2V3ZA

Glu383ala escherichia coli aminopeptidase p in complex with substrate
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVAPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Complexes of Mutants of Escherichia Coli Aminopeptidase P and the Tripeptide Substrate Valproleu.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2007-06-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2v3zA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2v3zA02
2GG7A 2GTXA 3S6BA 1R58A 4IKSA 4A6VA 2OAZA 3CB5A 4FO8A 1CHMA 4U69A 2V3YA 2P99A 2B3KA 4R60A 3TB5A 2GG8A 4OOKA 1KQ9A 4FKCA 2IW2A 5JI6A 4U6CA 3PN9A 1XGOA 1XGMA 5CLSA 1O0XA 4U73A 2BWYA 5CDEA 2GG0A 2Q92A 1Y1NA 4JUQA 4ZWOA 5D6FA 2EA4A 1WN1A 1WY2A 1W2MA 4ZWPA 2EA2A 2NQ7A 3MR1A 4U6ZA 1YW8A 5D6EA 4A6WA 1C24A 2P9AA 3MX6A 3RORA 4FLJA 3PKEA 2B3LA 5JFRA 3FMRA 2GGCA 2Q8KA 5CDVA 4RZYA 3PEBA 2EVMA 4PNCA 4ZWUA 1QZYA 3BITA 4IPAA 2GGBA 4IKTA 2BH3A 3OOOA 3OVKA 3CB6A 2GU7A 2BHCA 1PV9A 3BIQA 1N51A 4U71A 3PKCA 1XNZA 1YW9A 4U70A 4IU6A 2MATA 2BN7A 2BHAA 4S2RP 4FO7A 2Q93A 2GA2A 4EGEA 2GU5A 2GU4A 5FCFA 1C23A 2BHBA 4QR8A 4S01A 4U6EA 4ZNGA 3MATA 5CIKA 2ADUA 4KM3A 1WL6A 1R5HA 2V3ZA 4RZZA 1YVMA 2G6PA 3TAVA 1C22A 1W7VA 2BWVA 3BIPA 3I7MA 1WLRA 1QXWA 4FLLA 4IECA 3IG4A 1JAWA 4PV4A 1B6AA 2BB7A 1KP0A 3FMQA 2EVOA 2V6CA 1C21A 3D27A 1C27A 2ZSGA 4B28A 2EVCA 3PKBA 2OKNA 4U75A 4MATA 5JHUA 1WBQA 2BHDA 4U1BA 1M35A 1YJ3A 3PKDA 1WKMA 5CNXA 2V3XA 2GG5A 3PKAA 4FLKA 1WL9A 4IF7A 2GG2A 4IKUA 1XGNA 2BWUA 1B59A 1BOAA 1QXZA 1QXYA 2BWSA 2GG9A 3CTZA 2GU6A 3RVAA 1XGSA 5E2CA 1BN5A 4RGZ1 3IL0A 2Q94A 4U6JA 2BWXA 3IU7A 2NQ6A 4IDYA 2P98A 4HXXA 4S2TP 3IU8A 2GZ5A 2BWWA 3O5VA 5CE6A 3L24A 1KQ0A 3QOCA 3L7GA 4U76A 4Z7MA 3Q6DA 2Q95A 2Q96A 1R5GA 2BWTA 5FCHA 4IKRA 4U6WA 4S00A 4FLIA 2HOWA 2GG3A 1A16A 3IU9A 5E5BA 2DFIA 4FUKA 1YW7A 1MATA 3FM3A 2B3HA 5CDLA
chains in the Genus database with same CATH superfamily
2GG7A 2GTXA 3S6BA 1R58A 4IKSA 4A6VA 2OAZA 3CB5A 4FO8A 1CHMA 4U69A 2V3YA 2P99A 2B3KA 4R60A 3TB5A 2GG8A 4OOKA 1KQ9A 4FKCA 2IW2A 5JI6A 4U6CA 3PN9A 1XGOA 1XGMA 5CLSA 1O0XA 4U73A 2BWYA 5CDEA 2GG0A 2Q92A 1Y1NA 4JUQA 4ZWOA 5D6FA 2EA4A 1WN1A 1WY2A 1W2MA 4ZWPA 2EA2A 2NQ7A 3MR1A 4U6ZA 1YW8A 5D6EA 4A6WA 1C24A 2P9AA 3MX6A 3RORA 4FLJA 3PKEA 2B3LA 5JFRA 3FMRA 2GGCA 2Q8KA 5CDVA 4RZYA 3PEBA 2EVMA 4PNCA 4ZWUA 1QZYA 3BITA 4IPAA 2GGBA 4IKTA 2BH3A 3OOOA 3OVKA 3CB6A 2GU7A 2BHCA 1PV9A 3BIQA 1N51A 4U71A 3PKCA 1XNZA 1YW9A 4U70A 4IU6A 2MATA 2BN7A 2BHAA 4S2RP 4FO7A 2Q93A 2GA2A 4EGEA 2GU5A 2GU4A 5FCFA 1C23A 2BHBA 4QR8A 4S01A 4U6EA 4ZNGA 3MATA 5CIKA 2ADUA 4KM3A 1WL6A 1R5HA 2V3ZA 4RZZA 1YVMA 2G6PA 3TAVA 1C22A 1W7VA 2BWVA 3BIPA 3I7MA 1WLRA 1QXWA 4FLLA 4IECA 3IG4A 1JAWA 4PV4A 1B6AA 2BB7A 1KP0A 3FMQA 2EVOA 2V6CA 1C21A 3D27A 1C27A 2ZSGA 4B28A 2EVCA 3PKBA 2OKNA 4U75A 4MATA 5JHUA 1WBQA 2BHDA 4U1BA 1M35A 1YJ3A 3PKDA 1WKMA 5CNXA 2V3XA 2GG5A 3PKAA 4FLKA 1WL9A 4IF7A 2GG2A 4IKUA 1XGNA 2BWUA 1B59A 1BOAA 1QXZA 1QXYA 2BWSA 2GG9A 3CTZA 2GU6A 3RVAA 1XGSA 5E2CA 1BN5A 4RGZ1 3IL0A 2Q94A 4U6JA 2BWXA 3IU7A 2NQ6A 4IDYA 2P98A 4HXXA 4S2TP 3IU8A 2GZ5A 2BWWA 3O5VA 5CE6A 3L24A 1KQ0A 3QOCA 3L7GA 4U76A 4Z7MA 3Q6DA 2Q95A 2Q96A 1R5GA 2BWTA 5FCHA 4IKRA 4U6WA 4S00A 4FLIA 2HOWA 2GG3A 1A16A 3IU9A 5E5BA 2DFIA 4FUKA 1YW7A 1MATA 3FM3A 2B3HA 5CDLA
chains in the Genus database with same CATH topology
2GG7A 2GTXA 3S6BA 1R58A 4IKSA 4A6VA 2OAZA 3CB5A 4FO8A 1CHMA 4U69A 2V3YA 2P99A 2B3KA 4R60A 3TB5A 2GG8A 4OOKA 1KQ9A 4FKCA 2IW2A 5JI6A 4U6CA 3PN9A 1XGOA 1XGMA 5CLSA 1O0XA 4U73A 2BWYA 5CDEA 2GG0A 2Q92A 1Y1NA 4JUQA 4ZWOA 5D6FA 2EA4A 1WN1A 1WY2A 1W2MA 4ZWPA 2EA2A 2NQ7A 3MR1A 4U6ZA 1YW8A 5D6EA 4A6WA 1C24A 2P9AA 3MX6A 3RORA 4FLJA 3PKEA 2B3LA 5JFRA 3FMRA 2GGCA 2Q8KA 5CDVA 4RZYA 3PEBA 2EVMA 4PNCA 4ZWUA 1QZYA 3BITA 4IPAA 2GGBA 4IKTA 2BH3A 3OOOA 3OVKA 3CB6A 2GU7A 2BHCA 1PV9A 3BIQA 1N51A 4U71A 3PKCA 1XNZA 1YW9A 4U70A 4IU6A 2MATA 2BN7A 2BHAA 4S2RP 4FO7A 2Q93A 2GA2A 4EGEA 2GU5A 2GU4A 5FCFA 1C23A 2BHBA 4QR8A 4S01A 4U6EA 4ZNGA 3MATA 5CIKA 2ADUA 4KM3A 1WL6A 1R5HA 2V3ZA 4RZZA 1YVMA 2G6PA 3TAVA 1C22A 1W7VA 2BWVA 3BIPA 3I7MA 1WLRA 1QXWA 4FLLA 4IECA 3IG4A 1JAWA 4PV4A 1B6AA 2BB7A 1KP0A 3FMQA 2EVOA 2V6CA 1C21A 3D27A 1C27A 2ZSGA 4B28A 2EVCA 3PKBA 2OKNA 4U75A 4MATA 5JHUA 1WBQA 2BHDA 4U1BA 1M35A 1YJ3A 3PKDA 1WKMA 5CNXA 2V3XA 2GG5A 3PKAA 4FLKA 1WL9A 4IF7A 2GG2A 4IKUA 1XGNA 2BWUA 1B59A 1BOAA 1QXZA 1QXYA 2BWSA 2GG9A 3CTZA 2GU6A 3RVAA 1XGSA 5E2CA 1BN5A 4RGZ1 3IL0A 2Q94A 4U6JA 2BWXA 3IU7A 2NQ6A 4IDYA 2P98A 4HXXA 4S2TP 3IU8A 2GZ5A 2BWWA 3O5VA 5CE6A 3L24A 1KQ0A 3QOCA 3L7GA 4U76A 4Z7MA 3Q6DA 2Q95A 2Q96A 1R5GA 2BWTA 5FCHA 4IKRA 4U6WA 4S00A 4FLIA 2HOWA 2GG3A 1A16A 3IU9A 5E5BA 2DFIA 4FUKA 1YW7A 1MATA 3FM3A 2B3HA 5CDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG7 A;  2GTX A;  3S6B A;  1R58 A;  4IKS A;  4A6V A;  2OAZ A;  3CB5 A;  4FO8 A;  1CHM A;  4U69 A;  2V3Y A;  2P99 A;  2B3K A;  4R60 A;  3TB5 A;  2GG8 A;  4OOK A;  1KQ9 A;  4FKC A;  2IW2 A;  5JI6 A;  4U6C A;  3PN9 A;  1XGO A;  1XGM A;  5CLS A;  1O0X A;  4U73 A;  2BWY A;  5CDE A;  2GG0 A;  2Q92 A;  1Y1N A;  4JUQ A;  4ZWO A;  5D6F A;  2EA4 A;  1WN1 A;  1WY2 A;  1W2M A;  4ZWP A;  2EA2 A;  2NQ7 A;  3MR1 A;  4U6Z A;  1YW8 A;  5D6E A;  4A6W A;  1C24 A;  2P9A A;  3MX6 A;  3ROR A;  4FLJ A;  3PKE A;  2B3L A;  5JFR A;  3FMR A;  2GGC A;  2Q8K A;  5CDV A;  4RZY A;  3PEB A;  2EVM A;  4PNC A;  4ZWU A;  1QZY A;  3BIT A;  4IPA A;  2GGB A;  4IKT A;  2BH3 A;  3OOO A;  3OVK A;  3CB6 A;  2GU7 A;  2BHC A;  1PV9 A;  3BIQ A;  1N51 A;  4U71 A;  3PKC A;  1XNZ A;  1YW9 A;  4U70 A;  4IU6 A;  2MAT A;  2BN7 A;  2BHA A;  4S2R P;  4FO7 A;  2Q93 A;  2GA2 A;  4EGE A;  2GU5 A;  2GU4 A;  5FCF A;  1C23 A;  2BHB A;  4QR8 A;  4S01 A;  4U6E A;  4ZNG A;  3MAT A;  5CIK A;  2ADU A;  4KM3 A;  1WL6 A;  1R5H A;  2V3Z A;  4RZZ A;  1YVM A;  2G6P A;  3TAV A;  1C22 A;  1W7V A;  2BWV A;  3BIP A;  3I7M A;  1WLR A;  1QXW A;  4FLL A;  4IEC A;  3IG4 A;  1JAW A;  4PV4 A;  1B6A A;  2BB7 A;  1KP0 A;  3FMQ A;  2EVO A;  2V6C A;  1C21 A;  3D27 A;  1C27 A;  2ZSG A;  4B28 A;  2EVC A;  3PKB A;  2OKN A;  4U75 A;  4MAT A;  5JHU A;  1WBQ A;  2BHD A;  4U1B A;  1M35 A;  1YJ3 A;  3PKD A;  1WKM A;  5CNX A;  2V3X A;  2GG5 A;  3PKA A;  4FLK A;  1WL9 A;  4IF7 A;  2GG2 A;  4IKU A;  1XGN A;  2BWU A;  1B59 A;  1BOA A;  1QXZ A;  1QXY A;  2BWS A;  2GG9 A;  3CTZ A;  2GU6 A;  3RVA A;  1XGS A;  5E2C A;  1BN5 A;  4RGZ 1;  3IL0 A;  2Q94 A;  4U6J A;  2BWX A;  3IU7 A;  2NQ6 A;  4IDY A;  2P98 A;  4HXX A;  4S2T P;  3IU8 A;  2GZ5 A;  2BWW A;  3O5V A;  5CE6 A;  3L24 A;  1KQ0 A;  3QOC A;  3L7G A;  4U76 A;  4Z7M A;  3Q6D A;  2Q95 A;  2Q96 A;  1R5G A;  2BWT A;  5FCH A;  4IKR A;  4U6W A;  4S00 A;  4FLI A;  2HOW A;  2GG3 A;  1A16 A;  3IU9 A;  5E5B A;  2DFI A;  4FUK A;  1YW7 A;  1MAT A;  3FM3 A;  2B3H A;  5CDL A; 
#chains in the Genus database with same CATH topology
 2GG7 A;  2GTX A;  3S6B A;  1R58 A;  4IKS A;  4A6V A;  2OAZ A;  3CB5 A;  4FO8 A;  1CHM A;  4U69 A;  2V3Y A;  2P99 A;  2B3K A;  4R60 A;  3TB5 A;  2GG8 A;  4OOK A;  1KQ9 A;  4FKC A;  2IW2 A;  5JI6 A;  4U6C A;  3PN9 A;  1XGO A;  1XGM A;  5CLS A;  1O0X A;  4U73 A;  2BWY A;  5CDE A;  2GG0 A;  2Q92 A;  1Y1N A;  4JUQ A;  4ZWO A;  5D6F A;  2EA4 A;  1WN1 A;  1WY2 A;  1W2M A;  4ZWP A;  2EA2 A;  2NQ7 A;  3MR1 A;  4U6Z A;  1YW8 A;  5D6E A;  4A6W A;  1C24 A;  2P9A A;  3MX6 A;  3ROR A;  4FLJ A;  3PKE A;  2B3L A;  5JFR A;  3FMR A;  2GGC A;  2Q8K A;  5CDV A;  4RZY A;  3PEB A;  2EVM A;  4PNC A;  4ZWU A;  1QZY A;  3BIT A;  4IPA A;  2GGB A;  4IKT A;  2BH3 A;  3OOO A;  3OVK A;  3CB6 A;  2GU7 A;  2BHC A;  1PV9 A;  3BIQ A;  1N51 A;  4U71 A;  3PKC A;  1XNZ A;  1YW9 A;  4U70 A;  4IU6 A;  2MAT A;  2BN7 A;  2BHA A;  4S2R P;  4FO7 A;  2Q93 A;  2GA2 A;  4EGE A;  2GU5 A;  2GU4 A;  5FCF A;  1C23 A;  2BHB A;  4QR8 A;  4S01 A;  4U6E A;  4ZNG A;  3MAT A;  5CIK A;  2ADU A;  4KM3 A;  1WL6 A;  1R5H A;  2V3Z A;  4RZZ A;  1YVM A;  2G6P A;  3TAV A;  1C22 A;  1W7V A;  2BWV A;  3BIP A;  3I7M A;  1WLR A;  1QXW A;  4FLL A;  4IEC A;  3IG4 A;  1JAW A;  4PV4 A;  1B6A A;  2BB7 A;  1KP0 A;  3FMQ A;  2EVO A;  2V6C A;  1C21 A;  3D27 A;  1C27 A;  2ZSG A;  4B28 A;  2EVC A;  3PKB A;  2OKN A;  4U75 A;  4MAT A;  5JHU A;  1WBQ A;  2BHD A;  4U1B A;  1M35 A;  1YJ3 A;  3PKD A;  1WKM A;  5CNX A;  2V3X A;  2GG5 A;  3PKA A;  4FLK A;  1WL9 A;  4IF7 A;  2GG2 A;  4IKU A;  1XGN A;  2BWU A;  1B59 A;  1BOA A;  1QXZ A;  1QXY A;  2BWS A;  2GG9 A;  3CTZ A;  2GU6 A;  3RVA A;  1XGS A;  5E2C A;  1BN5 A;  4RGZ 1;  3IL0 A;  2Q94 A;  4U6J A;  2BWX A;  3IU7 A;  2NQ6 A;  4IDY A;  2P98 A;  4HXX A;  4S2T P;  3IU8 A;  2GZ5 A;  2BWW A;  3O5V A;  5CE6 A;  3L24 A;  1KQ0 A;  3QOC A;  3L7G A;  4U76 A;  4Z7M A;  3Q6D A;  2Q95 A;  2Q96 A;  1R5G A;  2BWT A;  5FCH A;  4IKR A;  4U6W A;  4S00 A;  4FLI A;  2HOW A;  2GG3 A;  1A16 A;  3IU9 A;  5E5B A;  2DFI A;  4FUK A;  1YW7 A;  1MAT A;  3FM3 A;  2B3H A;  5CDL A; 
#chains in the Genus database with same CATH homology
 2GG7 A;  2GTX A;  3S6B A;  1R58 A;  4IKS A;  4A6V A;  2OAZ A;  3CB5 A;  4FO8 A;  1CHM A;  4U69 A;  2V3Y A;  2P99 A;  2B3K A;  4R60 A;  3TB5 A;  2GG8 A;  4OOK A;  1KQ9 A;  4FKC A;  2IW2 A;  5JI6 A;  4U6C A;  3PN9 A;  1XGO A;  1XGM A;  5CLS A;  1O0X A;  4U73 A;  2BWY A;  5CDE A;  2GG0 A;  2Q92 A;  1Y1N A;  4JUQ A;  4ZWO A;  5D6F A;  2EA4 A;  1WN1 A;  1WY2 A;  1W2M A;  4ZWP A;  2EA2 A;  2NQ7 A;  3MR1 A;  4U6Z A;  1YW8 A;  5D6E A;  4A6W A;  1C24 A;  2P9A A;  3MX6 A;  3ROR A;  4FLJ A;  3PKE A;  2B3L A;  5JFR A;  3FMR A;  2GGC A;  2Q8K A;  5CDV A;  4RZY A;  3PEB A;  2EVM A;  4PNC A;  4ZWU A;  1QZY A;  3BIT A;  4IPA A;  2GGB A;  4IKT A;  2BH3 A;  3OOO A;  3OVK A;  3CB6 A;  2GU7 A;  2BHC A;  1PV9 A;  3BIQ A;  1N51 A;  4U71 A;  3PKC A;  1XNZ A;  1YW9 A;  4U70 A;  4IU6 A;  2MAT A;  2BN7 A;  2BHA A;  4S2R P;  4FO7 A;  2Q93 A;  2GA2 A;  4EGE A;  2GU5 A;  2GU4 A;  5FCF A;  1C23 A;  2BHB A;  4QR8 A;  4S01 A;  4U6E A;  4ZNG A;  3MAT A;  5CIK A;  2ADU A;  4KM3 A;  1WL6 A;  1R5H A;  2V3Z A;  4RZZ A;  1YVM A;  2G6P A;  3TAV A;  1C22 A;  1W7V A;  2BWV A;  3BIP A;  3I7M A;  1WLR A;  1QXW A;  4FLL A;  4IEC A;  3IG4 A;  1JAW A;  4PV4 A;  1B6A A;  2BB7 A;  1KP0 A;  3FMQ A;  2EVO A;  2V6C A;  1C21 A;  3D27 A;  1C27 A;  2ZSG A;  4B28 A;  2EVC A;  3PKB A;  2OKN A;  4U75 A;  4MAT A;  5JHU A;  1WBQ A;  2BHD A;  4U1B A;  1M35 A;  1YJ3 A;  3PKD A;  1WKM A;  5CNX A;  2V3X A;  2GG5 A;  3PKA A;  4FLK A;  1WL9 A;  4IF7 A;  2GG2 A;  4IKU A;  1XGN A;  2BWU A;  1B59 A;  1BOA A;  1QXZ A;  1QXY A;  2BWS A;  2GG9 A;  3CTZ A;  2GU6 A;  3RVA A;  1XGS A;  5E2C A;  1BN5 A;  4RGZ 1;  3IL0 A;  2Q94 A;  4U6J A;  2BWX A;  3IU7 A;  2NQ6 A;  4IDY A;  2P98 A;  4HXX A;  4S2T P;  3IU8 A;  2GZ5 A;  2BWW A;  3O5V A;  5CE6 A;  3L24 A;  1KQ0 A;  3QOC A;  3L7G A;  4U76 A;  4Z7M A;  3Q6D A;  2Q95 A;  2Q96 A;  1R5G A;  2BWT A;  5FCH A;  4IKR A;  4U6W A;  4S00 A;  4FLI A;  2HOW A;  2GG3 A;  1A16 A;  3IU9 A;  5E5B A;  2DFI A;  4FUK A;  1YW7 A;  1MAT A;  3FM3 A;  2B3H A;  5CDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...