4FLJ A;  5E5B A;  2NQ7 A;  1WL9 A;  2GG3 A;  2V6C A;  4U71 A;  4Z7M A;  2BN7 A;  5CE6 A;  3IU9 A;  3PKC A;  4PNC A;  2OAZ A;  1WL6 A;  1XNZ A;  1JAW A;  3MX6 A;  1YJ3 A;  2B3K A;  1QXY A;  2OKN A;  3MAT A;  3PKB A;  3L7G A;  4U6E A;  4ZWO A;  3PKE A;  2BWS A;  4RZY A;  4KM3 A;  2GG0 A;  1M35 A;  3L24 A;  1WLR A;  1QXZ A;  1R5G A;  1W7V A;  3PN9 A;  5CIK A;  1YVM A;  2GG5 A;  2GU7 A;  3ROR A;  4A6V A;  2BWT A;  4U76 A;  1B6A A;  3FMQ A;  1YW9 A;  1R5H A;  4S2T P;  4ZWP A;  2EVO A;  1C27 A;  2Q96 A;  3FMR A;  3IL0 A;  2P99 A;  1XGS A;  5CLS A;  2GU6 A;  2BWY A;  2GZ5 A;  1KQ0 A;  2BWX A;  3IU7 A;  3Q6D A;  4JUQ A;  3D27 A;  2P9A A;  2B3L A;  2BHA A;  2GG9 A;  1B59 A;  2MAT A;  2Q92 A;  2GG8 A;  5CDE A;  5D6E A;  2V3Y A;  4FLL A;  4U70 A;  3QOC A;  2P98 A;  3OVK A;  2BHB A;  2GG2 A;  5D6F A;  2ADU A;  2BHD A;  2Q94 A;  4IDY A;  2GTX A;  4IKS A;  2V3X A;  4FUK A;  4U75 A;  2BWW A;  1R58 A;  2GA2 A;  1QXW A;  4IEC A;  5JFR A;  4FO8 A;  1XGO A;  1BOA A;  1PV9 A;  2GG7 A;  1KP0 A;  4U6W A;  4IPA A;  3FM3 A;  2GGC A;  2BHC A;  4B28 A;  1W2M A;  1N51 A;  4HXX A;  4U6Z A;  1MAT A;  3BIT A;  4FLK A;  5JHU A;  2Q95 A;  4IF7 A;  4S2R P;  2GU4 A;  3PKD A;  1O0X A;  3MR1 A;  4OOK A;  4FKC A;  2HOW A;  1C24 A;  4PV4 A;  2EVC A;  3S6B A;  1WKM A;  2EA4 A;  1WY2 A;  4FO7 A;  1WN1 A;  5E2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...