2V3ZA

Glu383ala escherichia coli aminopeptidase p in complex with substrate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVAPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3zA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3zA02
2GG0A 5FCHA 3IG4A 1QZYA 4U6ZA 3PKCA 2BWYA 4FUKA 2Q94A 3S6BA 2EA2A 3PKDA 4PNCA 2DFIA 5CNXA 3FM3A 1N51A 4EGEA 1BN5A 2BHCA 2EA4A 4A6VA 4FO8A 2V3ZA 3IU8A 4U6WA 1R5HA 2GU7A 3FMQA 3PKAA 4HXXA 1WL9A 2HOWA 4S00A 4R60A 1Y1NA 5CDVA 3IU7A 4U6EA 2GZ5A 4U1BA 4IF7A 2EVCA 4IU6A 3BITA 2BWXA 2Q8KA 2NQ6A 4U76A 4IKTA 1WL6A 5D6FA 5CIKA 2Q95A 4S2TP 2P9AA 2GG7A 3PN9A 2MATA 5FCFA 2V6CA 3TB5A 2BWUA 4ZWUA 3MR1A 1XGSA 1KQ9A 1B6AA 1KP0A 3MX6A 4U69A 2GA2A 4JUQA 2GGBA 1R5GA 3RVAA 1C21A 4FLLA 1A16A 1YW7A 1C27A 1WBQA 2P98A 4ZNGA 2GG2A 4U6CA 1KQ0A 1BOAA 2GG9A 3D27A 2BWTA 4U73A 4RZYA 3O5VA 1B59A 3IU9A 5CDEA 3OOOA 3TAVA 2EVOA 2NQ7A 1PV9A 5E5BA 4FLKA 2OAZA 2EVMA 3FMRA 1CHMA 4FO7A 1JAWA 1XGMA 3PKEA 1WN1A 1M35A 2Q93A 4FLIA 4S01A 2BHBA 1W2MA 5CE6A 2V3XA 4RZZA 1WY2A 1R58A 1WKMA 4KM3A 4B28A 4QR8A 4IKUA 3CB6A 4IECA 4IPAA 2BHDA 5CDLA 1XNZA 1QXYA 1QXZA 4MATA 5JFRA 2BN7A 5JHUA 2B3KA 4Z7MA 5E2CA 2B3LA 4IKSA 3BIQA 3I7MA 2IW2A 2BWWA 4IKRA 4IDYA 1C23A 2BH3A 3L7GA 2BWVA 1O0XA 2V3YA 1XGOA 3CB5A 2BB7A 2GG8A 4U6JA 3OVKA 4U71A 1XGNA 1W7VA 2ADUA 1YW8A 2GU5A 4ZWOA 2ZSGA 2G6PA 4FLJA 4OOKA 3QOCA 4RGZ1 3MATA 5JI6A 1WLRA 3PEBA 3L24A 4PV4A 1MATA 5D6EA 3IL0A 2Q96A 2GU6A 3RORA 4A6WA 2GGCA 1YJ3A 5CLSA 3PKBA 1QXWA 4ZWPA 2OKNA 3Q6DA 2BWSA 1C24A 4U75A 4S2RP 2GU4A 2GTXA 2BHAA 4FKCA 1YW9A 2P99A 2B3HA 1C22A 1YVMA 2GG5A 2GG3A 3CTZA 4U70A 2Q92A 3BIPA
chains in the Genus database with same CATH superfamily
2GG0A 5FCHA 3IG4A 1QZYA 4U6ZA 3PKCA 2BWYA 4FUKA 2Q94A 3S6BA 2EA2A 3PKDA 4PNCA 2DFIA 5CNXA 3FM3A 1N51A 4EGEA 1BN5A 2BHCA 2EA4A 4A6VA 4FO8A 2V3ZA 3IU8A 4U6WA 1R5HA 2GU7A 3FMQA 3PKAA 4HXXA 1WL9A 2HOWA 4S00A 4R60A 1Y1NA 5CDVA 3IU7A 4U6EA 2GZ5A 4U1BA 4IF7A 2EVCA 4IU6A 3BITA 2BWXA 2Q8KA 2NQ6A 4U76A 4IKTA 1WL6A 5D6FA 5CIKA 2Q95A 4S2TP 2P9AA 2GG7A 3PN9A 2MATA 5FCFA 2V6CA 3TB5A 2BWUA 4ZWUA 3MR1A 1XGSA 1KQ9A 1B6AA 1KP0A 3MX6A 4U69A 2GA2A 4JUQA 2GGBA 1R5GA 3RVAA 1C21A 4FLLA 1A16A 1YW7A 1C27A 1WBQA 2P98A 4ZNGA 2GG2A 4U6CA 1KQ0A 1BOAA 2GG9A 3D27A 2BWTA 4U73A 4RZYA 3O5VA 1B59A 3IU9A 5CDEA 3OOOA 3TAVA 2EVOA 2NQ7A 1PV9A 5E5BA 4FLKA 2OAZA 2EVMA 3FMRA 1CHMA 4FO7A 1JAWA 1XGMA 3PKEA 1WN1A 1M35A 2Q93A 4FLIA 4S01A 2BHBA 1W2MA 5CE6A 2V3XA 4RZZA 1WY2A 1R58A 1WKMA 4KM3A 4B28A 4QR8A 4IKUA 3CB6A 4IECA 4IPAA 2BHDA 5CDLA 1XNZA 1QXYA 1QXZA 4MATA 5JFRA 2BN7A 5JHUA 2B3KA 4Z7MA 5E2CA 2B3LA 4IKSA 3BIQA 3I7MA 2IW2A 2BWWA 4IKRA 4IDYA 1C23A 2BH3A 3L7GA 2BWVA 1O0XA 2V3YA 1XGOA 3CB5A 2BB7A 2GG8A 4U6JA 3OVKA 4U71A 1XGNA 1W7VA 2ADUA 1YW8A 2GU5A 4ZWOA 2ZSGA 2G6PA 4FLJA 4OOKA 3QOCA 4RGZ1 3MATA 5JI6A 1WLRA 3PEBA 3L24A 4PV4A 1MATA 5D6EA 3IL0A 2Q96A 2GU6A 3RORA 4A6WA 2GGCA 1YJ3A 5CLSA 3PKBA 1QXWA 4ZWPA 2OKNA 3Q6DA 2BWSA 1C24A 4U75A 4S2RP 2GU4A 2GTXA 2BHAA 4FKCA 1YW9A 2P99A 2B3HA 1C22A 1YVMA 2GG5A 2GG3A 3CTZA 4U70A 2Q92A 3BIPA
chains in the Genus database with same CATH topology
2GG0A 5FCHA 3IG4A 1QZYA 4U6ZA 3PKCA 2BWYA 4FUKA 2Q94A 3S6BA 2EA2A 3PKDA 4PNCA 2DFIA 5CNXA 3FM3A 1N51A 4EGEA 1BN5A 2BHCA 2EA4A 4A6VA 4FO8A 2V3ZA 3IU8A 4U6WA 1R5HA 2GU7A 3FMQA 3PKAA 4HXXA 1WL9A 2HOWA 4S00A 4R60A 1Y1NA 5CDVA 3IU7A 4U6EA 2GZ5A 4U1BA 4IF7A 2EVCA 4IU6A 3BITA 2BWXA 2Q8KA 2NQ6A 4U76A 4IKTA 1WL6A 5D6FA 5CIKA 2Q95A 4S2TP 2P9AA 2GG7A 3PN9A 2MATA 5FCFA 2V6CA 3TB5A 2BWUA 4ZWUA 3MR1A 1XGSA 1KQ9A 1B6AA 1KP0A 3MX6A 4U69A 2GA2A 4JUQA 2GGBA 1R5GA 3RVAA 1C21A 4FLLA 1A16A 1YW7A 1C27A 1WBQA 2P98A 4ZNGA 2GG2A 4U6CA 1KQ0A 1BOAA 2GG9A 3D27A 2BWTA 4U73A 4RZYA 3O5VA 1B59A 3IU9A 5CDEA 3OOOA 3TAVA 2EVOA 2NQ7A 1PV9A 5E5BA 4FLKA 2OAZA 2EVMA 3FMRA 1CHMA 4FO7A 1JAWA 1XGMA 3PKEA 1WN1A 1M35A 2Q93A 4FLIA 4S01A 2BHBA 1W2MA 5CE6A 2V3XA 4RZZA 1WY2A 1R58A 1WKMA 4KM3A 4B28A 4QR8A 4IKUA 3CB6A 4IECA 4IPAA 2BHDA 5CDLA 1XNZA 1QXYA 1QXZA 4MATA 5JFRA 2BN7A 5JHUA 2B3KA 4Z7MA 5E2CA 2B3LA 4IKSA 3BIQA 3I7MA 2IW2A 2BWWA 4IKRA 4IDYA 1C23A 2BH3A 3L7GA 2BWVA 1O0XA 2V3YA 1XGOA 3CB5A 2BB7A 2GG8A 4U6JA 3OVKA 4U71A 1XGNA 1W7VA 2ADUA 1YW8A 2GU5A 4ZWOA 2ZSGA 2G6PA 4FLJA 4OOKA 3QOCA 4RGZ1 3MATA 5JI6A 1WLRA 3PEBA 3L24A 4PV4A 1MATA 5D6EA 3IL0A 2Q96A 2GU6A 3RORA 4A6WA 2GGCA 1YJ3A 5CLSA 3PKBA 1QXWA 4ZWPA 2OKNA 3Q6DA 2BWSA 1C24A 4U75A 4S2RP 2GU4A 2GTXA 2BHAA 4FKCA 1YW9A 2P99A 2B3HA 1C22A 1YVMA 2GG5A 2GG3A 3CTZA 4U70A 2Q92A 3BIPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG0 A;  5FCH A;  3IG4 A;  1QZY A;  4U6Z A;  3PKC A;  2BWY A;  4FUK A;  2Q94 A;  3S6B A;  2EA2 A;  3PKD A;  4PNC A;  2DFI A;  5CNX A;  3FM3 A;  1N51 A;  4EGE A;  1BN5 A;  2BHC A;  2EA4 A;  4A6V A;  4FO8 A;  2V3Z A;  3IU8 A;  4U6W A;  1R5H A;  2GU7 A;  3FMQ A;  3PKA A;  4HXX A;  1WL9 A;  2HOW A;  4S00 A;  4R60 A;  1Y1N A;  5CDV A;  3IU7 A;  4U6E A;  2GZ5 A;  4U1B A;  4IF7 A;  2EVC A;  4IU6 A;  3BIT A;  2BWX A;  2Q8K A;  2NQ6 A;  4U76 A;  4IKT A;  1WL6 A;  5D6F A;  5CIK A;  2Q95 A;  4S2T P;  2P9A A;  2GG7 A;  3PN9 A;  2MAT A;  5FCF A;  2V6C A;  3TB5 A;  2BWU A;  4ZWU A;  3MR1 A;  1XGS A;  1KQ9 A;  1B6A A;  1KP0 A;  3MX6 A;  4U69 A;  2GA2 A;  4JUQ A;  2GGB A;  1R5G A;  3RVA A;  1C21 A;  4FLL A;  1A16 A;  1YW7 A;  1C27 A;  1WBQ A;  2P98 A;  4ZNG A;  2GG2 A;  4U6C A;  1KQ0 A;  1BOA A;  2GG9 A;  3D27 A;  2BWT A;  4U73 A;  4RZY A;  3O5V A;  1B59 A;  3IU9 A;  5CDE A;  3OOO A;  3TAV A;  2EVO A;  2NQ7 A;  1PV9 A;  5E5B A;  4FLK A;  2OAZ A;  2EVM A;  3FMR A;  1CHM A;  4FO7 A;  1JAW A;  1XGM A;  3PKE A;  1WN1 A;  1M35 A;  2Q93 A;  4FLI A;  4S01 A;  2BHB A;  1W2M A;  5CE6 A;  2V3X A;  4RZZ A;  1WY2 A;  1R58 A;  1WKM A;  4KM3 A;  4B28 A;  4QR8 A;  4IKU A;  3CB6 A;  4IEC A;  4IPA A;  2BHD A;  5CDL A;  1XNZ A;  1QXY A;  1QXZ A;  4MAT A;  5JFR A;  2BN7 A;  5JHU A;  2B3K A;  4Z7M A;  5E2C A;  2B3L A;  4IKS A;  3BIQ A;  3I7M A;  2IW2 A;  2BWW A;  4IKR A;  4IDY A;  1C23 A;  2BH3 A;  3L7G A;  2BWV A;  1O0X A;  2V3Y A;  1XGO A;  3CB5 A;  2BB7 A;  2GG8 A;  4U6J A;  3OVK A;  4U71 A;  1XGN A;  1W7V A;  2ADU A;  1YW8 A;  2GU5 A;  4ZWO A;  2ZSG A;  2G6P A;  4FLJ A;  4OOK A;  3QOC A;  4RGZ 1;  3MAT A;  5JI6 A;  1WLR A;  3PEB A;  3L24 A;  4PV4 A;  1MAT A;  5D6E A;  3IL0 A;  2Q96 A;  2GU6 A;  3ROR A;  4A6W A;  2GGC A;  1YJ3 A;  5CLS A;  3PKB A;  1QXW A;  4ZWP A;  2OKN A;  3Q6D A;  2BWS A;  1C24 A;  4U75 A;  4S2R P;  2GU4 A;  2GTX A;  2BHA A;  4FKC A;  1YW9 A;  2P99 A;  2B3H A;  1C22 A;  1YVM A;  2GG5 A;  2GG3 A;  3CTZ A;  4U70 A;  2Q92 A;  3BIP A; 
#chains in the Genus database with same CATH topology
 2GG0 A;  5FCH A;  3IG4 A;  1QZY A;  4U6Z A;  3PKC A;  2BWY A;  4FUK A;  2Q94 A;  3S6B A;  2EA2 A;  3PKD A;  4PNC A;  2DFI A;  5CNX A;  3FM3 A;  1N51 A;  4EGE A;  1BN5 A;  2BHC A;  2EA4 A;  4A6V A;  4FO8 A;  2V3Z A;  3IU8 A;  4U6W A;  1R5H A;  2GU7 A;  3FMQ A;  3PKA A;  4HXX A;  1WL9 A;  2HOW A;  4S00 A;  4R60 A;  1Y1N A;  5CDV A;  3IU7 A;  4U6E A;  2GZ5 A;  4U1B A;  4IF7 A;  2EVC A;  4IU6 A;  3BIT A;  2BWX A;  2Q8K A;  2NQ6 A;  4U76 A;  4IKT A;  1WL6 A;  5D6F A;  5CIK A;  2Q95 A;  4S2T P;  2P9A A;  2GG7 A;  3PN9 A;  2MAT A;  5FCF A;  2V6C A;  3TB5 A;  2BWU A;  4ZWU A;  3MR1 A;  1XGS A;  1KQ9 A;  1B6A A;  1KP0 A;  3MX6 A;  4U69 A;  2GA2 A;  4JUQ A;  2GGB A;  1R5G A;  3RVA A;  1C21 A;  4FLL A;  1A16 A;  1YW7 A;  1C27 A;  1WBQ A;  2P98 A;  4ZNG A;  2GG2 A;  4U6C A;  1KQ0 A;  1BOA A;  2GG9 A;  3D27 A;  2BWT A;  4U73 A;  4RZY A;  3O5V A;  1B59 A;  3IU9 A;  5CDE A;  3OOO A;  3TAV A;  2EVO A;  2NQ7 A;  1PV9 A;  5E5B A;  4FLK A;  2OAZ A;  2EVM A;  3FMR A;  1CHM A;  4FO7 A;  1JAW A;  1XGM A;  3PKE A;  1WN1 A;  1M35 A;  2Q93 A;  4FLI A;  4S01 A;  2BHB A;  1W2M A;  5CE6 A;  2V3X A;  4RZZ A;  1WY2 A;  1R58 A;  1WKM A;  4KM3 A;  4B28 A;  4QR8 A;  4IKU A;  3CB6 A;  4IEC A;  4IPA A;  2BHD A;  5CDL A;  1XNZ A;  1QXY A;  1QXZ A;  4MAT A;  5JFR A;  2BN7 A;  5JHU A;  2B3K A;  4Z7M A;  5E2C A;  2B3L A;  4IKS A;  3BIQ A;  3I7M A;  2IW2 A;  2BWW A;  4IKR A;  4IDY A;  1C23 A;  2BH3 A;  3L7G A;  2BWV A;  1O0X A;  2V3Y A;  1XGO A;  3CB5 A;  2BB7 A;  2GG8 A;  4U6J A;  3OVK A;  4U71 A;  1XGN A;  1W7V A;  2ADU A;  1YW8 A;  2GU5 A;  4ZWO A;  2ZSG A;  2G6P A;  4FLJ A;  4OOK A;  3QOC A;  4RGZ 1;  3MAT A;  5JI6 A;  1WLR A;  3PEB A;  3L24 A;  4PV4 A;  1MAT A;  5D6E A;  3IL0 A;  2Q96 A;  2GU6 A;  3ROR A;  4A6W A;  2GGC A;  1YJ3 A;  5CLS A;  3PKB A;  1QXW A;  4ZWP A;  2OKN A;  3Q6D A;  2BWS A;  1C24 A;  4U75 A;  4S2R P;  2GU4 A;  2GTX A;  2BHA A;  4FKC A;  1YW9 A;  2P99 A;  2B3H A;  1C22 A;  1YVM A;  2GG5 A;  2GG3 A;  3CTZ A;  4U70 A;  2Q92 A;  3BIP A; 
#chains in the Genus database with same CATH homology
 2GG0 A;  5FCH A;  3IG4 A;  1QZY A;  4U6Z A;  3PKC A;  2BWY A;  4FUK A;  2Q94 A;  3S6B A;  2EA2 A;  3PKD A;  4PNC A;  2DFI A;  5CNX A;  3FM3 A;  1N51 A;  4EGE A;  1BN5 A;  2BHC A;  2EA4 A;  4A6V A;  4FO8 A;  2V3Z A;  3IU8 A;  4U6W A;  1R5H A;  2GU7 A;  3FMQ A;  3PKA A;  4HXX A;  1WL9 A;  2HOW A;  4S00 A;  4R60 A;  1Y1N A;  5CDV A;  3IU7 A;  4U6E A;  2GZ5 A;  4U1B A;  4IF7 A;  2EVC A;  4IU6 A;  3BIT A;  2BWX A;  2Q8K A;  2NQ6 A;  4U76 A;  4IKT A;  1WL6 A;  5D6F A;  5CIK A;  2Q95 A;  4S2T P;  2P9A A;  2GG7 A;  3PN9 A;  2MAT A;  5FCF A;  2V6C A;  3TB5 A;  2BWU A;  4ZWU A;  3MR1 A;  1XGS A;  1KQ9 A;  1B6A A;  1KP0 A;  3MX6 A;  4U69 A;  2GA2 A;  4JUQ A;  2GGB A;  1R5G A;  3RVA A;  1C21 A;  4FLL A;  1A16 A;  1YW7 A;  1C27 A;  1WBQ A;  2P98 A;  4ZNG A;  2GG2 A;  4U6C A;  1KQ0 A;  1BOA A;  2GG9 A;  3D27 A;  2BWT A;  4U73 A;  4RZY A;  3O5V A;  1B59 A;  3IU9 A;  5CDE A;  3OOO A;  3TAV A;  2EVO A;  2NQ7 A;  1PV9 A;  5E5B A;  4FLK A;  2OAZ A;  2EVM A;  3FMR A;  1CHM A;  4FO7 A;  1JAW A;  1XGM A;  3PKE A;  1WN1 A;  1M35 A;  2Q93 A;  4FLI A;  4S01 A;  2BHB A;  1W2M A;  5CE6 A;  2V3X A;  4RZZ A;  1WY2 A;  1R58 A;  1WKM A;  4KM3 A;  4B28 A;  4QR8 A;  4IKU A;  3CB6 A;  4IEC A;  4IPA A;  2BHD A;  5CDL A;  1XNZ A;  1QXY A;  1QXZ A;  4MAT A;  5JFR A;  2BN7 A;  5JHU A;  2B3K A;  4Z7M A;  5E2C A;  2B3L A;  4IKS A;  3BIQ A;  3I7M A;  2IW2 A;  2BWW A;  4IKR A;  4IDY A;  1C23 A;  2BH3 A;  3L7G A;  2BWV A;  1O0X A;  2V3Y A;  1XGO A;  3CB5 A;  2BB7 A;  2GG8 A;  4U6J A;  3OVK A;  4U71 A;  1XGN A;  1W7V A;  2ADU A;  1YW8 A;  2GU5 A;  4ZWO A;  2ZSG A;  2G6P A;  4FLJ A;  4OOK A;  3QOC A;  4RGZ 1;  3MAT A;  5JI6 A;  1WLR A;  3PEB A;  3L24 A;  4PV4 A;  1MAT A;  5D6E A;  3IL0 A;  2Q96 A;  2GU6 A;  3ROR A;  4A6W A;  2GGC A;  1YJ3 A;  5CLS A;  3PKB A;  1QXW A;  4ZWP A;  2OKN A;  3Q6D A;  2BWS A;  1C24 A;  4U75 A;  4S2R P;  2GU4 A;  2GTX A;  2BHA A;  4FKC A;  1YW9 A;  2P99 A;  2B3H A;  1C22 A;  1YVM A;  2GG5 A;  2GG3 A;  3CTZ A;  4U70 A;  2Q92 A;  3BIP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...