2V3ZA

Glu383ala escherichia coli aminopeptidase p in complex with substrate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVAPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3zA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3zA02
2ADUA 4IU6A 1B6AA 3CTZA 1C23A 3PN9A 3PKBA 4U6WA 3RORA 3PKDA 3L24A 4FUKA 3CB6A 1R5GA 5CDEA 1O0XA 2EVCA 2G6PA 3TB5A 2BWSA 1N51A 2BWWA 1XGOA 3PKEA 4RGZ1 1YVMA 2BHDA 5E2CA 1BN5A 4U6JA 4RZZA 4FLKA 1WN1A 3O5VA 3Q6DA 2GG0A 1BOAA 4S2RP 2NQ6A 5JFRA 3PEBA 3IU7A 1YJ3A 4A6WA 2BHAA 4IDYA 1JAWA 3FMRA 2BHCA 4A6VA 3IG4A 4U73A 1WLRA 3D27A 2HOWA 5E5BA 2ZSGA 1XGNA 1QXYA 1XNZA 2P98A 2Q93A 3OOOA 5CNXA 2GGBA 2DFIA 2V3YA 2BWUA 4B28A 4ZNGA 3BITA 1XGSA 1YW7A 3PKAA 4IF7A 2BB7A 1XGMA 2OAZA 2GG9A 4ZWPA 4U70A 4EGEA 1C22A 2Q8KA 4IKSA 1WL9A 2V3XA 4U1BA 2B3KA 2GG7A 4FLJA 4U69A 3L7GA 4Z7MA 2BH3A 1B59A 4MATA 4FLLA 3PKCA 3IU9A 5JHUA 1PV9A 5CIKA 1WL6A 1MATA 2EVOA 2GG2A 4IECA 1A16A 5CDLA 4HXXA 2B3HA 1M35A 3I7MA 4U6EA 5FCHA 1YW9A 4S01A 3TAVA 2GU5A 2BWVA 1WKMA 2GU6A 1KQ0A 3MX6A 5FCFA 5CLSA 2Q95A 2BWXA 1Y1NA 2P9AA 1WBQA 3FM3A 2GGCA 3OVKA 2GG8A 1W7VA 3IL0A 1C24A 2GG5A 4JUQA 2Q92A 2EA2A 2BHBA 2EVMA 2GZ5A 1CHMA 2GG3A 4U76A 5D6EA 4ZWOA 3BIPA 4FO8A 4S00A 2V3ZA 2B3LA 3RVAA 5CDVA 3MR1A 4U6CA 1R58A 1W2MA 4ZWUA 2P99A 3CB5A 4S2TP 4IKUA 4U71A 4R60A 1QXZA 1R5HA 2Q96A 2IW2A 1C27A 3FMQA 5CE6A 4OOKA 3IU8A 4QR8A 5JI6A 1QXWA 4U6ZA 2Q94A 4FKCA 5D6FA 2EA4A 4IKRA 4IKTA 2V6CA 4KM3A 4FO7A 4FLIA 1WY2A 2OKNA 1YW8A 3QOCA 3MATA 3BIQA 2GTXA 1C21A 4PNCA 2MATA 4PV4A 4U75A 2GU4A 2NQ7A 2BN7A 1KP0A 4IPAA 2BWTA 1KQ9A 3S6BA 2GA2A 2GU7A 4RZYA 1QZYA 2BWYA
chains in the Genus database with same CATH superfamily
2ADUA 4IU6A 1B6AA 3CTZA 1C23A 3PN9A 3PKBA 4U6WA 3RORA 3PKDA 3L24A 4FUKA 3CB6A 1R5GA 5CDEA 1O0XA 2EVCA 2G6PA 3TB5A 2BWSA 1N51A 2BWWA 1XGOA 3PKEA 4RGZ1 1YVMA 2BHDA 5E2CA 1BN5A 4U6JA 4RZZA 4FLKA 1WN1A 3O5VA 3Q6DA 2GG0A 1BOAA 4S2RP 2NQ6A 5JFRA 3PEBA 3IU7A 1YJ3A 4A6WA 2BHAA 4IDYA 1JAWA 3FMRA 2BHCA 4A6VA 3IG4A 4U73A 1WLRA 3D27A 2HOWA 5E5BA 2ZSGA 1XGNA 1QXYA 1XNZA 2P98A 2Q93A 3OOOA 5CNXA 2GGBA 2DFIA 2V3YA 2BWUA 4B28A 4ZNGA 3BITA 1XGSA 1YW7A 3PKAA 4IF7A 2BB7A 1XGMA 2OAZA 2GG9A 4ZWPA 4U70A 4EGEA 1C22A 2Q8KA 4IKSA 1WL9A 2V3XA 4U1BA 2B3KA 2GG7A 4FLJA 4U69A 3L7GA 4Z7MA 2BH3A 1B59A 4MATA 4FLLA 3PKCA 3IU9A 5JHUA 1PV9A 5CIKA 1WL6A 1MATA 2EVOA 2GG2A 4IECA 1A16A 5CDLA 4HXXA 2B3HA 1M35A 3I7MA 4U6EA 5FCHA 1YW9A 4S01A 3TAVA 2GU5A 2BWVA 1WKMA 2GU6A 1KQ0A 3MX6A 5FCFA 5CLSA 2Q95A 2BWXA 1Y1NA 2P9AA 1WBQA 3FM3A 2GGCA 3OVKA 2GG8A 1W7VA 3IL0A 1C24A 2GG5A 4JUQA 2Q92A 2EA2A 2BHBA 2EVMA 2GZ5A 1CHMA 2GG3A 4U76A 5D6EA 4ZWOA 3BIPA 4FO8A 4S00A 2V3ZA 2B3LA 3RVAA 5CDVA 3MR1A 4U6CA 1R58A 1W2MA 4ZWUA 2P99A 3CB5A 4S2TP 4IKUA 4U71A 4R60A 1QXZA 1R5HA 2Q96A 2IW2A 1C27A 3FMQA 5CE6A 4OOKA 3IU8A 4QR8A 5JI6A 1QXWA 4U6ZA 2Q94A 4FKCA 5D6FA 2EA4A 4IKRA 4IKTA 2V6CA 4KM3A 4FO7A 4FLIA 1WY2A 2OKNA 1YW8A 3QOCA 3MATA 3BIQA 2GTXA 1C21A 4PNCA 2MATA 4PV4A 4U75A 2GU4A 2NQ7A 2BN7A 1KP0A 4IPAA 2BWTA 1KQ9A 3S6BA 2GA2A 2GU7A 4RZYA 1QZYA 2BWYA
chains in the Genus database with same CATH topology
2ADUA 4IU6A 1B6AA 3CTZA 1C23A 3PN9A 3PKBA 4U6WA 3RORA 3PKDA 3L24A 4FUKA 3CB6A 1R5GA 5CDEA 1O0XA 2EVCA 2G6PA 3TB5A 2BWSA 1N51A 2BWWA 1XGOA 3PKEA 4RGZ1 1YVMA 2BHDA 5E2CA 1BN5A 4U6JA 4RZZA 4FLKA 1WN1A 3O5VA 3Q6DA 2GG0A 1BOAA 4S2RP 2NQ6A 5JFRA 3PEBA 3IU7A 1YJ3A 4A6WA 2BHAA 4IDYA 1JAWA 3FMRA 2BHCA 4A6VA 3IG4A 4U73A 1WLRA 3D27A 2HOWA 5E5BA 2ZSGA 1XGNA 1QXYA 1XNZA 2P98A 2Q93A 3OOOA 5CNXA 2GGBA 2DFIA 2V3YA 2BWUA 4B28A 4ZNGA 3BITA 1XGSA 1YW7A 3PKAA 4IF7A 2BB7A 1XGMA 2OAZA 2GG9A 4ZWPA 4U70A 4EGEA 1C22A 2Q8KA 4IKSA 1WL9A 2V3XA 4U1BA 2B3KA 2GG7A 4FLJA 4U69A 3L7GA 4Z7MA 2BH3A 1B59A 4MATA 4FLLA 3PKCA 3IU9A 5JHUA 1PV9A 5CIKA 1WL6A 1MATA 2EVOA 2GG2A 4IECA 1A16A 5CDLA 4HXXA 2B3HA 1M35A 3I7MA 4U6EA 5FCHA 1YW9A 4S01A 3TAVA 2GU5A 2BWVA 1WKMA 2GU6A 1KQ0A 3MX6A 5FCFA 5CLSA 2Q95A 2BWXA 1Y1NA 2P9AA 1WBQA 3FM3A 2GGCA 3OVKA 2GG8A 1W7VA 3IL0A 1C24A 2GG5A 4JUQA 2Q92A 2EA2A 2BHBA 2EVMA 2GZ5A 1CHMA 2GG3A 4U76A 5D6EA 4ZWOA 3BIPA 4FO8A 4S00A 2V3ZA 2B3LA 3RVAA 5CDVA 3MR1A 4U6CA 1R58A 1W2MA 4ZWUA 2P99A 3CB5A 4S2TP 4IKUA 4U71A 4R60A 1QXZA 1R5HA 2Q96A 2IW2A 1C27A 3FMQA 5CE6A 4OOKA 3IU8A 4QR8A 5JI6A 1QXWA 4U6ZA 2Q94A 4FKCA 5D6FA 2EA4A 4IKRA 4IKTA 2V6CA 4KM3A 4FO7A 4FLIA 1WY2A 2OKNA 1YW8A 3QOCA 3MATA 3BIQA 2GTXA 1C21A 4PNCA 2MATA 4PV4A 4U75A 2GU4A 2NQ7A 2BN7A 1KP0A 4IPAA 2BWTA 1KQ9A 3S6BA 2GA2A 2GU7A 4RZYA 1QZYA 2BWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ADU A;  4IU6 A;  1B6A A;  3CTZ A;  1C23 A;  3PN9 A;  3PKB A;  4U6W A;  3ROR A;  3PKD A;  3L24 A;  4FUK A;  3CB6 A;  1R5G A;  5CDE A;  1O0X A;  2EVC A;  2G6P A;  3TB5 A;  2BWS A;  1N51 A;  2BWW A;  1XGO A;  3PKE A;  4RGZ 1;  1YVM A;  2BHD A;  5E2C A;  1BN5 A;  4U6J A;  4RZZ A;  4FLK A;  1WN1 A;  3O5V A;  3Q6D A;  2GG0 A;  1BOA A;  4S2R P;  2NQ6 A;  5JFR A;  3PEB A;  3IU7 A;  1YJ3 A;  4A6W A;  2BHA A;  4IDY A;  1JAW A;  3FMR A;  2BHC A;  4A6V A;  3IG4 A;  4U73 A;  1WLR A;  3D27 A;  2HOW A;  5E5B A;  2ZSG A;  1XGN A;  1QXY A;  1XNZ A;  2P98 A;  2Q93 A;  3OOO A;  5CNX A;  2GGB A;  2DFI A;  2V3Y A;  2BWU A;  4B28 A;  4ZNG A;  3BIT A;  1XGS A;  1YW7 A;  3PKA A;  4IF7 A;  2BB7 A;  1XGM A;  2OAZ A;  2GG9 A;  4ZWP A;  4U70 A;  4EGE A;  1C22 A;  2Q8K A;  4IKS A;  1WL9 A;  2V3X A;  4U1B A;  2B3K A;  2GG7 A;  4FLJ A;  4U69 A;  3L7G A;  4Z7M A;  2BH3 A;  1B59 A;  4MAT A;  4FLL A;  3PKC A;  3IU9 A;  5JHU A;  1PV9 A;  5CIK A;  1WL6 A;  1MAT A;  2EVO A;  2GG2 A;  4IEC A;  1A16 A;  5CDL A;  4HXX A;  2B3H A;  1M35 A;  3I7M A;  4U6E A;  5FCH A;  1YW9 A;  4S01 A;  3TAV A;  2GU5 A;  2BWV A;  1WKM A;  2GU6 A;  1KQ0 A;  3MX6 A;  5FCF A;  5CLS A;  2Q95 A;  2BWX A;  1Y1N A;  2P9A A;  1WBQ A;  3FM3 A;  2GGC A;  3OVK A;  2GG8 A;  1W7V A;  3IL0 A;  1C24 A;  2GG5 A;  4JUQ A;  2Q92 A;  2EA2 A;  2BHB A;  2EVM A;  2GZ5 A;  1CHM A;  2GG3 A;  4U76 A;  5D6E A;  4ZWO A;  3BIP A;  4FO8 A;  4S00 A;  2V3Z A;  2B3L A;  3RVA A;  5CDV A;  3MR1 A;  4U6C A;  1R58 A;  1W2M A;  4ZWU A;  2P99 A;  3CB5 A;  4S2T P;  4IKU A;  4U71 A;  4R60 A;  1QXZ A;  1R5H A;  2Q96 A;  2IW2 A;  1C27 A;  3FMQ A;  5CE6 A;  4OOK A;  3IU8 A;  4QR8 A;  5JI6 A;  1QXW A;  4U6Z A;  2Q94 A;  4FKC A;  5D6F A;  2EA4 A;  4IKR A;  4IKT A;  2V6C A;  4KM3 A;  4FO7 A;  4FLI A;  1WY2 A;  2OKN A;  1YW8 A;  3QOC A;  3MAT A;  3BIQ A;  2GTX A;  1C21 A;  4PNC A;  2MAT A;  4PV4 A;  4U75 A;  2GU4 A;  2NQ7 A;  2BN7 A;  1KP0 A;  4IPA A;  2BWT A;  1KQ9 A;  3S6B A;  2GA2 A;  2GU7 A;  4RZY A;  1QZY A;  2BWY A; 
#chains in the Genus database with same CATH topology
 2ADU A;  4IU6 A;  1B6A A;  3CTZ A;  1C23 A;  3PN9 A;  3PKB A;  4U6W A;  3ROR A;  3PKD A;  3L24 A;  4FUK A;  3CB6 A;  1R5G A;  5CDE A;  1O0X A;  2EVC A;  2G6P A;  3TB5 A;  2BWS A;  1N51 A;  2BWW A;  1XGO A;  3PKE A;  4RGZ 1;  1YVM A;  2BHD A;  5E2C A;  1BN5 A;  4U6J A;  4RZZ A;  4FLK A;  1WN1 A;  3O5V A;  3Q6D A;  2GG0 A;  1BOA A;  4S2R P;  2NQ6 A;  5JFR A;  3PEB A;  3IU7 A;  1YJ3 A;  4A6W A;  2BHA A;  4IDY A;  1JAW A;  3FMR A;  2BHC A;  4A6V A;  3IG4 A;  4U73 A;  1WLR A;  3D27 A;  2HOW A;  5E5B A;  2ZSG A;  1XGN A;  1QXY A;  1XNZ A;  2P98 A;  2Q93 A;  3OOO A;  5CNX A;  2GGB A;  2DFI A;  2V3Y A;  2BWU A;  4B28 A;  4ZNG A;  3BIT A;  1XGS A;  1YW7 A;  3PKA A;  4IF7 A;  2BB7 A;  1XGM A;  2OAZ A;  2GG9 A;  4ZWP A;  4U70 A;  4EGE A;  1C22 A;  2Q8K A;  4IKS A;  1WL9 A;  2V3X A;  4U1B A;  2B3K A;  2GG7 A;  4FLJ A;  4U69 A;  3L7G A;  4Z7M A;  2BH3 A;  1B59 A;  4MAT A;  4FLL A;  3PKC A;  3IU9 A;  5JHU A;  1PV9 A;  5CIK A;  1WL6 A;  1MAT A;  2EVO A;  2GG2 A;  4IEC A;  1A16 A;  5CDL A;  4HXX A;  2B3H A;  1M35 A;  3I7M A;  4U6E A;  5FCH A;  1YW9 A;  4S01 A;  3TAV A;  2GU5 A;  2BWV A;  1WKM A;  2GU6 A;  1KQ0 A;  3MX6 A;  5FCF A;  5CLS A;  2Q95 A;  2BWX A;  1Y1N A;  2P9A A;  1WBQ A;  3FM3 A;  2GGC A;  3OVK A;  2GG8 A;  1W7V A;  3IL0 A;  1C24 A;  2GG5 A;  4JUQ A;  2Q92 A;  2EA2 A;  2BHB A;  2EVM A;  2GZ5 A;  1CHM A;  2GG3 A;  4U76 A;  5D6E A;  4ZWO A;  3BIP A;  4FO8 A;  4S00 A;  2V3Z A;  2B3L A;  3RVA A;  5CDV A;  3MR1 A;  4U6C A;  1R58 A;  1W2M A;  4ZWU A;  2P99 A;  3CB5 A;  4S2T P;  4IKU A;  4U71 A;  4R60 A;  1QXZ A;  1R5H A;  2Q96 A;  2IW2 A;  1C27 A;  3FMQ A;  5CE6 A;  4OOK A;  3IU8 A;  4QR8 A;  5JI6 A;  1QXW A;  4U6Z A;  2Q94 A;  4FKC A;  5D6F A;  2EA4 A;  4IKR A;  4IKT A;  2V6C A;  4KM3 A;  4FO7 A;  4FLI A;  1WY2 A;  2OKN A;  1YW8 A;  3QOC A;  3MAT A;  3BIQ A;  2GTX A;  1C21 A;  4PNC A;  2MAT A;  4PV4 A;  4U75 A;  2GU4 A;  2NQ7 A;  2BN7 A;  1KP0 A;  4IPA A;  2BWT A;  1KQ9 A;  3S6B A;  2GA2 A;  2GU7 A;  4RZY A;  1QZY A;  2BWY A; 
#chains in the Genus database with same CATH homology
 2ADU A;  4IU6 A;  1B6A A;  3CTZ A;  1C23 A;  3PN9 A;  3PKB A;  4U6W A;  3ROR A;  3PKD A;  3L24 A;  4FUK A;  3CB6 A;  1R5G A;  5CDE A;  1O0X A;  2EVC A;  2G6P A;  3TB5 A;  2BWS A;  1N51 A;  2BWW A;  1XGO A;  3PKE A;  4RGZ 1;  1YVM A;  2BHD A;  5E2C A;  1BN5 A;  4U6J A;  4RZZ A;  4FLK A;  1WN1 A;  3O5V A;  3Q6D A;  2GG0 A;  1BOA A;  4S2R P;  2NQ6 A;  5JFR A;  3PEB A;  3IU7 A;  1YJ3 A;  4A6W A;  2BHA A;  4IDY A;  1JAW A;  3FMR A;  2BHC A;  4A6V A;  3IG4 A;  4U73 A;  1WLR A;  3D27 A;  2HOW A;  5E5B A;  2ZSG A;  1XGN A;  1QXY A;  1XNZ A;  2P98 A;  2Q93 A;  3OOO A;  5CNX A;  2GGB A;  2DFI A;  2V3Y A;  2BWU A;  4B28 A;  4ZNG A;  3BIT A;  1XGS A;  1YW7 A;  3PKA A;  4IF7 A;  2BB7 A;  1XGM A;  2OAZ A;  2GG9 A;  4ZWP A;  4U70 A;  4EGE A;  1C22 A;  2Q8K A;  4IKS A;  1WL9 A;  2V3X A;  4U1B A;  2B3K A;  2GG7 A;  4FLJ A;  4U69 A;  3L7G A;  4Z7M A;  2BH3 A;  1B59 A;  4MAT A;  4FLL A;  3PKC A;  3IU9 A;  5JHU A;  1PV9 A;  5CIK A;  1WL6 A;  1MAT A;  2EVO A;  2GG2 A;  4IEC A;  1A16 A;  5CDL A;  4HXX A;  2B3H A;  1M35 A;  3I7M A;  4U6E A;  5FCH A;  1YW9 A;  4S01 A;  3TAV A;  2GU5 A;  2BWV A;  1WKM A;  2GU6 A;  1KQ0 A;  3MX6 A;  5FCF A;  5CLS A;  2Q95 A;  2BWX A;  1Y1N A;  2P9A A;  1WBQ A;  3FM3 A;  2GGC A;  3OVK A;  2GG8 A;  1W7V A;  3IL0 A;  1C24 A;  2GG5 A;  4JUQ A;  2Q92 A;  2EA2 A;  2BHB A;  2EVM A;  2GZ5 A;  1CHM A;  2GG3 A;  4U76 A;  5D6E A;  4ZWO A;  3BIP A;  4FO8 A;  4S00 A;  2V3Z A;  2B3L A;  3RVA A;  5CDV A;  3MR1 A;  4U6C A;  1R58 A;  1W2M A;  4ZWU A;  2P99 A;  3CB5 A;  4S2T P;  4IKU A;  4U71 A;  4R60 A;  1QXZ A;  1R5H A;  2Q96 A;  2IW2 A;  1C27 A;  3FMQ A;  5CE6 A;  4OOK A;  3IU8 A;  4QR8 A;  5JI6 A;  1QXW A;  4U6Z A;  2Q94 A;  4FKC A;  5D6F A;  2EA4 A;  4IKR A;  4IKT A;  2V6C A;  4KM3 A;  4FO7 A;  4FLI A;  1WY2 A;  2OKN A;  1YW8 A;  3QOC A;  3MAT A;  3BIQ A;  2GTX A;  1C21 A;  4PNC A;  2MAT A;  4PV4 A;  4U75 A;  2GU4 A;  2NQ7 A;  2BN7 A;  1KP0 A;  4IPA A;  2BWT A;  1KQ9 A;  3S6B A;  2GA2 A;  2GU7 A;  4RZY A;  1QZY A;  2BWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...