2V3ZA

Glu383ala escherichia coli aminopeptidase p in complex with substrate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVAPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3zA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3zA02
4FKCA 2BWUA 2BB7A 4FLIA 3BITA 1YVMA 2GG7A 4U76A 1JAWA 1C23A 1N51A 2B3KA 4U70A 2GZ5A 1YW7A 1XGMA 2DFIA 4ZWPA 1Y1NA 3S6BA 1WY2A 2GG9A 5FCFA 1XGNA 5E5BA 4IPAA 4RZYA 1YW9A 3CB5A 2P98A 2EVCA 2BHDA 4S01A 1O0XA 2IW2A 1WL9A 3RORA 1C22A 5CDEA 2V3YA 2BHBA 1BOAA 3IU9A 4FO8A 4U69A 5JHUA 4OOKA 2ZSGA 3CB6A 4FLLA 2P9AA 3FMQA 3PN9A 3PKEA 4ZWOA 4B28A 5CIKA 2EVOA 2NQ7A 4PNCA 2BWWA 1YW8A 4FLJA 2Q94A 4QR8A 3I7MA 4FLKA 3TB5A 4S00A 1R5HA 2Q92A 1KQ0A 1BN5A 4IKSA 3RVAA 2BWXA 2GA2A 1M35A 2Q96A 2GGCA 2EA2A 4U75A 4S2TP 4U6EA 3IU8A 1W7VA 4FO7A 1QXWA 2GU4A 3BIPA 4IKRA 1W2MA 3PKDA 4U1BA 2BHCA 3PEBA 4ZWUA 5CNXA 4U71A 3MR1A 3D27A 4KM3A 2HOWA 2OAZA 1R58A 4IDYA 2OKNA 4U6ZA 4JUQA 4U6WA 5CE6A 2BHAA 1YJ3A 1WL6A 2GTXA 2BH3A 2GU5A 2Q95A 5JI6A 2GG5A 3MATA 1B59A 1QXYA 1KP0A 3Q6DA 1XGSA 2B3LA 2BWYA 5CDLA 1C21A 2Q93A 1C27A 2EVMA 4PV4A 2GG8A 3FMRA 2GG3A 2NQ6A 2GU7A 5D6FA 2Q8KA 2BN7A 5D6EA 1CHMA 4EGEA 4HXXA 2GG2A 3PKBA 4MATA 1WN1A 4U6CA 4IF7A 2EA4A 3IU7A 4A6VA 4A6WA 5JFRA 5FCHA 1A16A 2G6PA 3CTZA 2V6CA 1WKMA 2P99A 2GU6A 4FUKA 1WLRA 2V3XA 1XGOA 4IKUA 1QZYA 4Z7MA 2GGBA 4U73A 1B6AA 4IECA 5E2CA 2GG0A 4IU6A 5CLSA 2V3ZA 1XNZA 3IG4A 3L24A 3OOOA 3L7GA 5CDVA 2ADUA 3TAVA 2BWVA 4IKTA 1PV9A 2B3HA 2BWTA 1R5GA 3O5VA 2MATA 3QOCA 3OVKA 1MATA 3IL0A 1QXZA 3MX6A 4U6JA 3BIQA 1WBQA 4RZZA 1C24A 4R60A 4RGZ1 3FM3A 4S2RP 1KQ9A 2BWSA 3PKCA 3PKAA 4ZNGA
chains in the Genus database with same CATH superfamily
4FKCA 2BWUA 2BB7A 4FLIA 3BITA 1YVMA 2GG7A 4U76A 1JAWA 1C23A 1N51A 2B3KA 4U70A 2GZ5A 1YW7A 1XGMA 2DFIA 4ZWPA 1Y1NA 3S6BA 1WY2A 2GG9A 5FCFA 1XGNA 5E5BA 4IPAA 4RZYA 1YW9A 3CB5A 2P98A 2EVCA 2BHDA 4S01A 1O0XA 2IW2A 1WL9A 3RORA 1C22A 5CDEA 2V3YA 2BHBA 1BOAA 3IU9A 4FO8A 4U69A 5JHUA 4OOKA 2ZSGA 3CB6A 4FLLA 2P9AA 3FMQA 3PN9A 3PKEA 4ZWOA 4B28A 5CIKA 2EVOA 2NQ7A 4PNCA 2BWWA 1YW8A 4FLJA 2Q94A 4QR8A 3I7MA 4FLKA 3TB5A 4S00A 1R5HA 2Q92A 1KQ0A 1BN5A 4IKSA 3RVAA 2BWXA 2GA2A 1M35A 2Q96A 2GGCA 2EA2A 4U75A 4S2TP 4U6EA 3IU8A 1W7VA 4FO7A 1QXWA 2GU4A 3BIPA 4IKRA 1W2MA 3PKDA 4U1BA 2BHCA 3PEBA 4ZWUA 5CNXA 4U71A 3MR1A 3D27A 4KM3A 2HOWA 2OAZA 1R58A 4IDYA 2OKNA 4U6ZA 4JUQA 4U6WA 5CE6A 2BHAA 1YJ3A 1WL6A 2GTXA 2BH3A 2GU5A 2Q95A 5JI6A 2GG5A 3MATA 1B59A 1QXYA 1KP0A 3Q6DA 1XGSA 2B3LA 2BWYA 5CDLA 1C21A 2Q93A 1C27A 2EVMA 4PV4A 2GG8A 3FMRA 2GG3A 2NQ6A 2GU7A 5D6FA 2Q8KA 2BN7A 5D6EA 1CHMA 4EGEA 4HXXA 2GG2A 3PKBA 4MATA 1WN1A 4U6CA 4IF7A 2EA4A 3IU7A 4A6VA 4A6WA 5JFRA 5FCHA 1A16A 2G6PA 3CTZA 2V6CA 1WKMA 2P99A 2GU6A 4FUKA 1WLRA 2V3XA 1XGOA 4IKUA 1QZYA 4Z7MA 2GGBA 4U73A 1B6AA 4IECA 5E2CA 2GG0A 4IU6A 5CLSA 2V3ZA 1XNZA 3IG4A 3L24A 3OOOA 3L7GA 5CDVA 2ADUA 3TAVA 2BWVA 4IKTA 1PV9A 2B3HA 2BWTA 1R5GA 3O5VA 2MATA 3QOCA 3OVKA 1MATA 3IL0A 1QXZA 3MX6A 4U6JA 3BIQA 1WBQA 4RZZA 1C24A 4R60A 4RGZ1 3FM3A 4S2RP 1KQ9A 2BWSA 3PKCA 3PKAA 4ZNGA
chains in the Genus database with same CATH topology
4FKCA 2BWUA 2BB7A 4FLIA 3BITA 1YVMA 2GG7A 4U76A 1JAWA 1C23A 1N51A 2B3KA 4U70A 2GZ5A 1YW7A 1XGMA 2DFIA 4ZWPA 1Y1NA 3S6BA 1WY2A 2GG9A 5FCFA 1XGNA 5E5BA 4IPAA 4RZYA 1YW9A 3CB5A 2P98A 2EVCA 2BHDA 4S01A 1O0XA 2IW2A 1WL9A 3RORA 1C22A 5CDEA 2V3YA 2BHBA 1BOAA 3IU9A 4FO8A 4U69A 5JHUA 4OOKA 2ZSGA 3CB6A 4FLLA 2P9AA 3FMQA 3PN9A 3PKEA 4ZWOA 4B28A 5CIKA 2EVOA 2NQ7A 4PNCA 2BWWA 1YW8A 4FLJA 2Q94A 4QR8A 3I7MA 4FLKA 3TB5A 4S00A 1R5HA 2Q92A 1KQ0A 1BN5A 4IKSA 3RVAA 2BWXA 2GA2A 1M35A 2Q96A 2GGCA 2EA2A 4U75A 4S2TP 4U6EA 3IU8A 1W7VA 4FO7A 1QXWA 2GU4A 3BIPA 4IKRA 1W2MA 3PKDA 4U1BA 2BHCA 3PEBA 4ZWUA 5CNXA 4U71A 3MR1A 3D27A 4KM3A 2HOWA 2OAZA 1R58A 4IDYA 2OKNA 4U6ZA 4JUQA 4U6WA 5CE6A 2BHAA 1YJ3A 1WL6A 2GTXA 2BH3A 2GU5A 2Q95A 5JI6A 2GG5A 3MATA 1B59A 1QXYA 1KP0A 3Q6DA 1XGSA 2B3LA 2BWYA 5CDLA 1C21A 2Q93A 1C27A 2EVMA 4PV4A 2GG8A 3FMRA 2GG3A 2NQ6A 2GU7A 5D6FA 2Q8KA 2BN7A 5D6EA 1CHMA 4EGEA 4HXXA 2GG2A 3PKBA 4MATA 1WN1A 4U6CA 4IF7A 2EA4A 3IU7A 4A6VA 4A6WA 5JFRA 5FCHA 1A16A 2G6PA 3CTZA 2V6CA 1WKMA 2P99A 2GU6A 4FUKA 1WLRA 2V3XA 1XGOA 4IKUA 1QZYA 4Z7MA 2GGBA 4U73A 1B6AA 4IECA 5E2CA 2GG0A 4IU6A 5CLSA 2V3ZA 1XNZA 3IG4A 3L24A 3OOOA 3L7GA 5CDVA 2ADUA 3TAVA 2BWVA 4IKTA 1PV9A 2B3HA 2BWTA 1R5GA 3O5VA 2MATA 3QOCA 3OVKA 1MATA 3IL0A 1QXZA 3MX6A 4U6JA 3BIQA 1WBQA 4RZZA 1C24A 4R60A 4RGZ1 3FM3A 4S2RP 1KQ9A 2BWSA 3PKCA 3PKAA 4ZNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FKC A;  2BWU A;  2BB7 A;  4FLI A;  3BIT A;  1YVM A;  2GG7 A;  4U76 A;  1JAW A;  1C23 A;  1N51 A;  2B3K A;  4U70 A;  2GZ5 A;  1YW7 A;  1XGM A;  2DFI A;  4ZWP A;  1Y1N A;  3S6B A;  1WY2 A;  2GG9 A;  5FCF A;  1XGN A;  5E5B A;  4IPA A;  4RZY A;  1YW9 A;  3CB5 A;  2P98 A;  2EVC A;  2BHD A;  4S01 A;  1O0X A;  2IW2 A;  1WL9 A;  3ROR A;  1C22 A;  5CDE A;  2V3Y A;  2BHB A;  1BOA A;  3IU9 A;  4FO8 A;  4U69 A;  5JHU A;  4OOK A;  2ZSG A;  3CB6 A;  4FLL A;  2P9A A;  3FMQ A;  3PN9 A;  3PKE A;  4ZWO A;  4B28 A;  5CIK A;  2EVO A;  2NQ7 A;  4PNC A;  2BWW A;  1YW8 A;  4FLJ A;  2Q94 A;  4QR8 A;  3I7M A;  4FLK A;  3TB5 A;  4S00 A;  1R5H A;  2Q92 A;  1KQ0 A;  1BN5 A;  4IKS A;  3RVA A;  2BWX A;  2GA2 A;  1M35 A;  2Q96 A;  2GGC A;  2EA2 A;  4U75 A;  4S2T P;  4U6E A;  3IU8 A;  1W7V A;  4FO7 A;  1QXW A;  2GU4 A;  3BIP A;  4IKR A;  1W2M A;  3PKD A;  4U1B A;  2BHC A;  3PEB A;  4ZWU A;  5CNX A;  4U71 A;  3MR1 A;  3D27 A;  4KM3 A;  2HOW A;  2OAZ A;  1R58 A;  4IDY A;  2OKN A;  4U6Z A;  4JUQ A;  4U6W A;  5CE6 A;  2BHA A;  1YJ3 A;  1WL6 A;  2GTX A;  2BH3 A;  2GU5 A;  2Q95 A;  5JI6 A;  2GG5 A;  3MAT A;  1B59 A;  1QXY A;  1KP0 A;  3Q6D A;  1XGS A;  2B3L A;  2BWY A;  5CDL A;  1C21 A;  2Q93 A;  1C27 A;  2EVM A;  4PV4 A;  2GG8 A;  3FMR A;  2GG3 A;  2NQ6 A;  2GU7 A;  5D6F A;  2Q8K A;  2BN7 A;  5D6E A;  1CHM A;  4EGE A;  4HXX A;  2GG2 A;  3PKB A;  4MAT A;  1WN1 A;  4U6C A;  4IF7 A;  2EA4 A;  3IU7 A;  4A6V A;  4A6W A;  5JFR A;  5FCH A;  1A16 A;  2G6P A;  3CTZ A;  2V6C A;  1WKM A;  2P99 A;  2GU6 A;  4FUK A;  1WLR A;  2V3X A;  1XGO A;  4IKU A;  1QZY A;  4Z7M A;  2GGB A;  4U73 A;  1B6A A;  4IEC A;  5E2C A;  2GG0 A;  4IU6 A;  5CLS A;  2V3Z A;  1XNZ A;  3IG4 A;  3L24 A;  3OOO A;  3L7G A;  5CDV A;  2ADU A;  3TAV A;  2BWV A;  4IKT A;  1PV9 A;  2B3H A;  2BWT A;  1R5G A;  3O5V A;  2MAT A;  3QOC A;  3OVK A;  1MAT A;  3IL0 A;  1QXZ A;  3MX6 A;  4U6J A;  3BIQ A;  1WBQ A;  4RZZ A;  1C24 A;  4R60 A;  4RGZ 1;  3FM3 A;  4S2R P;  1KQ9 A;  2BWS A;  3PKC A;  3PKA A;  4ZNG A; 
#chains in the Genus database with same CATH topology
 4FKC A;  2BWU A;  2BB7 A;  4FLI A;  3BIT A;  1YVM A;  2GG7 A;  4U76 A;  1JAW A;  1C23 A;  1N51 A;  2B3K A;  4U70 A;  2GZ5 A;  1YW7 A;  1XGM A;  2DFI A;  4ZWP A;  1Y1N A;  3S6B A;  1WY2 A;  2GG9 A;  5FCF A;  1XGN A;  5E5B A;  4IPA A;  4RZY A;  1YW9 A;  3CB5 A;  2P98 A;  2EVC A;  2BHD A;  4S01 A;  1O0X A;  2IW2 A;  1WL9 A;  3ROR A;  1C22 A;  5CDE A;  2V3Y A;  2BHB A;  1BOA A;  3IU9 A;  4FO8 A;  4U69 A;  5JHU A;  4OOK A;  2ZSG A;  3CB6 A;  4FLL A;  2P9A A;  3FMQ A;  3PN9 A;  3PKE A;  4ZWO A;  4B28 A;  5CIK A;  2EVO A;  2NQ7 A;  4PNC A;  2BWW A;  1YW8 A;  4FLJ A;  2Q94 A;  4QR8 A;  3I7M A;  4FLK A;  3TB5 A;  4S00 A;  1R5H A;  2Q92 A;  1KQ0 A;  1BN5 A;  4IKS A;  3RVA A;  2BWX A;  2GA2 A;  1M35 A;  2Q96 A;  2GGC A;  2EA2 A;  4U75 A;  4S2T P;  4U6E A;  3IU8 A;  1W7V A;  4FO7 A;  1QXW A;  2GU4 A;  3BIP A;  4IKR A;  1W2M A;  3PKD A;  4U1B A;  2BHC A;  3PEB A;  4ZWU A;  5CNX A;  4U71 A;  3MR1 A;  3D27 A;  4KM3 A;  2HOW A;  2OAZ A;  1R58 A;  4IDY A;  2OKN A;  4U6Z A;  4JUQ A;  4U6W A;  5CE6 A;  2BHA A;  1YJ3 A;  1WL6 A;  2GTX A;  2BH3 A;  2GU5 A;  2Q95 A;  5JI6 A;  2GG5 A;  3MAT A;  1B59 A;  1QXY A;  1KP0 A;  3Q6D A;  1XGS A;  2B3L A;  2BWY A;  5CDL A;  1C21 A;  2Q93 A;  1C27 A;  2EVM A;  4PV4 A;  2GG8 A;  3FMR A;  2GG3 A;  2NQ6 A;  2GU7 A;  5D6F A;  2Q8K A;  2BN7 A;  5D6E A;  1CHM A;  4EGE A;  4HXX A;  2GG2 A;  3PKB A;  4MAT A;  1WN1 A;  4U6C A;  4IF7 A;  2EA4 A;  3IU7 A;  4A6V A;  4A6W A;  5JFR A;  5FCH A;  1A16 A;  2G6P A;  3CTZ A;  2V6C A;  1WKM A;  2P99 A;  2GU6 A;  4FUK A;  1WLR A;  2V3X A;  1XGO A;  4IKU A;  1QZY A;  4Z7M A;  2GGB A;  4U73 A;  1B6A A;  4IEC A;  5E2C A;  2GG0 A;  4IU6 A;  5CLS A;  2V3Z A;  1XNZ A;  3IG4 A;  3L24 A;  3OOO A;  3L7G A;  5CDV A;  2ADU A;  3TAV A;  2BWV A;  4IKT A;  1PV9 A;  2B3H A;  2BWT A;  1R5G A;  3O5V A;  2MAT A;  3QOC A;  3OVK A;  1MAT A;  3IL0 A;  1QXZ A;  3MX6 A;  4U6J A;  3BIQ A;  1WBQ A;  4RZZ A;  1C24 A;  4R60 A;  4RGZ 1;  3FM3 A;  4S2R P;  1KQ9 A;  2BWS A;  3PKC A;  3PKA A;  4ZNG A; 
#chains in the Genus database with same CATH homology
 4FKC A;  2BWU A;  2BB7 A;  4FLI A;  3BIT A;  1YVM A;  2GG7 A;  4U76 A;  1JAW A;  1C23 A;  1N51 A;  2B3K A;  4U70 A;  2GZ5 A;  1YW7 A;  1XGM A;  2DFI A;  4ZWP A;  1Y1N A;  3S6B A;  1WY2 A;  2GG9 A;  5FCF A;  1XGN A;  5E5B A;  4IPA A;  4RZY A;  1YW9 A;  3CB5 A;  2P98 A;  2EVC A;  2BHD A;  4S01 A;  1O0X A;  2IW2 A;  1WL9 A;  3ROR A;  1C22 A;  5CDE A;  2V3Y A;  2BHB A;  1BOA A;  3IU9 A;  4FO8 A;  4U69 A;  5JHU A;  4OOK A;  2ZSG A;  3CB6 A;  4FLL A;  2P9A A;  3FMQ A;  3PN9 A;  3PKE A;  4ZWO A;  4B28 A;  5CIK A;  2EVO A;  2NQ7 A;  4PNC A;  2BWW A;  1YW8 A;  4FLJ A;  2Q94 A;  4QR8 A;  3I7M A;  4FLK A;  3TB5 A;  4S00 A;  1R5H A;  2Q92 A;  1KQ0 A;  1BN5 A;  4IKS A;  3RVA A;  2BWX A;  2GA2 A;  1M35 A;  2Q96 A;  2GGC A;  2EA2 A;  4U75 A;  4S2T P;  4U6E A;  3IU8 A;  1W7V A;  4FO7 A;  1QXW A;  2GU4 A;  3BIP A;  4IKR A;  1W2M A;  3PKD A;  4U1B A;  2BHC A;  3PEB A;  4ZWU A;  5CNX A;  4U71 A;  3MR1 A;  3D27 A;  4KM3 A;  2HOW A;  2OAZ A;  1R58 A;  4IDY A;  2OKN A;  4U6Z A;  4JUQ A;  4U6W A;  5CE6 A;  2BHA A;  1YJ3 A;  1WL6 A;  2GTX A;  2BH3 A;  2GU5 A;  2Q95 A;  5JI6 A;  2GG5 A;  3MAT A;  1B59 A;  1QXY A;  1KP0 A;  3Q6D A;  1XGS A;  2B3L A;  2BWY A;  5CDL A;  1C21 A;  2Q93 A;  1C27 A;  2EVM A;  4PV4 A;  2GG8 A;  3FMR A;  2GG3 A;  2NQ6 A;  2GU7 A;  5D6F A;  2Q8K A;  2BN7 A;  5D6E A;  1CHM A;  4EGE A;  4HXX A;  2GG2 A;  3PKB A;  4MAT A;  1WN1 A;  4U6C A;  4IF7 A;  2EA4 A;  3IU7 A;  4A6V A;  4A6W A;  5JFR A;  5FCH A;  1A16 A;  2G6P A;  3CTZ A;  2V6C A;  1WKM A;  2P99 A;  2GU6 A;  4FUK A;  1WLR A;  2V3X A;  1XGO A;  4IKU A;  1QZY A;  4Z7M A;  2GGB A;  4U73 A;  1B6A A;  4IEC A;  5E2C A;  2GG0 A;  4IU6 A;  5CLS A;  2V3Z A;  1XNZ A;  3IG4 A;  3L24 A;  3OOO A;  3L7G A;  5CDV A;  2ADU A;  3TAV A;  2BWV A;  4IKT A;  1PV9 A;  2B3H A;  2BWT A;  1R5G A;  3O5V A;  2MAT A;  3QOC A;  3OVK A;  1MAT A;  3IL0 A;  1QXZ A;  3MX6 A;  4U6J A;  3BIQ A;  1WBQ A;  4RZZ A;  1C24 A;  4R60 A;  4RGZ 1;  3FM3 A;  4S2R P;  1KQ9 A;  2BWS A;  3PKC A;  3PKA A;  4ZNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...