2V3ZA

Glu383ala escherichia coli aminopeptidase p in complex with substrate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVAPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3zA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3zA02
4KM3A 3OOOA 3PN9A 1Y1NA 2ADUA 4FO7A 1WL9A 4S2TP 4B28A 3D27A 3IU9A 2GZ5A 4U69A 4FLIA 3CTZA 3MX6A 4IDYA 4IF7A 1WLRA 3FMRA 4FLLA 5JHUA 3IU7A 3RVAA 3TB5A 2NQ7A 1R5HA 1PV9A 2GU7A 2EVMA 2GG5A 1BOAA 4HXXA 3RORA 5CDLA 2GG9A 5FCHA 2Q94A 1W7VA 2DFIA 4OOKA 3PEBA 1QXYA 3FM3A 4FUKA 1C24A 4S00A 2BWXA 1C22A 1YW7A 2EA4A 2EVOA 2Q95A 2Q8KA 1WBQA 2BHAA 4U70A 2HOWA 3IL0A 3MATA 3BITA 2GU5A 1W2MA 1WL6A 4S2RP 2GU6A 2V6CA 3OVKA 4R60A 4RZZA 4PV4A 2Q92A 3L7GA 1R58A 3BIPA 4U6WA 4U76A 1XGOA 5CNXA 5CE6A 2GTXA 1C21A 4U75A 4ZWUA 2GG2A 2GG7A 4FO8A 1M35A 2OKNA 2BB7A 1YW8A 1CHMA 1B6AA 2P9AA 4PNCA 4IECA 3L24A 1MATA 1XGMA 2V3XA 4ZWOA 5JI6A 1XGNA 1YW9A 3TAVA 4A6VA 1JAWA 1KP0A 1QZYA 3PKCA 4ZNGA 1N51A 1WN1A 2BWTA 4QR8A 1QXZA 2Q96A 5CLSA 2EVCA 2GG8A 4EGEA 2OAZA 4U71A 2P98A 2BH3A 2P99A 3PKAA 1O0XA 2V3ZA 1YVMA 1KQ9A 3IG4A 3QOCA 4IU6A 3FMQA 1XGSA 2GG3A 2ZSGA 4IKRA 5E5BA 3BIQA 4A6WA 2BWYA 3IU8A 1R5GA 4U6CA 2GU4A 5CIKA 1WY2A 3CB6A 5CDEA 5E2CA 2GA2A 4IKSA 4U6EA 5D6FA 1C27A 2BWWA 4U73A 1QXWA 4IKTA 2BWUA 2G6PA 1XNZA 2IW2A 5FCFA 4IKUA 4U1BA 2V3YA 2BHBA 3PKBA 3I7MA 4RGZ1 5CDVA 2GGBA 5JFRA 4JUQA 1BN5A 4MATA 1A16A 2MATA 4U6ZA 3PKDA 1YJ3A 1B59A 4ZWPA 2B3HA 3MR1A 3O5VA 3CB5A 1WKMA 2BWVA 2B3KA 5D6EA 2NQ6A 4IPAA 2BWSA 4FKCA 2BHDA 4RZYA 4S01A 2GG0A 2Q93A 1C23A 4FLJA 4FLKA 3Q6DA 2GGCA 3S6BA 2B3LA 2BHCA 3PKEA 2BN7A 2EA2A 4U6JA 4Z7MA 1KQ0A
chains in the Genus database with same CATH superfamily
4KM3A 3OOOA 3PN9A 1Y1NA 2ADUA 4FO7A 1WL9A 4S2TP 4B28A 3D27A 3IU9A 2GZ5A 4U69A 4FLIA 3CTZA 3MX6A 4IDYA 4IF7A 1WLRA 3FMRA 4FLLA 5JHUA 3IU7A 3RVAA 3TB5A 2NQ7A 1R5HA 1PV9A 2GU7A 2EVMA 2GG5A 1BOAA 4HXXA 3RORA 5CDLA 2GG9A 5FCHA 2Q94A 1W7VA 2DFIA 4OOKA 3PEBA 1QXYA 3FM3A 4FUKA 1C24A 4S00A 2BWXA 1C22A 1YW7A 2EA4A 2EVOA 2Q95A 2Q8KA 1WBQA 2BHAA 4U70A 2HOWA 3IL0A 3MATA 3BITA 2GU5A 1W2MA 1WL6A 4S2RP 2GU6A 2V6CA 3OVKA 4R60A 4RZZA 4PV4A 2Q92A 3L7GA 1R58A 3BIPA 4U6WA 4U76A 1XGOA 5CNXA 5CE6A 2GTXA 1C21A 4U75A 4ZWUA 2GG2A 2GG7A 4FO8A 1M35A 2OKNA 2BB7A 1YW8A 1CHMA 1B6AA 2P9AA 4PNCA 4IECA 3L24A 1MATA 1XGMA 2V3XA 4ZWOA 5JI6A 1XGNA 1YW9A 3TAVA 4A6VA 1JAWA 1KP0A 1QZYA 3PKCA 4ZNGA 1N51A 1WN1A 2BWTA 4QR8A 1QXZA 2Q96A 5CLSA 2EVCA 2GG8A 4EGEA 2OAZA 4U71A 2P98A 2BH3A 2P99A 3PKAA 1O0XA 2V3ZA 1YVMA 1KQ9A 3IG4A 3QOCA 4IU6A 3FMQA 1XGSA 2GG3A 2ZSGA 4IKRA 5E5BA 3BIQA 4A6WA 2BWYA 3IU8A 1R5GA 4U6CA 2GU4A 5CIKA 1WY2A 3CB6A 5CDEA 5E2CA 2GA2A 4IKSA 4U6EA 5D6FA 1C27A 2BWWA 4U73A 1QXWA 4IKTA 2BWUA 2G6PA 1XNZA 2IW2A 5FCFA 4IKUA 4U1BA 2V3YA 2BHBA 3PKBA 3I7MA 4RGZ1 5CDVA 2GGBA 5JFRA 4JUQA 1BN5A 4MATA 1A16A 2MATA 4U6ZA 3PKDA 1YJ3A 1B59A 4ZWPA 2B3HA 3MR1A 3O5VA 3CB5A 1WKMA 2BWVA 2B3KA 5D6EA 2NQ6A 4IPAA 2BWSA 4FKCA 2BHDA 4RZYA 4S01A 2GG0A 2Q93A 1C23A 4FLJA 4FLKA 3Q6DA 2GGCA 3S6BA 2B3LA 2BHCA 3PKEA 2BN7A 2EA2A 4U6JA 4Z7MA 1KQ0A
chains in the Genus database with same CATH topology
4KM3A 3OOOA 3PN9A 1Y1NA 2ADUA 4FO7A 1WL9A 4S2TP 4B28A 3D27A 3IU9A 2GZ5A 4U69A 4FLIA 3CTZA 3MX6A 4IDYA 4IF7A 1WLRA 3FMRA 4FLLA 5JHUA 3IU7A 3RVAA 3TB5A 2NQ7A 1R5HA 1PV9A 2GU7A 2EVMA 2GG5A 1BOAA 4HXXA 3RORA 5CDLA 2GG9A 5FCHA 2Q94A 1W7VA 2DFIA 4OOKA 3PEBA 1QXYA 3FM3A 4FUKA 1C24A 4S00A 2BWXA 1C22A 1YW7A 2EA4A 2EVOA 2Q95A 2Q8KA 1WBQA 2BHAA 4U70A 2HOWA 3IL0A 3MATA 3BITA 2GU5A 1W2MA 1WL6A 4S2RP 2GU6A 2V6CA 3OVKA 4R60A 4RZZA 4PV4A 2Q92A 3L7GA 1R58A 3BIPA 4U6WA 4U76A 1XGOA 5CNXA 5CE6A 2GTXA 1C21A 4U75A 4ZWUA 2GG2A 2GG7A 4FO8A 1M35A 2OKNA 2BB7A 1YW8A 1CHMA 1B6AA 2P9AA 4PNCA 4IECA 3L24A 1MATA 1XGMA 2V3XA 4ZWOA 5JI6A 1XGNA 1YW9A 3TAVA 4A6VA 1JAWA 1KP0A 1QZYA 3PKCA 4ZNGA 1N51A 1WN1A 2BWTA 4QR8A 1QXZA 2Q96A 5CLSA 2EVCA 2GG8A 4EGEA 2OAZA 4U71A 2P98A 2BH3A 2P99A 3PKAA 1O0XA 2V3ZA 1YVMA 1KQ9A 3IG4A 3QOCA 4IU6A 3FMQA 1XGSA 2GG3A 2ZSGA 4IKRA 5E5BA 3BIQA 4A6WA 2BWYA 3IU8A 1R5GA 4U6CA 2GU4A 5CIKA 1WY2A 3CB6A 5CDEA 5E2CA 2GA2A 4IKSA 4U6EA 5D6FA 1C27A 2BWWA 4U73A 1QXWA 4IKTA 2BWUA 2G6PA 1XNZA 2IW2A 5FCFA 4IKUA 4U1BA 2V3YA 2BHBA 3PKBA 3I7MA 4RGZ1 5CDVA 2GGBA 5JFRA 4JUQA 1BN5A 4MATA 1A16A 2MATA 4U6ZA 3PKDA 1YJ3A 1B59A 4ZWPA 2B3HA 3MR1A 3O5VA 3CB5A 1WKMA 2BWVA 2B3KA 5D6EA 2NQ6A 4IPAA 2BWSA 4FKCA 2BHDA 4RZYA 4S01A 2GG0A 2Q93A 1C23A 4FLJA 4FLKA 3Q6DA 2GGCA 3S6BA 2B3LA 2BHCA 3PKEA 2BN7A 2EA2A 4U6JA 4Z7MA 1KQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KM3 A;  3OOO A;  3PN9 A;  1Y1N A;  2ADU A;  4FO7 A;  1WL9 A;  4S2T P;  4B28 A;  3D27 A;  3IU9 A;  2GZ5 A;  4U69 A;  4FLI A;  3CTZ A;  3MX6 A;  4IDY A;  4IF7 A;  1WLR A;  3FMR A;  4FLL A;  5JHU A;  3IU7 A;  3RVA A;  3TB5 A;  2NQ7 A;  1R5H A;  1PV9 A;  2GU7 A;  2EVM A;  2GG5 A;  1BOA A;  4HXX A;  3ROR A;  5CDL A;  2GG9 A;  5FCH A;  2Q94 A;  1W7V A;  2DFI A;  4OOK A;  3PEB A;  1QXY A;  3FM3 A;  4FUK A;  1C24 A;  4S00 A;  2BWX A;  1C22 A;  1YW7 A;  2EA4 A;  2EVO A;  2Q95 A;  2Q8K A;  1WBQ A;  2BHA A;  4U70 A;  2HOW A;  3IL0 A;  3MAT A;  3BIT A;  2GU5 A;  1W2M A;  1WL6 A;  4S2R P;  2GU6 A;  2V6C A;  3OVK A;  4R60 A;  4RZZ A;  4PV4 A;  2Q92 A;  3L7G A;  1R58 A;  3BIP A;  4U6W A;  4U76 A;  1XGO A;  5CNX A;  5CE6 A;  2GTX A;  1C21 A;  4U75 A;  4ZWU A;  2GG2 A;  2GG7 A;  4FO8 A;  1M35 A;  2OKN A;  2BB7 A;  1YW8 A;  1CHM A;  1B6A A;  2P9A A;  4PNC A;  4IEC A;  3L24 A;  1MAT A;  1XGM A;  2V3X A;  4ZWO A;  5JI6 A;  1XGN A;  1YW9 A;  3TAV A;  4A6V A;  1JAW A;  1KP0 A;  1QZY A;  3PKC A;  4ZNG A;  1N51 A;  1WN1 A;  2BWT A;  4QR8 A;  1QXZ A;  2Q96 A;  5CLS A;  2EVC A;  2GG8 A;  4EGE A;  2OAZ A;  4U71 A;  2P98 A;  2BH3 A;  2P99 A;  3PKA A;  1O0X A;  2V3Z A;  1YVM A;  1KQ9 A;  3IG4 A;  3QOC A;  4IU6 A;  3FMQ A;  1XGS A;  2GG3 A;  2ZSG A;  4IKR A;  5E5B A;  3BIQ A;  4A6W A;  2BWY A;  3IU8 A;  1R5G A;  4U6C A;  2GU4 A;  5CIK A;  1WY2 A;  3CB6 A;  5CDE A;  5E2C A;  2GA2 A;  4IKS A;  4U6E A;  5D6F A;  1C27 A;  2BWW A;  4U73 A;  1QXW A;  4IKT A;  2BWU A;  2G6P A;  1XNZ A;  2IW2 A;  5FCF A;  4IKU A;  4U1B A;  2V3Y A;  2BHB A;  3PKB A;  3I7M A;  4RGZ 1;  5CDV A;  2GGB A;  5JFR A;  4JUQ A;  1BN5 A;  4MAT A;  1A16 A;  2MAT A;  4U6Z A;  3PKD A;  1YJ3 A;  1B59 A;  4ZWP A;  2B3H A;  3MR1 A;  3O5V A;  3CB5 A;  1WKM A;  2BWV A;  2B3K A;  5D6E A;  2NQ6 A;  4IPA A;  2BWS A;  4FKC A;  2BHD A;  4RZY A;  4S01 A;  2GG0 A;  2Q93 A;  1C23 A;  4FLJ A;  4FLK A;  3Q6D A;  2GGC A;  3S6B A;  2B3L A;  2BHC A;  3PKE A;  2BN7 A;  2EA2 A;  4U6J A;  4Z7M A;  1KQ0 A; 
#chains in the Genus database with same CATH topology
 4KM3 A;  3OOO A;  3PN9 A;  1Y1N A;  2ADU A;  4FO7 A;  1WL9 A;  4S2T P;  4B28 A;  3D27 A;  3IU9 A;  2GZ5 A;  4U69 A;  4FLI A;  3CTZ A;  3MX6 A;  4IDY A;  4IF7 A;  1WLR A;  3FMR A;  4FLL A;  5JHU A;  3IU7 A;  3RVA A;  3TB5 A;  2NQ7 A;  1R5H A;  1PV9 A;  2GU7 A;  2EVM A;  2GG5 A;  1BOA A;  4HXX A;  3ROR A;  5CDL A;  2GG9 A;  5FCH A;  2Q94 A;  1W7V A;  2DFI A;  4OOK A;  3PEB A;  1QXY A;  3FM3 A;  4FUK A;  1C24 A;  4S00 A;  2BWX A;  1C22 A;  1YW7 A;  2EA4 A;  2EVO A;  2Q95 A;  2Q8K A;  1WBQ A;  2BHA A;  4U70 A;  2HOW A;  3IL0 A;  3MAT A;  3BIT A;  2GU5 A;  1W2M A;  1WL6 A;  4S2R P;  2GU6 A;  2V6C A;  3OVK A;  4R60 A;  4RZZ A;  4PV4 A;  2Q92 A;  3L7G A;  1R58 A;  3BIP A;  4U6W A;  4U76 A;  1XGO A;  5CNX A;  5CE6 A;  2GTX A;  1C21 A;  4U75 A;  4ZWU A;  2GG2 A;  2GG7 A;  4FO8 A;  1M35 A;  2OKN A;  2BB7 A;  1YW8 A;  1CHM A;  1B6A A;  2P9A A;  4PNC A;  4IEC A;  3L24 A;  1MAT A;  1XGM A;  2V3X A;  4ZWO A;  5JI6 A;  1XGN A;  1YW9 A;  3TAV A;  4A6V A;  1JAW A;  1KP0 A;  1QZY A;  3PKC A;  4ZNG A;  1N51 A;  1WN1 A;  2BWT A;  4QR8 A;  1QXZ A;  2Q96 A;  5CLS A;  2EVC A;  2GG8 A;  4EGE A;  2OAZ A;  4U71 A;  2P98 A;  2BH3 A;  2P99 A;  3PKA A;  1O0X A;  2V3Z A;  1YVM A;  1KQ9 A;  3IG4 A;  3QOC A;  4IU6 A;  3FMQ A;  1XGS A;  2GG3 A;  2ZSG A;  4IKR A;  5E5B A;  3BIQ A;  4A6W A;  2BWY A;  3IU8 A;  1R5G A;  4U6C A;  2GU4 A;  5CIK A;  1WY2 A;  3CB6 A;  5CDE A;  5E2C A;  2GA2 A;  4IKS A;  4U6E A;  5D6F A;  1C27 A;  2BWW A;  4U73 A;  1QXW A;  4IKT A;  2BWU A;  2G6P A;  1XNZ A;  2IW2 A;  5FCF A;  4IKU A;  4U1B A;  2V3Y A;  2BHB A;  3PKB A;  3I7M A;  4RGZ 1;  5CDV A;  2GGB A;  5JFR A;  4JUQ A;  1BN5 A;  4MAT A;  1A16 A;  2MAT A;  4U6Z A;  3PKD A;  1YJ3 A;  1B59 A;  4ZWP A;  2B3H A;  3MR1 A;  3O5V A;  3CB5 A;  1WKM A;  2BWV A;  2B3K A;  5D6E A;  2NQ6 A;  4IPA A;  2BWS A;  4FKC A;  2BHD A;  4RZY A;  4S01 A;  2GG0 A;  2Q93 A;  1C23 A;  4FLJ A;  4FLK A;  3Q6D A;  2GGC A;  3S6B A;  2B3L A;  2BHC A;  3PKE A;  2BN7 A;  2EA2 A;  4U6J A;  4Z7M A;  1KQ0 A; 
#chains in the Genus database with same CATH homology
 4KM3 A;  3OOO A;  3PN9 A;  1Y1N A;  2ADU A;  4FO7 A;  1WL9 A;  4S2T P;  4B28 A;  3D27 A;  3IU9 A;  2GZ5 A;  4U69 A;  4FLI A;  3CTZ A;  3MX6 A;  4IDY A;  4IF7 A;  1WLR A;  3FMR A;  4FLL A;  5JHU A;  3IU7 A;  3RVA A;  3TB5 A;  2NQ7 A;  1R5H A;  1PV9 A;  2GU7 A;  2EVM A;  2GG5 A;  1BOA A;  4HXX A;  3ROR A;  5CDL A;  2GG9 A;  5FCH A;  2Q94 A;  1W7V A;  2DFI A;  4OOK A;  3PEB A;  1QXY A;  3FM3 A;  4FUK A;  1C24 A;  4S00 A;  2BWX A;  1C22 A;  1YW7 A;  2EA4 A;  2EVO A;  2Q95 A;  2Q8K A;  1WBQ A;  2BHA A;  4U70 A;  2HOW A;  3IL0 A;  3MAT A;  3BIT A;  2GU5 A;  1W2M A;  1WL6 A;  4S2R P;  2GU6 A;  2V6C A;  3OVK A;  4R60 A;  4RZZ A;  4PV4 A;  2Q92 A;  3L7G A;  1R58 A;  3BIP A;  4U6W A;  4U76 A;  1XGO A;  5CNX A;  5CE6 A;  2GTX A;  1C21 A;  4U75 A;  4ZWU A;  2GG2 A;  2GG7 A;  4FO8 A;  1M35 A;  2OKN A;  2BB7 A;  1YW8 A;  1CHM A;  1B6A A;  2P9A A;  4PNC A;  4IEC A;  3L24 A;  1MAT A;  1XGM A;  2V3X A;  4ZWO A;  5JI6 A;  1XGN A;  1YW9 A;  3TAV A;  4A6V A;  1JAW A;  1KP0 A;  1QZY A;  3PKC A;  4ZNG A;  1N51 A;  1WN1 A;  2BWT A;  4QR8 A;  1QXZ A;  2Q96 A;  5CLS A;  2EVC A;  2GG8 A;  4EGE A;  2OAZ A;  4U71 A;  2P98 A;  2BH3 A;  2P99 A;  3PKA A;  1O0X A;  2V3Z A;  1YVM A;  1KQ9 A;  3IG4 A;  3QOC A;  4IU6 A;  3FMQ A;  1XGS A;  2GG3 A;  2ZSG A;  4IKR A;  5E5B A;  3BIQ A;  4A6W A;  2BWY A;  3IU8 A;  1R5G A;  4U6C A;  2GU4 A;  5CIK A;  1WY2 A;  3CB6 A;  5CDE A;  5E2C A;  2GA2 A;  4IKS A;  4U6E A;  5D6F A;  1C27 A;  2BWW A;  4U73 A;  1QXW A;  4IKT A;  2BWU A;  2G6P A;  1XNZ A;  2IW2 A;  5FCF A;  4IKU A;  4U1B A;  2V3Y A;  2BHB A;  3PKB A;  3I7M A;  4RGZ 1;  5CDV A;  2GGB A;  5JFR A;  4JUQ A;  1BN5 A;  4MAT A;  1A16 A;  2MAT A;  4U6Z A;  3PKD A;  1YJ3 A;  1B59 A;  4ZWP A;  2B3H A;  3MR1 A;  3O5V A;  3CB5 A;  1WKM A;  2BWV A;  2B3K A;  5D6E A;  2NQ6 A;  4IPA A;  2BWS A;  4FKC A;  2BHD A;  4RZY A;  4S01 A;  2GG0 A;  2Q93 A;  1C23 A;  4FLJ A;  4FLK A;  3Q6D A;  2GGC A;  3S6B A;  2B3L A;  2BHC A;  3PKE A;  2BN7 A;  2EA2 A;  4U6J A;  4Z7M A;  1KQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...