2BWXA

His354ala escherichia coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSAWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwxA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwxA02
4FLJA 1KP0A 2GU4A 4PNCA 4S01A 3MX6A 4U73A 4ZWUA 4U70A 1M35A 3PEBA 3IU7A 5D6FA 3RVAA 1R5GA 1C27A 2Q95A 4ZWPA 1YW9A 4U69A 1A16A 4U76A 1B59A 2B3KA 1YJ3A 3D27A 2P99A 4ZWOA 3CB5A 1WY2A 4IU6A 4QR8A 2V6CA 4IF7A 4FLIA 2EVCA 4IKRA 1XNZA 4U6ZA 4IDYA 4JUQA 2EVOA 2GU6A 1QXWA 2V3YA 1BOAA 4IKTA 2MATA 4U6EA 2Q8KA 2BHCA 3PKCA 1YVMA 3OOOA 1QXYA 2Q96A 3PKAA 3CTZA 1C23A 1JAWA 3BITA 3L24A 3Q6DA 2V3XA 4B28A 5JFRA 4PV4A 1XGNA 4S2TP 2EA2A 2GG8A 2GA2A 4RZYA 3MR1A 1QXZA 5E2CA 2GGCA 4U1BA 1XGSA 4U6WA 5CE6A 4S00A 1WL6A 4FKCA 3I7MA 2Q93A 2BWVA 4FLKA 1WLRA 4FUKA 2BHAA 5CDEA 2BWSA 2HOWA 4HXXA 5CDVA 4U6JA 2B3HA 3PN9A 3PKDA 1YW7A 4A6VA 3MATA 4KM3A 2OKNA 1B6AA 5CNXA 3BIPA 2GGBA 4U71A 3OVKA 3RORA 1YW8A 4A6WA 3TB5A 1PV9A 2BWYA 2GZ5A 2ADUA 1C22A 2G6PA 4IPAA 2GG9A 4RZZA 3CB6A 2BHDA 4R60A 2GTXA 1KQ0A 5CDLA 4IECA 4EGEA 2OAZA 4ZNGA 3O5VA 2GG7A 3FMQA 2BB7A 2DFIA 2GG5A 5CLSA 4IKSA 2NQ7A 2B3LA 3IG4A 2BWXA 2EVMA 4U75A 1O0XA 3L7GA 1W2MA 2BHBA 3BIQA 2BWTA 1CHMA 1KQ9A 2Q92A 4IKUA 2GG3A 3IL0A 2BWUA 1MATA 2GU5A 3S6BA 1N51A 3FM3A 2V3ZA 4Z7MA 4FLLA 1QZYA 4FO8A 2GU7A 5JI6A 3PKBA 1WN1A 1XGMA 5JHUA 3TAVA 3FMRA 2P9AA 2GG0A 1WL9A 1W7VA 2IW2A 4RGZ1 1Y1NA 5FCHA 1C24A 1R58A 4S2RP 4MATA 4OOKA 5FCFA 5D6EA 2ZSGA 5E5BA 1C21A 2BN7A 1R5HA 1WKMA 2EA4A 1XGOA 2NQ6A 3IU8A 3PKEA 2BWWA 5CIKA 3QOCA 2P98A 2BH3A 1WBQA 1BN5A 2GG2A 2Q94A 3IU9A 4U6CA 4FO7A
chains in the Genus database with same CATH superfamily
4FLJA 1KP0A 2GU4A 4PNCA 4S01A 3MX6A 4U73A 4ZWUA 4U70A 1M35A 3PEBA 3IU7A 5D6FA 3RVAA 1R5GA 1C27A 2Q95A 4ZWPA 1YW9A 4U69A 1A16A 4U76A 1B59A 2B3KA 1YJ3A 3D27A 2P99A 4ZWOA 3CB5A 1WY2A 4IU6A 4QR8A 2V6CA 4IF7A 4FLIA 2EVCA 4IKRA 1XNZA 4U6ZA 4IDYA 4JUQA 2EVOA 2GU6A 1QXWA 2V3YA 1BOAA 4IKTA 2MATA 4U6EA 2Q8KA 2BHCA 3PKCA 1YVMA 3OOOA 1QXYA 2Q96A 3PKAA 3CTZA 1C23A 1JAWA 3BITA 3L24A 3Q6DA 2V3XA 4B28A 5JFRA 4PV4A 1XGNA 4S2TP 2EA2A 2GG8A 2GA2A 4RZYA 3MR1A 1QXZA 5E2CA 2GGCA 4U1BA 1XGSA 4U6WA 5CE6A 4S00A 1WL6A 4FKCA 3I7MA 2Q93A 2BWVA 4FLKA 1WLRA 4FUKA 2BHAA 5CDEA 2BWSA 2HOWA 4HXXA 5CDVA 4U6JA 2B3HA 3PN9A 3PKDA 1YW7A 4A6VA 3MATA 4KM3A 2OKNA 1B6AA 5CNXA 3BIPA 2GGBA 4U71A 3OVKA 3RORA 1YW8A 4A6WA 3TB5A 1PV9A 2BWYA 2GZ5A 2ADUA 1C22A 2G6PA 4IPAA 2GG9A 4RZZA 3CB6A 2BHDA 4R60A 2GTXA 1KQ0A 5CDLA 4IECA 4EGEA 2OAZA 4ZNGA 3O5VA 2GG7A 3FMQA 2BB7A 2DFIA 2GG5A 5CLSA 4IKSA 2NQ7A 2B3LA 3IG4A 2BWXA 2EVMA 4U75A 1O0XA 3L7GA 1W2MA 2BHBA 3BIQA 2BWTA 1CHMA 1KQ9A 2Q92A 4IKUA 2GG3A 3IL0A 2BWUA 1MATA 2GU5A 3S6BA 1N51A 3FM3A 2V3ZA 4Z7MA 4FLLA 1QZYA 4FO8A 2GU7A 5JI6A 3PKBA 1WN1A 1XGMA 5JHUA 3TAVA 3FMRA 2P9AA 2GG0A 1WL9A 1W7VA 2IW2A 4RGZ1 1Y1NA 5FCHA 1C24A 1R58A 4S2RP 4MATA 4OOKA 5FCFA 5D6EA 2ZSGA 5E5BA 1C21A 2BN7A 1R5HA 1WKMA 2EA4A 1XGOA 2NQ6A 3IU8A 3PKEA 2BWWA 5CIKA 3QOCA 2P98A 2BH3A 1WBQA 1BN5A 2GG2A 2Q94A 3IU9A 4U6CA 4FO7A
chains in the Genus database with same CATH topology
4FLJA 1KP0A 2GU4A 4PNCA 4S01A 3MX6A 4U73A 4ZWUA 4U70A 1M35A 3PEBA 3IU7A 5D6FA 3RVAA 1R5GA 1C27A 2Q95A 4ZWPA 1YW9A 4U69A 1A16A 4U76A 1B59A 2B3KA 1YJ3A 3D27A 2P99A 4ZWOA 3CB5A 1WY2A 4IU6A 4QR8A 2V6CA 4IF7A 4FLIA 2EVCA 4IKRA 1XNZA 4U6ZA 4IDYA 4JUQA 2EVOA 2GU6A 1QXWA 2V3YA 1BOAA 4IKTA 2MATA 4U6EA 2Q8KA 2BHCA 3PKCA 1YVMA 3OOOA 1QXYA 2Q96A 3PKAA 3CTZA 1C23A 1JAWA 3BITA 3L24A 3Q6DA 2V3XA 4B28A 5JFRA 4PV4A 1XGNA 4S2TP 2EA2A 2GG8A 2GA2A 4RZYA 3MR1A 1QXZA 5E2CA 2GGCA 4U1BA 1XGSA 4U6WA 5CE6A 4S00A 1WL6A 4FKCA 3I7MA 2Q93A 2BWVA 4FLKA 1WLRA 4FUKA 2BHAA 5CDEA 2BWSA 2HOWA 4HXXA 5CDVA 4U6JA 2B3HA 3PN9A 3PKDA 1YW7A 4A6VA 3MATA 4KM3A 2OKNA 1B6AA 5CNXA 3BIPA 2GGBA 4U71A 3OVKA 3RORA 1YW8A 4A6WA 3TB5A 1PV9A 2BWYA 2GZ5A 2ADUA 1C22A 2G6PA 4IPAA 2GG9A 4RZZA 3CB6A 2BHDA 4R60A 2GTXA 1KQ0A 5CDLA 4IECA 4EGEA 2OAZA 4ZNGA 3O5VA 2GG7A 3FMQA 2BB7A 2DFIA 2GG5A 5CLSA 4IKSA 2NQ7A 2B3LA 3IG4A 2BWXA 2EVMA 4U75A 1O0XA 3L7GA 1W2MA 2BHBA 3BIQA 2BWTA 1CHMA 1KQ9A 2Q92A 4IKUA 2GG3A 3IL0A 2BWUA 1MATA 2GU5A 3S6BA 1N51A 3FM3A 2V3ZA 4Z7MA 4FLLA 1QZYA 4FO8A 2GU7A 5JI6A 3PKBA 1WN1A 1XGMA 5JHUA 3TAVA 3FMRA 2P9AA 2GG0A 1WL9A 1W7VA 2IW2A 4RGZ1 1Y1NA 5FCHA 1C24A 1R58A 4S2RP 4MATA 4OOKA 5FCFA 5D6EA 2ZSGA 5E5BA 1C21A 2BN7A 1R5HA 1WKMA 2EA4A 1XGOA 2NQ6A 3IU8A 3PKEA 2BWWA 5CIKA 3QOCA 2P98A 2BH3A 1WBQA 1BN5A 2GG2A 2Q94A 3IU9A 4U6CA 4FO7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLJ A;  1KP0 A;  2GU4 A;  4PNC A;  4S01 A;  3MX6 A;  4U73 A;  4ZWU A;  4U70 A;  1M35 A;  3PEB A;  3IU7 A;  5D6F A;  3RVA A;  1R5G A;  1C27 A;  2Q95 A;  4ZWP A;  1YW9 A;  4U69 A;  1A16 A;  4U76 A;  1B59 A;  2B3K A;  1YJ3 A;  3D27 A;  2P99 A;  4ZWO A;  3CB5 A;  1WY2 A;  4IU6 A;  4QR8 A;  2V6C A;  4IF7 A;  4FLI A;  2EVC A;  4IKR A;  1XNZ A;  4U6Z A;  4IDY A;  4JUQ A;  2EVO A;  2GU6 A;  1QXW A;  2V3Y A;  1BOA A;  4IKT A;  2MAT A;  4U6E A;  2Q8K A;  2BHC A;  3PKC A;  1YVM A;  3OOO A;  1QXY A;  2Q96 A;  3PKA A;  3CTZ A;  1C23 A;  1JAW A;  3BIT A;  3L24 A;  3Q6D A;  2V3X A;  4B28 A;  5JFR A;  4PV4 A;  1XGN A;  4S2T P;  2EA2 A;  2GG8 A;  2GA2 A;  4RZY A;  3MR1 A;  1QXZ A;  5E2C A;  2GGC A;  4U1B A;  1XGS A;  4U6W A;  5CE6 A;  4S00 A;  1WL6 A;  4FKC A;  3I7M A;  2Q93 A;  2BWV A;  4FLK A;  1WLR A;  4FUK A;  2BHA A;  5CDE A;  2BWS A;  2HOW A;  4HXX A;  5CDV A;  4U6J A;  2B3H A;  3PN9 A;  3PKD A;  1YW7 A;  4A6V A;  3MAT A;  4KM3 A;  2OKN A;  1B6A A;  5CNX A;  3BIP A;  2GGB A;  4U71 A;  3OVK A;  3ROR A;  1YW8 A;  4A6W A;  3TB5 A;  1PV9 A;  2BWY A;  2GZ5 A;  2ADU A;  1C22 A;  2G6P A;  4IPA A;  2GG9 A;  4RZZ A;  3CB6 A;  2BHD A;  4R60 A;  2GTX A;  1KQ0 A;  5CDL A;  4IEC A;  4EGE A;  2OAZ A;  4ZNG A;  3O5V A;  2GG7 A;  3FMQ A;  2BB7 A;  2DFI A;  2GG5 A;  5CLS A;  4IKS A;  2NQ7 A;  2B3L A;  3IG4 A;  2BWX A;  2EVM A;  4U75 A;  1O0X A;  3L7G A;  1W2M A;  2BHB A;  3BIQ A;  2BWT A;  1CHM A;  1KQ9 A;  2Q92 A;  4IKU A;  2GG3 A;  3IL0 A;  2BWU A;  1MAT A;  2GU5 A;  3S6B A;  1N51 A;  3FM3 A;  2V3Z A;  4Z7M A;  4FLL A;  1QZY A;  4FO8 A;  2GU7 A;  5JI6 A;  3PKB A;  1WN1 A;  1XGM A;  5JHU A;  3TAV A;  3FMR A;  2P9A A;  2GG0 A;  1WL9 A;  1W7V A;  2IW2 A;  4RGZ 1;  1Y1N A;  5FCH A;  1C24 A;  1R58 A;  4S2R P;  4MAT A;  4OOK A;  5FCF A;  5D6E A;  2ZSG A;  5E5B A;  1C21 A;  2BN7 A;  1R5H A;  1WKM A;  2EA4 A;  1XGO A;  2NQ6 A;  3IU8 A;  3PKE A;  2BWW A;  5CIK A;  3QOC A;  2P98 A;  2BH3 A;  1WBQ A;  1BN5 A;  2GG2 A;  2Q94 A;  3IU9 A;  4U6C A;  4FO7 A; 
#chains in the Genus database with same CATH topology
 4FLJ A;  1KP0 A;  2GU4 A;  4PNC A;  4S01 A;  3MX6 A;  4U73 A;  4ZWU A;  4U70 A;  1M35 A;  3PEB A;  3IU7 A;  5D6F A;  3RVA A;  1R5G A;  1C27 A;  2Q95 A;  4ZWP A;  1YW9 A;  4U69 A;  1A16 A;  4U76 A;  1B59 A;  2B3K A;  1YJ3 A;  3D27 A;  2P99 A;  4ZWO A;  3CB5 A;  1WY2 A;  4IU6 A;  4QR8 A;  2V6C A;  4IF7 A;  4FLI A;  2EVC A;  4IKR A;  1XNZ A;  4U6Z A;  4IDY A;  4JUQ A;  2EVO A;  2GU6 A;  1QXW A;  2V3Y A;  1BOA A;  4IKT A;  2MAT A;  4U6E A;  2Q8K A;  2BHC A;  3PKC A;  1YVM A;  3OOO A;  1QXY A;  2Q96 A;  3PKA A;  3CTZ A;  1C23 A;  1JAW A;  3BIT A;  3L24 A;  3Q6D A;  2V3X A;  4B28 A;  5JFR A;  4PV4 A;  1XGN A;  4S2T P;  2EA2 A;  2GG8 A;  2GA2 A;  4RZY A;  3MR1 A;  1QXZ A;  5E2C A;  2GGC A;  4U1B A;  1XGS A;  4U6W A;  5CE6 A;  4S00 A;  1WL6 A;  4FKC A;  3I7M A;  2Q93 A;  2BWV A;  4FLK A;  1WLR A;  4FUK A;  2BHA A;  5CDE A;  2BWS A;  2HOW A;  4HXX A;  5CDV A;  4U6J A;  2B3H A;  3PN9 A;  3PKD A;  1YW7 A;  4A6V A;  3MAT A;  4KM3 A;  2OKN A;  1B6A A;  5CNX A;  3BIP A;  2GGB A;  4U71 A;  3OVK A;  3ROR A;  1YW8 A;  4A6W A;  3TB5 A;  1PV9 A;  2BWY A;  2GZ5 A;  2ADU A;  1C22 A;  2G6P A;  4IPA A;  2GG9 A;  4RZZ A;  3CB6 A;  2BHD A;  4R60 A;  2GTX A;  1KQ0 A;  5CDL A;  4IEC A;  4EGE A;  2OAZ A;  4ZNG A;  3O5V A;  2GG7 A;  3FMQ A;  2BB7 A;  2DFI A;  2GG5 A;  5CLS A;  4IKS A;  2NQ7 A;  2B3L A;  3IG4 A;  2BWX A;  2EVM A;  4U75 A;  1O0X A;  3L7G A;  1W2M A;  2BHB A;  3BIQ A;  2BWT A;  1CHM A;  1KQ9 A;  2Q92 A;  4IKU A;  2GG3 A;  3IL0 A;  2BWU A;  1MAT A;  2GU5 A;  3S6B A;  1N51 A;  3FM3 A;  2V3Z A;  4Z7M A;  4FLL A;  1QZY A;  4FO8 A;  2GU7 A;  5JI6 A;  3PKB A;  1WN1 A;  1XGM A;  5JHU A;  3TAV A;  3FMR A;  2P9A A;  2GG0 A;  1WL9 A;  1W7V A;  2IW2 A;  4RGZ 1;  1Y1N A;  5FCH A;  1C24 A;  1R58 A;  4S2R P;  4MAT A;  4OOK A;  5FCF A;  5D6E A;  2ZSG A;  5E5B A;  1C21 A;  2BN7 A;  1R5H A;  1WKM A;  2EA4 A;  1XGO A;  2NQ6 A;  3IU8 A;  3PKE A;  2BWW A;  5CIK A;  3QOC A;  2P98 A;  2BH3 A;  1WBQ A;  1BN5 A;  2GG2 A;  2Q94 A;  3IU9 A;  4U6C A;  4FO7 A; 
#chains in the Genus database with same CATH homology
 4FLJ A;  1KP0 A;  2GU4 A;  4PNC A;  4S01 A;  3MX6 A;  4U73 A;  4ZWU A;  4U70 A;  1M35 A;  3PEB A;  3IU7 A;  5D6F A;  3RVA A;  1R5G A;  1C27 A;  2Q95 A;  4ZWP A;  1YW9 A;  4U69 A;  1A16 A;  4U76 A;  1B59 A;  2B3K A;  1YJ3 A;  3D27 A;  2P99 A;  4ZWO A;  3CB5 A;  1WY2 A;  4IU6 A;  4QR8 A;  2V6C A;  4IF7 A;  4FLI A;  2EVC A;  4IKR A;  1XNZ A;  4U6Z A;  4IDY A;  4JUQ A;  2EVO A;  2GU6 A;  1QXW A;  2V3Y A;  1BOA A;  4IKT A;  2MAT A;  4U6E A;  2Q8K A;  2BHC A;  3PKC A;  1YVM A;  3OOO A;  1QXY A;  2Q96 A;  3PKA A;  3CTZ A;  1C23 A;  1JAW A;  3BIT A;  3L24 A;  3Q6D A;  2V3X A;  4B28 A;  5JFR A;  4PV4 A;  1XGN A;  4S2T P;  2EA2 A;  2GG8 A;  2GA2 A;  4RZY A;  3MR1 A;  1QXZ A;  5E2C A;  2GGC A;  4U1B A;  1XGS A;  4U6W A;  5CE6 A;  4S00 A;  1WL6 A;  4FKC A;  3I7M A;  2Q93 A;  2BWV A;  4FLK A;  1WLR A;  4FUK A;  2BHA A;  5CDE A;  2BWS A;  2HOW A;  4HXX A;  5CDV A;  4U6J A;  2B3H A;  3PN9 A;  3PKD A;  1YW7 A;  4A6V A;  3MAT A;  4KM3 A;  2OKN A;  1B6A A;  5CNX A;  3BIP A;  2GGB A;  4U71 A;  3OVK A;  3ROR A;  1YW8 A;  4A6W A;  3TB5 A;  1PV9 A;  2BWY A;  2GZ5 A;  2ADU A;  1C22 A;  2G6P A;  4IPA A;  2GG9 A;  4RZZ A;  3CB6 A;  2BHD A;  4R60 A;  2GTX A;  1KQ0 A;  5CDL A;  4IEC A;  4EGE A;  2OAZ A;  4ZNG A;  3O5V A;  2GG7 A;  3FMQ A;  2BB7 A;  2DFI A;  2GG5 A;  5CLS A;  4IKS A;  2NQ7 A;  2B3L A;  3IG4 A;  2BWX A;  2EVM A;  4U75 A;  1O0X A;  3L7G A;  1W2M A;  2BHB A;  3BIQ A;  2BWT A;  1CHM A;  1KQ9 A;  2Q92 A;  4IKU A;  2GG3 A;  3IL0 A;  2BWU A;  1MAT A;  2GU5 A;  3S6B A;  1N51 A;  3FM3 A;  2V3Z A;  4Z7M A;  4FLL A;  1QZY A;  4FO8 A;  2GU7 A;  5JI6 A;  3PKB A;  1WN1 A;  1XGM A;  5JHU A;  3TAV A;  3FMR A;  2P9A A;  2GG0 A;  1WL9 A;  1W7V A;  2IW2 A;  4RGZ 1;  1Y1N A;  5FCH A;  1C24 A;  1R58 A;  4S2R P;  4MAT A;  4OOK A;  5FCF A;  5D6E A;  2ZSG A;  5E5B A;  1C21 A;  2BN7 A;  1R5H A;  1WKM A;  2EA4 A;  1XGO A;  2NQ6 A;  3IU8 A;  3PKE A;  2BWW A;  5CIK A;  3QOC A;  2P98 A;  2BH3 A;  1WBQ A;  1BN5 A;  2GG2 A;  2Q94 A;  3IU9 A;  4U6C A;  4FO7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...