2BWXA

His354ala escherichia coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSAWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords AMINOPEPTIDASE P
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwxA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwxA02
1WL6A 2V3XA 4U76A 2GGCA 3PEBA 4S01A 4S00A 4IKRA 4JUQA 2GG2A 3RVAA 4IDYA 2BN7A 3IU8A 1JAWA 1BOAA 2ZSGA 2Q93A 1C23A 1WY2A 2P9AA 3OVKA 1YVMA 3O5VA 3L24A 2BWVA 4FLJA 2BHBA 2ADUA 4KM3A 2BHAA 2DFIA 2GGBA 3D27A 4U6CA 1XGNA 2BHDA 4U69A 1R5HA 4S2RP 3PKAA 5CLSA 1WL9A 2GG0A 4ZNGA 2GU6A 4IKSA 2GU5A 3IU9A 4IECA 5CE6A 1C24A 2BWWA 1WN1A 2Q92A 2NQ7A 4EGEA 2OKNA 4PV4A 1B6AA 4U6EA 2GG8A 1W2MA 3BITA 1WLRA 3CTZA 3IU7A 4FUKA 4IKUA 2B3HA 4U71A 2OAZA 2HOWA 5CDVA 2EA2A 1XGOA 2NQ6A 3FMQA 4PNCA 4U6JA 4U6WA 1CHMA 2Q8KA 5JFRA 4FO7A 2BWYA 4FLLA 3BIQA 4ZWPA 1QXYA 1QZYA 3IL0A 3MR1A 5D6FA 1BN5A 2BWSA 1WBQA 3Q6DA 1YJ3A 3OOOA 3PN9A 5FCHA 2B3KA 4U1BA 2IW2A 1XGMA 4FKCA 4R60A 5JHUA 3TAVA 2GG5A 1YW9A 3L7GA 4Z7MA 3PKCA 4OOKA 4U75A 2V6CA 4RGZ1 3S6BA 5JI6A 3PKBA 4IPAA 2EVMA 4U70A 2EVCA 1QXZA 2EVOA 2Q95A 5D6EA 2GG9A 4S2TP 5E2CA 2GZ5A 1R58A 1C22A 2GTXA 2Q96A 3FM3A 1A16A 1O0XA 1N51A 3MATA 2EA4A 4RZYA 4ZWUA 2GU4A 1XGSA 4B28A 2P99A 2GG7A 2BWTA 3MX6A 4ZWOA 2GA2A 1XNZA 2BWUA 5CNXA 1YW8A 4FLKA 4IF7A 4QR8A 1MATA 4IKTA 3QOCA 1PV9A 1YW7A 2BWXA 3IG4A 2B3LA 1W7VA 2GG3A 2MATA 2G6PA 1KQ0A 5CDLA 2BHCA 4FO8A 1C21A 3TB5A 3I7MA 5E5BA 4U73A 1B59A 4RZZA 5CIKA 2BB7A 4IU6A 3FMRA 3PKEA 2Q94A 5FCFA 2P98A 1M35A 4A6VA 1C27A 1QXWA 1Y1NA 2GU7A 4HXXA 3CB5A 3CB6A 3BIPA 1KQ9A 2BH3A 3PKDA 4U6ZA 1R5GA 4FLIA 1KP0A 4MATA 4A6WA 5CDEA 3RORA 1WKMA 2V3ZA 2V3YA
chains in the Genus database with same CATH superfamily
1WL6A 2V3XA 4U76A 2GGCA 3PEBA 4S01A 4S00A 4IKRA 4JUQA 2GG2A 3RVAA 4IDYA 2BN7A 3IU8A 1JAWA 1BOAA 2ZSGA 2Q93A 1C23A 1WY2A 2P9AA 3OVKA 1YVMA 3O5VA 3L24A 2BWVA 4FLJA 2BHBA 2ADUA 4KM3A 2BHAA 2DFIA 2GGBA 3D27A 4U6CA 1XGNA 2BHDA 4U69A 1R5HA 4S2RP 3PKAA 5CLSA 1WL9A 2GG0A 4ZNGA 2GU6A 4IKSA 2GU5A 3IU9A 4IECA 5CE6A 1C24A 2BWWA 1WN1A 2Q92A 2NQ7A 4EGEA 2OKNA 4PV4A 1B6AA 4U6EA 2GG8A 1W2MA 3BITA 1WLRA 3CTZA 3IU7A 4FUKA 4IKUA 2B3HA 4U71A 2OAZA 2HOWA 5CDVA 2EA2A 1XGOA 2NQ6A 3FMQA 4PNCA 4U6JA 4U6WA 1CHMA 2Q8KA 5JFRA 4FO7A 2BWYA 4FLLA 3BIQA 4ZWPA 1QXYA 1QZYA 3IL0A 3MR1A 5D6FA 1BN5A 2BWSA 1WBQA 3Q6DA 1YJ3A 3OOOA 3PN9A 5FCHA 2B3KA 4U1BA 2IW2A 1XGMA 4FKCA 4R60A 5JHUA 3TAVA 2GG5A 1YW9A 3L7GA 4Z7MA 3PKCA 4OOKA 4U75A 2V6CA 4RGZ1 3S6BA 5JI6A 3PKBA 4IPAA 2EVMA 4U70A 2EVCA 1QXZA 2EVOA 2Q95A 5D6EA 2GG9A 4S2TP 5E2CA 2GZ5A 1R58A 1C22A 2GTXA 2Q96A 3FM3A 1A16A 1O0XA 1N51A 3MATA 2EA4A 4RZYA 4ZWUA 2GU4A 1XGSA 4B28A 2P99A 2GG7A 2BWTA 3MX6A 4ZWOA 2GA2A 1XNZA 2BWUA 5CNXA 1YW8A 4FLKA 4IF7A 4QR8A 1MATA 4IKTA 3QOCA 1PV9A 1YW7A 2BWXA 3IG4A 2B3LA 1W7VA 2GG3A 2MATA 2G6PA 1KQ0A 5CDLA 2BHCA 4FO8A 1C21A 3TB5A 3I7MA 5E5BA 4U73A 1B59A 4RZZA 5CIKA 2BB7A 4IU6A 3FMRA 3PKEA 2Q94A 5FCFA 2P98A 1M35A 4A6VA 1C27A 1QXWA 1Y1NA 2GU7A 4HXXA 3CB5A 3CB6A 3BIPA 1KQ9A 2BH3A 3PKDA 4U6ZA 1R5GA 4FLIA 1KP0A 4MATA 4A6WA 5CDEA 3RORA 1WKMA 2V3ZA 2V3YA
chains in the Genus database with same CATH topology
1WL6A 2V3XA 4U76A 2GGCA 3PEBA 4S01A 4S00A 4IKRA 4JUQA 2GG2A 3RVAA 4IDYA 2BN7A 3IU8A 1JAWA 1BOAA 2ZSGA 2Q93A 1C23A 1WY2A 2P9AA 3OVKA 1YVMA 3O5VA 3L24A 2BWVA 4FLJA 2BHBA 2ADUA 4KM3A 2BHAA 2DFIA 2GGBA 3D27A 4U6CA 1XGNA 2BHDA 4U69A 1R5HA 4S2RP 3PKAA 5CLSA 1WL9A 2GG0A 4ZNGA 2GU6A 4IKSA 2GU5A 3IU9A 4IECA 5CE6A 1C24A 2BWWA 1WN1A 2Q92A 2NQ7A 4EGEA 2OKNA 4PV4A 1B6AA 4U6EA 2GG8A 1W2MA 3BITA 1WLRA 3CTZA 3IU7A 4FUKA 4IKUA 2B3HA 4U71A 2OAZA 2HOWA 5CDVA 2EA2A 1XGOA 2NQ6A 3FMQA 4PNCA 4U6JA 4U6WA 1CHMA 2Q8KA 5JFRA 4FO7A 2BWYA 4FLLA 3BIQA 4ZWPA 1QXYA 1QZYA 3IL0A 3MR1A 5D6FA 1BN5A 2BWSA 1WBQA 3Q6DA 1YJ3A 3OOOA 3PN9A 5FCHA 2B3KA 4U1BA 2IW2A 1XGMA 4FKCA 4R60A 5JHUA 3TAVA 2GG5A 1YW9A 3L7GA 4Z7MA 3PKCA 4OOKA 4U75A 2V6CA 4RGZ1 3S6BA 5JI6A 3PKBA 4IPAA 2EVMA 4U70A 2EVCA 1QXZA 2EVOA 2Q95A 5D6EA 2GG9A 4S2TP 5E2CA 2GZ5A 1R58A 1C22A 2GTXA 2Q96A 3FM3A 1A16A 1O0XA 1N51A 3MATA 2EA4A 4RZYA 4ZWUA 2GU4A 1XGSA 4B28A 2P99A 2GG7A 2BWTA 3MX6A 4ZWOA 2GA2A 1XNZA 2BWUA 5CNXA 1YW8A 4FLKA 4IF7A 4QR8A 1MATA 4IKTA 3QOCA 1PV9A 1YW7A 2BWXA 3IG4A 2B3LA 1W7VA 2GG3A 2MATA 2G6PA 1KQ0A 5CDLA 2BHCA 4FO8A 1C21A 3TB5A 3I7MA 5E5BA 4U73A 1B59A 4RZZA 5CIKA 2BB7A 4IU6A 3FMRA 3PKEA 2Q94A 5FCFA 2P98A 1M35A 4A6VA 1C27A 1QXWA 1Y1NA 2GU7A 4HXXA 3CB5A 3CB6A 3BIPA 1KQ9A 2BH3A 3PKDA 4U6ZA 1R5GA 4FLIA 1KP0A 4MATA 4A6WA 5CDEA 3RORA 1WKMA 2V3ZA 2V3YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WL6 A;  2V3X A;  4U76 A;  2GGC A;  3PEB A;  4S01 A;  4S00 A;  4IKR A;  4JUQ A;  2GG2 A;  3RVA A;  4IDY A;  2BN7 A;  3IU8 A;  1JAW A;  1BOA A;  2ZSG A;  2Q93 A;  1C23 A;  1WY2 A;  2P9A A;  3OVK A;  1YVM A;  3O5V A;  3L24 A;  2BWV A;  4FLJ A;  2BHB A;  2ADU A;  4KM3 A;  2BHA A;  2DFI A;  2GGB A;  3D27 A;  4U6C A;  1XGN A;  2BHD A;  4U69 A;  1R5H A;  4S2R P;  3PKA A;  5CLS A;  1WL9 A;  2GG0 A;  4ZNG A;  2GU6 A;  4IKS A;  2GU5 A;  3IU9 A;  4IEC A;  5CE6 A;  1C24 A;  2BWW A;  1WN1 A;  2Q92 A;  2NQ7 A;  4EGE A;  2OKN A;  4PV4 A;  1B6A A;  4U6E A;  2GG8 A;  1W2M A;  3BIT A;  1WLR A;  3CTZ A;  3IU7 A;  4FUK A;  4IKU A;  2B3H A;  4U71 A;  2OAZ A;  2HOW A;  5CDV A;  2EA2 A;  1XGO A;  2NQ6 A;  3FMQ A;  4PNC A;  4U6J A;  4U6W A;  1CHM A;  2Q8K A;  5JFR A;  4FO7 A;  2BWY A;  4FLL A;  3BIQ A;  4ZWP A;  1QXY A;  1QZY A;  3IL0 A;  3MR1 A;  5D6F A;  1BN5 A;  2BWS A;  1WBQ A;  3Q6D A;  1YJ3 A;  3OOO A;  3PN9 A;  5FCH A;  2B3K A;  4U1B A;  2IW2 A;  1XGM A;  4FKC A;  4R60 A;  5JHU A;  3TAV A;  2GG5 A;  1YW9 A;  3L7G A;  4Z7M A;  3PKC A;  4OOK A;  4U75 A;  2V6C A;  4RGZ 1;  3S6B A;  5JI6 A;  3PKB A;  4IPA A;  2EVM A;  4U70 A;  2EVC A;  1QXZ A;  2EVO A;  2Q95 A;  5D6E A;  2GG9 A;  4S2T P;  5E2C A;  2GZ5 A;  1R58 A;  1C22 A;  2GTX A;  2Q96 A;  3FM3 A;  1A16 A;  1O0X A;  1N51 A;  3MAT A;  2EA4 A;  4RZY A;  4ZWU A;  2GU4 A;  1XGS A;  4B28 A;  2P99 A;  2GG7 A;  2BWT A;  3MX6 A;  4ZWO A;  2GA2 A;  1XNZ A;  2BWU A;  5CNX A;  1YW8 A;  4FLK A;  4IF7 A;  4QR8 A;  1MAT A;  4IKT A;  3QOC A;  1PV9 A;  1YW7 A;  2BWX A;  3IG4 A;  2B3L A;  1W7V A;  2GG3 A;  2MAT A;  2G6P A;  1KQ0 A;  5CDL A;  2BHC A;  4FO8 A;  1C21 A;  3TB5 A;  3I7M A;  5E5B A;  4U73 A;  1B59 A;  4RZZ A;  5CIK A;  2BB7 A;  4IU6 A;  3FMR A;  3PKE A;  2Q94 A;  5FCF A;  2P98 A;  1M35 A;  4A6V A;  1C27 A;  1QXW A;  1Y1N A;  2GU7 A;  4HXX A;  3CB5 A;  3CB6 A;  3BIP A;  1KQ9 A;  2BH3 A;  3PKD A;  4U6Z A;  1R5G A;  4FLI A;  1KP0 A;  4MAT A;  4A6W A;  5CDE A;  3ROR A;  1WKM A;  2V3Z A;  2V3Y A; 
#chains in the Genus database with same CATH topology
 1WL6 A;  2V3X A;  4U76 A;  2GGC A;  3PEB A;  4S01 A;  4S00 A;  4IKR A;  4JUQ A;  2GG2 A;  3RVA A;  4IDY A;  2BN7 A;  3IU8 A;  1JAW A;  1BOA A;  2ZSG A;  2Q93 A;  1C23 A;  1WY2 A;  2P9A A;  3OVK A;  1YVM A;  3O5V A;  3L24 A;  2BWV A;  4FLJ A;  2BHB A;  2ADU A;  4KM3 A;  2BHA A;  2DFI A;  2GGB A;  3D27 A;  4U6C A;  1XGN A;  2BHD A;  4U69 A;  1R5H A;  4S2R P;  3PKA A;  5CLS A;  1WL9 A;  2GG0 A;  4ZNG A;  2GU6 A;  4IKS A;  2GU5 A;  3IU9 A;  4IEC A;  5CE6 A;  1C24 A;  2BWW A;  1WN1 A;  2Q92 A;  2NQ7 A;  4EGE A;  2OKN A;  4PV4 A;  1B6A A;  4U6E A;  2GG8 A;  1W2M A;  3BIT A;  1WLR A;  3CTZ A;  3IU7 A;  4FUK A;  4IKU A;  2B3H A;  4U71 A;  2OAZ A;  2HOW A;  5CDV A;  2EA2 A;  1XGO A;  2NQ6 A;  3FMQ A;  4PNC A;  4U6J A;  4U6W A;  1CHM A;  2Q8K A;  5JFR A;  4FO7 A;  2BWY A;  4FLL A;  3BIQ A;  4ZWP A;  1QXY A;  1QZY A;  3IL0 A;  3MR1 A;  5D6F A;  1BN5 A;  2BWS A;  1WBQ A;  3Q6D A;  1YJ3 A;  3OOO A;  3PN9 A;  5FCH A;  2B3K A;  4U1B A;  2IW2 A;  1XGM A;  4FKC A;  4R60 A;  5JHU A;  3TAV A;  2GG5 A;  1YW9 A;  3L7G A;  4Z7M A;  3PKC A;  4OOK A;  4U75 A;  2V6C A;  4RGZ 1;  3S6B A;  5JI6 A;  3PKB A;  4IPA A;  2EVM A;  4U70 A;  2EVC A;  1QXZ A;  2EVO A;  2Q95 A;  5D6E A;  2GG9 A;  4S2T P;  5E2C A;  2GZ5 A;  1R58 A;  1C22 A;  2GTX A;  2Q96 A;  3FM3 A;  1A16 A;  1O0X A;  1N51 A;  3MAT A;  2EA4 A;  4RZY A;  4ZWU A;  2GU4 A;  1XGS A;  4B28 A;  2P99 A;  2GG7 A;  2BWT A;  3MX6 A;  4ZWO A;  2GA2 A;  1XNZ A;  2BWU A;  5CNX A;  1YW8 A;  4FLK A;  4IF7 A;  4QR8 A;  1MAT A;  4IKT A;  3QOC A;  1PV9 A;  1YW7 A;  2BWX A;  3IG4 A;  2B3L A;  1W7V A;  2GG3 A;  2MAT A;  2G6P A;  1KQ0 A;  5CDL A;  2BHC A;  4FO8 A;  1C21 A;  3TB5 A;  3I7M A;  5E5B A;  4U73 A;  1B59 A;  4RZZ A;  5CIK A;  2BB7 A;  4IU6 A;  3FMR A;  3PKE A;  2Q94 A;  5FCF A;  2P98 A;  1M35 A;  4A6V A;  1C27 A;  1QXW A;  1Y1N A;  2GU7 A;  4HXX A;  3CB5 A;  3CB6 A;  3BIP A;  1KQ9 A;  2BH3 A;  3PKD A;  4U6Z A;  1R5G A;  4FLI A;  1KP0 A;  4MAT A;  4A6W A;  5CDE A;  3ROR A;  1WKM A;  2V3Z A;  2V3Y A; 
#chains in the Genus database with same CATH homology
 1WL6 A;  2V3X A;  4U76 A;  2GGC A;  3PEB A;  4S01 A;  4S00 A;  4IKR A;  4JUQ A;  2GG2 A;  3RVA A;  4IDY A;  2BN7 A;  3IU8 A;  1JAW A;  1BOA A;  2ZSG A;  2Q93 A;  1C23 A;  1WY2 A;  2P9A A;  3OVK A;  1YVM A;  3O5V A;  3L24 A;  2BWV A;  4FLJ A;  2BHB A;  2ADU A;  4KM3 A;  2BHA A;  2DFI A;  2GGB A;  3D27 A;  4U6C A;  1XGN A;  2BHD A;  4U69 A;  1R5H A;  4S2R P;  3PKA A;  5CLS A;  1WL9 A;  2GG0 A;  4ZNG A;  2GU6 A;  4IKS A;  2GU5 A;  3IU9 A;  4IEC A;  5CE6 A;  1C24 A;  2BWW A;  1WN1 A;  2Q92 A;  2NQ7 A;  4EGE A;  2OKN A;  4PV4 A;  1B6A A;  4U6E A;  2GG8 A;  1W2M A;  3BIT A;  1WLR A;  3CTZ A;  3IU7 A;  4FUK A;  4IKU A;  2B3H A;  4U71 A;  2OAZ A;  2HOW A;  5CDV A;  2EA2 A;  1XGO A;  2NQ6 A;  3FMQ A;  4PNC A;  4U6J A;  4U6W A;  1CHM A;  2Q8K A;  5JFR A;  4FO7 A;  2BWY A;  4FLL A;  3BIQ A;  4ZWP A;  1QXY A;  1QZY A;  3IL0 A;  3MR1 A;  5D6F A;  1BN5 A;  2BWS A;  1WBQ A;  3Q6D A;  1YJ3 A;  3OOO A;  3PN9 A;  5FCH A;  2B3K A;  4U1B A;  2IW2 A;  1XGM A;  4FKC A;  4R60 A;  5JHU A;  3TAV A;  2GG5 A;  1YW9 A;  3L7G A;  4Z7M A;  3PKC A;  4OOK A;  4U75 A;  2V6C A;  4RGZ 1;  3S6B A;  5JI6 A;  3PKB A;  4IPA A;  2EVM A;  4U70 A;  2EVC A;  1QXZ A;  2EVO A;  2Q95 A;  5D6E A;  2GG9 A;  4S2T P;  5E2C A;  2GZ5 A;  1R58 A;  1C22 A;  2GTX A;  2Q96 A;  3FM3 A;  1A16 A;  1O0X A;  1N51 A;  3MAT A;  2EA4 A;  4RZY A;  4ZWU A;  2GU4 A;  1XGS A;  4B28 A;  2P99 A;  2GG7 A;  2BWT A;  3MX6 A;  4ZWO A;  2GA2 A;  1XNZ A;  2BWU A;  5CNX A;  1YW8 A;  4FLK A;  4IF7 A;  4QR8 A;  1MAT A;  4IKT A;  3QOC A;  1PV9 A;  1YW7 A;  2BWX A;  3IG4 A;  2B3L A;  1W7V A;  2GG3 A;  2MAT A;  2G6P A;  1KQ0 A;  5CDL A;  2BHC A;  4FO8 A;  1C21 A;  3TB5 A;  3I7M A;  5E5B A;  4U73 A;  1B59 A;  4RZZ A;  5CIK A;  2BB7 A;  4IU6 A;  3FMR A;  3PKE A;  2Q94 A;  5FCF A;  2P98 A;  1M35 A;  4A6V A;  1C27 A;  1QXW A;  1Y1N A;  2GU7 A;  4HXX A;  3CB5 A;  3CB6 A;  3BIP A;  1KQ9 A;  2BH3 A;  3PKD A;  4U6Z A;  1R5G A;  4FLI A;  1KP0 A;  4MAT A;  4A6W A;  5CDE A;  3ROR A;  1WKM A;  2V3Z A;  2V3Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...