2BWXA

His354ala escherichia coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSAWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwxA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwxA02
1XGOA 2ADUA 5CE6A 2Q95A 1QXZA 2Q94A 1YJ3A 1C22A 2BWWA 3BIQA 4U1BA 1XNZA 4IKUA 2GG2A 3PEBA 2GG8A 4S2RP 3IU8A 3MX6A 2Q96A 1QXYA 4FUKA 5D6FA 3OVKA 1A16A 2NQ7A 5CDEA 4IU6A 2P98A 3IU7A 4A6VA 5CNXA 2BB7A 2MATA 2V3ZA 5JHUA 2BWSA 3QOCA 2G6PA 1KQ9A 1QXWA 4S01A 4U73A 1KP0A 2BHBA 3L24A 1KQ0A 3TAVA 2BHDA 4ZWUA 4HXXA 4U70A 2EA2A 4R60A 4RZZA 3BIPA 5FCHA 4S00A 4S2TP 2ZSGA 1WLRA 2BWUA 3CB5A 4IECA 2GGCA 4B28A 1B6AA 2B3LA 1O0XA 4RZYA 1JAWA 4IDYA 2OKNA 1B59A 2GU5A 2Q93A 2BWXA 2B3HA 1YVMA 2GG0A 3PKDA 1WL6A 3RVAA 1C24A 2Q8KA 1XGMA 3PN9A 3Q6DA 1WL9A 1WN1A 4MATA 3IL0A 3TB5A 2HOWA 4ZNGA 1WBQA 4FLKA 2GG5A 3OOOA 4JUQA 5CDVA 2GG3A 3MR1A 5FCFA 4ZWPA 2GU7A 2BH3A 2BWYA 1C21A 4FO7A 1C27A 2OAZA 2V3XA 1W7VA 4EGEA 1XGSA 1YW7A 1YW8A 4U6CA 4A6WA 1R5GA 4FO8A 2EVCA 4PV4A 5E2CA 4FLIA 4RGZ1 2P99A 4IPAA 3CB6A 3I7MA 2EVMA 3FMQA 1C23A 3RORA 2DFIA 5E5BA 4U6JA 3PKCA 3PKBA 1R58A 3FMRA 4PNCA 4U6WA 5D6EA 1CHMA 2EA4A 1PV9A 3PKAA 4IF7A 4FLJA 4U6ZA 4U6EA 5CIKA 2GZ5A 4U71A 3L7GA 1BN5A 1XGNA 4Z7MA 1WY2A 3D27A 2GG9A 2GTXA 4ZWOA 2NQ6A 4IKSA 3S6BA 3BITA 3IG4A 5CDLA 4FKCA 4IKRA 1M35A 2BHCA 2BWTA 2BHAA 1QZYA 1Y1NA 2GU6A 5JFRA 4OOKA 2V6CA 4U69A 2B3KA 2GU4A 2EVOA 4U76A 2GGBA 3MATA 1YW9A 3FM3A 3IU9A 2V3YA 5CLSA 4QR8A 2BWVA 1MATA 2GA2A 4U75A 1WKMA 1BOAA 1W2MA 2BN7A 1N51A 3PKEA 3O5VA 2IW2A 2Q92A 4KM3A 1R5HA 2GG7A 2P9AA 4FLLA 5JI6A 4IKTA 3CTZA
chains in the Genus database with same CATH superfamily
1XGOA 2ADUA 5CE6A 2Q95A 1QXZA 2Q94A 1YJ3A 1C22A 2BWWA 3BIQA 4U1BA 1XNZA 4IKUA 2GG2A 3PEBA 2GG8A 4S2RP 3IU8A 3MX6A 2Q96A 1QXYA 4FUKA 5D6FA 3OVKA 1A16A 2NQ7A 5CDEA 4IU6A 2P98A 3IU7A 4A6VA 5CNXA 2BB7A 2MATA 2V3ZA 5JHUA 2BWSA 3QOCA 2G6PA 1KQ9A 1QXWA 4S01A 4U73A 1KP0A 2BHBA 3L24A 1KQ0A 3TAVA 2BHDA 4ZWUA 4HXXA 4U70A 2EA2A 4R60A 4RZZA 3BIPA 5FCHA 4S00A 4S2TP 2ZSGA 1WLRA 2BWUA 3CB5A 4IECA 2GGCA 4B28A 1B6AA 2B3LA 1O0XA 4RZYA 1JAWA 4IDYA 2OKNA 1B59A 2GU5A 2Q93A 2BWXA 2B3HA 1YVMA 2GG0A 3PKDA 1WL6A 3RVAA 1C24A 2Q8KA 1XGMA 3PN9A 3Q6DA 1WL9A 1WN1A 4MATA 3IL0A 3TB5A 2HOWA 4ZNGA 1WBQA 4FLKA 2GG5A 3OOOA 4JUQA 5CDVA 2GG3A 3MR1A 5FCFA 4ZWPA 2GU7A 2BH3A 2BWYA 1C21A 4FO7A 1C27A 2OAZA 2V3XA 1W7VA 4EGEA 1XGSA 1YW7A 1YW8A 4U6CA 4A6WA 1R5GA 4FO8A 2EVCA 4PV4A 5E2CA 4FLIA 4RGZ1 2P99A 4IPAA 3CB6A 3I7MA 2EVMA 3FMQA 1C23A 3RORA 2DFIA 5E5BA 4U6JA 3PKCA 3PKBA 1R58A 3FMRA 4PNCA 4U6WA 5D6EA 1CHMA 2EA4A 1PV9A 3PKAA 4IF7A 4FLJA 4U6ZA 4U6EA 5CIKA 2GZ5A 4U71A 3L7GA 1BN5A 1XGNA 4Z7MA 1WY2A 3D27A 2GG9A 2GTXA 4ZWOA 2NQ6A 4IKSA 3S6BA 3BITA 3IG4A 5CDLA 4FKCA 4IKRA 1M35A 2BHCA 2BWTA 2BHAA 1QZYA 1Y1NA 2GU6A 5JFRA 4OOKA 2V6CA 4U69A 2B3KA 2GU4A 2EVOA 4U76A 2GGBA 3MATA 1YW9A 3FM3A 3IU9A 2V3YA 5CLSA 4QR8A 2BWVA 1MATA 2GA2A 4U75A 1WKMA 1BOAA 1W2MA 2BN7A 1N51A 3PKEA 3O5VA 2IW2A 2Q92A 4KM3A 1R5HA 2GG7A 2P9AA 4FLLA 5JI6A 4IKTA 3CTZA
chains in the Genus database with same CATH topology
1XGOA 2ADUA 5CE6A 2Q95A 1QXZA 2Q94A 1YJ3A 1C22A 2BWWA 3BIQA 4U1BA 1XNZA 4IKUA 2GG2A 3PEBA 2GG8A 4S2RP 3IU8A 3MX6A 2Q96A 1QXYA 4FUKA 5D6FA 3OVKA 1A16A 2NQ7A 5CDEA 4IU6A 2P98A 3IU7A 4A6VA 5CNXA 2BB7A 2MATA 2V3ZA 5JHUA 2BWSA 3QOCA 2G6PA 1KQ9A 1QXWA 4S01A 4U73A 1KP0A 2BHBA 3L24A 1KQ0A 3TAVA 2BHDA 4ZWUA 4HXXA 4U70A 2EA2A 4R60A 4RZZA 3BIPA 5FCHA 4S00A 4S2TP 2ZSGA 1WLRA 2BWUA 3CB5A 4IECA 2GGCA 4B28A 1B6AA 2B3LA 1O0XA 4RZYA 1JAWA 4IDYA 2OKNA 1B59A 2GU5A 2Q93A 2BWXA 2B3HA 1YVMA 2GG0A 3PKDA 1WL6A 3RVAA 1C24A 2Q8KA 1XGMA 3PN9A 3Q6DA 1WL9A 1WN1A 4MATA 3IL0A 3TB5A 2HOWA 4ZNGA 1WBQA 4FLKA 2GG5A 3OOOA 4JUQA 5CDVA 2GG3A 3MR1A 5FCFA 4ZWPA 2GU7A 2BH3A 2BWYA 1C21A 4FO7A 1C27A 2OAZA 2V3XA 1W7VA 4EGEA 1XGSA 1YW7A 1YW8A 4U6CA 4A6WA 1R5GA 4FO8A 2EVCA 4PV4A 5E2CA 4FLIA 4RGZ1 2P99A 4IPAA 3CB6A 3I7MA 2EVMA 3FMQA 1C23A 3RORA 2DFIA 5E5BA 4U6JA 3PKCA 3PKBA 1R58A 3FMRA 4PNCA 4U6WA 5D6EA 1CHMA 2EA4A 1PV9A 3PKAA 4IF7A 4FLJA 4U6ZA 4U6EA 5CIKA 2GZ5A 4U71A 3L7GA 1BN5A 1XGNA 4Z7MA 1WY2A 3D27A 2GG9A 2GTXA 4ZWOA 2NQ6A 4IKSA 3S6BA 3BITA 3IG4A 5CDLA 4FKCA 4IKRA 1M35A 2BHCA 2BWTA 2BHAA 1QZYA 1Y1NA 2GU6A 5JFRA 4OOKA 2V6CA 4U69A 2B3KA 2GU4A 2EVOA 4U76A 2GGBA 3MATA 1YW9A 3FM3A 3IU9A 2V3YA 5CLSA 4QR8A 2BWVA 1MATA 2GA2A 4U75A 1WKMA 1BOAA 1W2MA 2BN7A 1N51A 3PKEA 3O5VA 2IW2A 2Q92A 4KM3A 1R5HA 2GG7A 2P9AA 4FLLA 5JI6A 4IKTA 3CTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XGO A;  2ADU A;  5CE6 A;  2Q95 A;  1QXZ A;  2Q94 A;  1YJ3 A;  1C22 A;  2BWW A;  3BIQ A;  4U1B A;  1XNZ A;  4IKU A;  2GG2 A;  3PEB A;  2GG8 A;  4S2R P;  3IU8 A;  3MX6 A;  2Q96 A;  1QXY A;  4FUK A;  5D6F A;  3OVK A;  1A16 A;  2NQ7 A;  5CDE A;  4IU6 A;  2P98 A;  3IU7 A;  4A6V A;  5CNX A;  2BB7 A;  2MAT A;  2V3Z A;  5JHU A;  2BWS A;  3QOC A;  2G6P A;  1KQ9 A;  1QXW A;  4S01 A;  4U73 A;  1KP0 A;  2BHB A;  3L24 A;  1KQ0 A;  3TAV A;  2BHD A;  4ZWU A;  4HXX A;  4U70 A;  2EA2 A;  4R60 A;  4RZZ A;  3BIP A;  5FCH A;  4S00 A;  4S2T P;  2ZSG A;  1WLR A;  2BWU A;  3CB5 A;  4IEC A;  2GGC A;  4B28 A;  1B6A A;  2B3L A;  1O0X A;  4RZY A;  1JAW A;  4IDY A;  2OKN A;  1B59 A;  2GU5 A;  2Q93 A;  2BWX A;  2B3H A;  1YVM A;  2GG0 A;  3PKD A;  1WL6 A;  3RVA A;  1C24 A;  2Q8K A;  1XGM A;  3PN9 A;  3Q6D A;  1WL9 A;  1WN1 A;  4MAT A;  3IL0 A;  3TB5 A;  2HOW A;  4ZNG A;  1WBQ A;  4FLK A;  2GG5 A;  3OOO A;  4JUQ A;  5CDV A;  2GG3 A;  3MR1 A;  5FCF A;  4ZWP A;  2GU7 A;  2BH3 A;  2BWY A;  1C21 A;  4FO7 A;  1C27 A;  2OAZ A;  2V3X A;  1W7V A;  4EGE A;  1XGS A;  1YW7 A;  1YW8 A;  4U6C A;  4A6W A;  1R5G A;  4FO8 A;  2EVC A;  4PV4 A;  5E2C A;  4FLI A;  4RGZ 1;  2P99 A;  4IPA A;  3CB6 A;  3I7M A;  2EVM A;  3FMQ A;  1C23 A;  3ROR A;  2DFI A;  5E5B A;  4U6J A;  3PKC A;  3PKB A;  1R58 A;  3FMR A;  4PNC A;  4U6W A;  5D6E A;  1CHM A;  2EA4 A;  1PV9 A;  3PKA A;  4IF7 A;  4FLJ A;  4U6Z A;  4U6E A;  5CIK A;  2GZ5 A;  4U71 A;  3L7G A;  1BN5 A;  1XGN A;  4Z7M A;  1WY2 A;  3D27 A;  2GG9 A;  2GTX A;  4ZWO A;  2NQ6 A;  4IKS A;  3S6B A;  3BIT A;  3IG4 A;  5CDL A;  4FKC A;  4IKR A;  1M35 A;  2BHC A;  2BWT A;  2BHA A;  1QZY A;  1Y1N A;  2GU6 A;  5JFR A;  4OOK A;  2V6C A;  4U69 A;  2B3K A;  2GU4 A;  2EVO A;  4U76 A;  2GGB A;  3MAT A;  1YW9 A;  3FM3 A;  3IU9 A;  2V3Y A;  5CLS A;  4QR8 A;  2BWV A;  1MAT A;  2GA2 A;  4U75 A;  1WKM A;  1BOA A;  1W2M A;  2BN7 A;  1N51 A;  3PKE A;  3O5V A;  2IW2 A;  2Q92 A;  4KM3 A;  1R5H A;  2GG7 A;  2P9A A;  4FLL A;  5JI6 A;  4IKT A;  3CTZ A; 
#chains in the Genus database with same CATH topology
 1XGO A;  2ADU A;  5CE6 A;  2Q95 A;  1QXZ A;  2Q94 A;  1YJ3 A;  1C22 A;  2BWW A;  3BIQ A;  4U1B A;  1XNZ A;  4IKU A;  2GG2 A;  3PEB A;  2GG8 A;  4S2R P;  3IU8 A;  3MX6 A;  2Q96 A;  1QXY A;  4FUK A;  5D6F A;  3OVK A;  1A16 A;  2NQ7 A;  5CDE A;  4IU6 A;  2P98 A;  3IU7 A;  4A6V A;  5CNX A;  2BB7 A;  2MAT A;  2V3Z A;  5JHU A;  2BWS A;  3QOC A;  2G6P A;  1KQ9 A;  1QXW A;  4S01 A;  4U73 A;  1KP0 A;  2BHB A;  3L24 A;  1KQ0 A;  3TAV A;  2BHD A;  4ZWU A;  4HXX A;  4U70 A;  2EA2 A;  4R60 A;  4RZZ A;  3BIP A;  5FCH A;  4S00 A;  4S2T P;  2ZSG A;  1WLR A;  2BWU A;  3CB5 A;  4IEC A;  2GGC A;  4B28 A;  1B6A A;  2B3L A;  1O0X A;  4RZY A;  1JAW A;  4IDY A;  2OKN A;  1B59 A;  2GU5 A;  2Q93 A;  2BWX A;  2B3H A;  1YVM A;  2GG0 A;  3PKD A;  1WL6 A;  3RVA A;  1C24 A;  2Q8K A;  1XGM A;  3PN9 A;  3Q6D A;  1WL9 A;  1WN1 A;  4MAT A;  3IL0 A;  3TB5 A;  2HOW A;  4ZNG A;  1WBQ A;  4FLK A;  2GG5 A;  3OOO A;  4JUQ A;  5CDV A;  2GG3 A;  3MR1 A;  5FCF A;  4ZWP A;  2GU7 A;  2BH3 A;  2BWY A;  1C21 A;  4FO7 A;  1C27 A;  2OAZ A;  2V3X A;  1W7V A;  4EGE A;  1XGS A;  1YW7 A;  1YW8 A;  4U6C A;  4A6W A;  1R5G A;  4FO8 A;  2EVC A;  4PV4 A;  5E2C A;  4FLI A;  4RGZ 1;  2P99 A;  4IPA A;  3CB6 A;  3I7M A;  2EVM A;  3FMQ A;  1C23 A;  3ROR A;  2DFI A;  5E5B A;  4U6J A;  3PKC A;  3PKB A;  1R58 A;  3FMR A;  4PNC A;  4U6W A;  5D6E A;  1CHM A;  2EA4 A;  1PV9 A;  3PKA A;  4IF7 A;  4FLJ A;  4U6Z A;  4U6E A;  5CIK A;  2GZ5 A;  4U71 A;  3L7G A;  1BN5 A;  1XGN A;  4Z7M A;  1WY2 A;  3D27 A;  2GG9 A;  2GTX A;  4ZWO A;  2NQ6 A;  4IKS A;  3S6B A;  3BIT A;  3IG4 A;  5CDL A;  4FKC A;  4IKR A;  1M35 A;  2BHC A;  2BWT A;  2BHA A;  1QZY A;  1Y1N A;  2GU6 A;  5JFR A;  4OOK A;  2V6C A;  4U69 A;  2B3K A;  2GU4 A;  2EVO A;  4U76 A;  2GGB A;  3MAT A;  1YW9 A;  3FM3 A;  3IU9 A;  2V3Y A;  5CLS A;  4QR8 A;  2BWV A;  1MAT A;  2GA2 A;  4U75 A;  1WKM A;  1BOA A;  1W2M A;  2BN7 A;  1N51 A;  3PKE A;  3O5V A;  2IW2 A;  2Q92 A;  4KM3 A;  1R5H A;  2GG7 A;  2P9A A;  4FLL A;  5JI6 A;  4IKT A;  3CTZ A; 
#chains in the Genus database with same CATH homology
 1XGO A;  2ADU A;  5CE6 A;  2Q95 A;  1QXZ A;  2Q94 A;  1YJ3 A;  1C22 A;  2BWW A;  3BIQ A;  4U1B A;  1XNZ A;  4IKU A;  2GG2 A;  3PEB A;  2GG8 A;  4S2R P;  3IU8 A;  3MX6 A;  2Q96 A;  1QXY A;  4FUK A;  5D6F A;  3OVK A;  1A16 A;  2NQ7 A;  5CDE A;  4IU6 A;  2P98 A;  3IU7 A;  4A6V A;  5CNX A;  2BB7 A;  2MAT A;  2V3Z A;  5JHU A;  2BWS A;  3QOC A;  2G6P A;  1KQ9 A;  1QXW A;  4S01 A;  4U73 A;  1KP0 A;  2BHB A;  3L24 A;  1KQ0 A;  3TAV A;  2BHD A;  4ZWU A;  4HXX A;  4U70 A;  2EA2 A;  4R60 A;  4RZZ A;  3BIP A;  5FCH A;  4S00 A;  4S2T P;  2ZSG A;  1WLR A;  2BWU A;  3CB5 A;  4IEC A;  2GGC A;  4B28 A;  1B6A A;  2B3L A;  1O0X A;  4RZY A;  1JAW A;  4IDY A;  2OKN A;  1B59 A;  2GU5 A;  2Q93 A;  2BWX A;  2B3H A;  1YVM A;  2GG0 A;  3PKD A;  1WL6 A;  3RVA A;  1C24 A;  2Q8K A;  1XGM A;  3PN9 A;  3Q6D A;  1WL9 A;  1WN1 A;  4MAT A;  3IL0 A;  3TB5 A;  2HOW A;  4ZNG A;  1WBQ A;  4FLK A;  2GG5 A;  3OOO A;  4JUQ A;  5CDV A;  2GG3 A;  3MR1 A;  5FCF A;  4ZWP A;  2GU7 A;  2BH3 A;  2BWY A;  1C21 A;  4FO7 A;  1C27 A;  2OAZ A;  2V3X A;  1W7V A;  4EGE A;  1XGS A;  1YW7 A;  1YW8 A;  4U6C A;  4A6W A;  1R5G A;  4FO8 A;  2EVC A;  4PV4 A;  5E2C A;  4FLI A;  4RGZ 1;  2P99 A;  4IPA A;  3CB6 A;  3I7M A;  2EVM A;  3FMQ A;  1C23 A;  3ROR A;  2DFI A;  5E5B A;  4U6J A;  3PKC A;  3PKB A;  1R58 A;  3FMR A;  4PNC A;  4U6W A;  5D6E A;  1CHM A;  2EA4 A;  1PV9 A;  3PKA A;  4IF7 A;  4FLJ A;  4U6Z A;  4U6E A;  5CIK A;  2GZ5 A;  4U71 A;  3L7G A;  1BN5 A;  1XGN A;  4Z7M A;  1WY2 A;  3D27 A;  2GG9 A;  2GTX A;  4ZWO A;  2NQ6 A;  4IKS A;  3S6B A;  3BIT A;  3IG4 A;  5CDL A;  4FKC A;  4IKR A;  1M35 A;  2BHC A;  2BWT A;  2BHA A;  1QZY A;  1Y1N A;  2GU6 A;  5JFR A;  4OOK A;  2V6C A;  4U69 A;  2B3K A;  2GU4 A;  2EVO A;  4U76 A;  2GGB A;  3MAT A;  1YW9 A;  3FM3 A;  3IU9 A;  2V3Y A;  5CLS A;  4QR8 A;  2BWV A;  1MAT A;  2GA2 A;  4U75 A;  1WKM A;  1BOA A;  1W2M A;  2BN7 A;  1N51 A;  3PKE A;  3O5V A;  2IW2 A;  2Q92 A;  4KM3 A;  1R5H A;  2GG7 A;  2P9A A;  4FLL A;  5JI6 A;  4IKT A;  3CTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...