1WL9A

Structure of aminopeptidase p from e. coli
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 156
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wl9A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wl9A02
2P9AA 3TAVA 2OKNA 2GU7A 4U6WA 1BN5A 1QZYA 4ZNGA 2GG7A 2MATA 4U6EA 2Q8KA 1B59A 1W7VA 2Q94A 4IU6A 1WLRA 2GGCA 2GG9A 1A16A 4HXXA 4FLKA 4IECA 3FMRA 1KQ9A 3RORA 4IF7A 3CB5A 4QR8A 2V3ZA 5CDVA 4IKRA 1BOAA 2GG0A 3IG4A 2V3XA 4IKTA 1B6AA 4FO7A 1CHMA 1WN1A 4U1BA 3PKAA 5D6FA 5FCFA 4ZWUA 1W2MA 3IU9A 2GU6A 1QXZA 1YW7A 3FMQA 1WKMA 2GGBA 5D6EA 1WBQA 1KP0A 2IW2A 2EA2A 1R5HA 2GG3A 3PN9A 2GZ5A 4JUQA 3OOOA 2GG5A 2EA4A 2BH3A 2GG8A 2V6CA 3L7GA 3BIQA 1YJ3A 3MATA 4S2RP 3CB6A 2Q93A 4FLIA 4IDYA 4U6JA 4S01A 4PV4A 2EVCA 4FKCA 4PNCA 5FCHA 1WL9A 3IL0A 1O0XA 1Y1NA 3PKDA 2P99A 2Q96A 2BB7A 2EVMA 2BWVA 2GU4A 2BWYA 1XGMA 5CNXA 3MR1A 4U69A 5CLSA 2NQ6A 4S00A 4U6CA 2BHCA 4IKSA 3L24A 2P98A 2BWTA 3S6BA 2BWUA 4FUKA 1PV9A 2ZSGA 2GA2A 3CTZA 2GG2A 4OOKA 4R60A 2DFIA 1R5GA 2B3HA 4Z7MA 2EVOA 4U73A 3PKEA 1QXWA 3PKCA 5JFRA 3BITA 2BN7A 1YW9A 4IPAA 1JAWA 2GU5A 1QXYA 1XGSA 4U71A 1M35A 4U6ZA 5E5BA 4FO8A 1C21A 3MX6A 4A6VA 2BWWA 4U76A 4U70A 3RVAA 2G6PA 1C22A 3PKBA 2BWXA 3FM3A 2HOWA 4FLLA 5CDEA 2ADUA 3D27A 4FLJA 3Q6DA 2OAZA 4KM3A 5CE6A 2Q92A 2BHAA 5JHUA 3OVKA 4ZWPA 4S2TP 2BWSA 4B28A 1XNZA 2B3KA 2Q95A 4MATA 5E2CA 3IU7A 3I7MA 1WL6A 1R58A 2V3YA 4RGZ1 4RZYA 3TB5A 4EGEA 3QOCA 4IKUA 1YW8A 1XGOA 4U75A 2NQ7A 1C27A 1N51A 4RZZA 1WY2A 4A6WA 4ZWOA 3PEBA 1XGNA 1YVMA 5JI6A 1C24A 2BHBA 3IU8A 1KQ0A 2GTXA 3BIPA 1MATA 3O5VA 5CDLA 2BHDA 2B3LA 5CIKA 1C23A
chains in the Genus database with same CATH superfamily
2P9AA 3TAVA 2OKNA 2GU7A 4U6WA 1BN5A 1QZYA 4ZNGA 2GG7A 2MATA 4U6EA 2Q8KA 1B59A 1W7VA 2Q94A 4IU6A 1WLRA 2GGCA 2GG9A 1A16A 4HXXA 4FLKA 4IECA 3FMRA 1KQ9A 3RORA 4IF7A 3CB5A 4QR8A 2V3ZA 5CDVA 4IKRA 1BOAA 2GG0A 3IG4A 2V3XA 4IKTA 1B6AA 4FO7A 1CHMA 1WN1A 4U1BA 3PKAA 5D6FA 5FCFA 4ZWUA 1W2MA 3IU9A 2GU6A 1QXZA 1YW7A 3FMQA 1WKMA 2GGBA 5D6EA 1WBQA 1KP0A 2IW2A 2EA2A 1R5HA 2GG3A 3PN9A 2GZ5A 4JUQA 3OOOA 2GG5A 2EA4A 2BH3A 2GG8A 2V6CA 3L7GA 3BIQA 1YJ3A 3MATA 4S2RP 3CB6A 2Q93A 4FLIA 4IDYA 4U6JA 4S01A 4PV4A 2EVCA 4FKCA 4PNCA 5FCHA 1WL9A 3IL0A 1O0XA 1Y1NA 3PKDA 2P99A 2Q96A 2BB7A 2EVMA 2BWVA 2GU4A 2BWYA 1XGMA 5CNXA 3MR1A 4U69A 5CLSA 2NQ6A 4S00A 4U6CA 2BHCA 4IKSA 3L24A 2P98A 2BWTA 3S6BA 2BWUA 4FUKA 1PV9A 2ZSGA 2GA2A 3CTZA 2GG2A 4OOKA 4R60A 2DFIA 1R5GA 2B3HA 4Z7MA 2EVOA 4U73A 3PKEA 1QXWA 3PKCA 5JFRA 3BITA 2BN7A 1YW9A 4IPAA 1JAWA 2GU5A 1QXYA 1XGSA 4U71A 1M35A 4U6ZA 5E5BA 4FO8A 1C21A 3MX6A 4A6VA 2BWWA 4U76A 4U70A 3RVAA 2G6PA 1C22A 3PKBA 2BWXA 3FM3A 2HOWA 4FLLA 5CDEA 2ADUA 3D27A 4FLJA 3Q6DA 2OAZA 4KM3A 5CE6A 2Q92A 2BHAA 5JHUA 3OVKA 4ZWPA 4S2TP 2BWSA 4B28A 1XNZA 2B3KA 2Q95A 4MATA 5E2CA 3IU7A 3I7MA 1WL6A 1R58A 2V3YA 4RGZ1 4RZYA 3TB5A 4EGEA 3QOCA 4IKUA 1YW8A 1XGOA 4U75A 2NQ7A 1C27A 1N51A 4RZZA 1WY2A 4A6WA 4ZWOA 3PEBA 1XGNA 1YVMA 5JI6A 1C24A 2BHBA 3IU8A 1KQ0A 2GTXA 3BIPA 1MATA 3O5VA 5CDLA 2BHDA 2B3LA 5CIKA 1C23A
chains in the Genus database with same CATH topology
2P9AA 3TAVA 2OKNA 2GU7A 4U6WA 1BN5A 1QZYA 4ZNGA 2GG7A 2MATA 4U6EA 2Q8KA 1B59A 1W7VA 2Q94A 4IU6A 1WLRA 2GGCA 2GG9A 1A16A 4HXXA 4FLKA 4IECA 3FMRA 1KQ9A 3RORA 4IF7A 3CB5A 4QR8A 2V3ZA 5CDVA 4IKRA 1BOAA 2GG0A 3IG4A 2V3XA 4IKTA 1B6AA 4FO7A 1CHMA 1WN1A 4U1BA 3PKAA 5D6FA 5FCFA 4ZWUA 1W2MA 3IU9A 2GU6A 1QXZA 1YW7A 3FMQA 1WKMA 2GGBA 5D6EA 1WBQA 1KP0A 2IW2A 2EA2A 1R5HA 2GG3A 3PN9A 2GZ5A 4JUQA 3OOOA 2GG5A 2EA4A 2BH3A 2GG8A 2V6CA 3L7GA 3BIQA 1YJ3A 3MATA 4S2RP 3CB6A 2Q93A 4FLIA 4IDYA 4U6JA 4S01A 4PV4A 2EVCA 4FKCA 4PNCA 5FCHA 1WL9A 3IL0A 1O0XA 1Y1NA 3PKDA 2P99A 2Q96A 2BB7A 2EVMA 2BWVA 2GU4A 2BWYA 1XGMA 5CNXA 3MR1A 4U69A 5CLSA 2NQ6A 4S00A 4U6CA 2BHCA 4IKSA 3L24A 2P98A 2BWTA 3S6BA 2BWUA 4FUKA 1PV9A 2ZSGA 2GA2A 3CTZA 2GG2A 4OOKA 4R60A 2DFIA 1R5GA 2B3HA 4Z7MA 2EVOA 4U73A 3PKEA 1QXWA 3PKCA 5JFRA 3BITA 2BN7A 1YW9A 4IPAA 1JAWA 2GU5A 1QXYA 1XGSA 4U71A 1M35A 4U6ZA 5E5BA 4FO8A 1C21A 3MX6A 4A6VA 2BWWA 4U76A 4U70A 3RVAA 2G6PA 1C22A 3PKBA 2BWXA 3FM3A 2HOWA 4FLLA 5CDEA 2ADUA 3D27A 4FLJA 3Q6DA 2OAZA 4KM3A 5CE6A 2Q92A 2BHAA 5JHUA 3OVKA 4ZWPA 4S2TP 2BWSA 4B28A 1XNZA 2B3KA 2Q95A 4MATA 5E2CA 3IU7A 3I7MA 1WL6A 1R58A 2V3YA 4RGZ1 4RZYA 3TB5A 4EGEA 3QOCA 4IKUA 1YW8A 1XGOA 4U75A 2NQ7A 1C27A 1N51A 4RZZA 1WY2A 4A6WA 4ZWOA 3PEBA 1XGNA 1YVMA 5JI6A 1C24A 2BHBA 3IU8A 1KQ0A 2GTXA 3BIPA 1MATA 3O5VA 5CDLA 2BHDA 2B3LA 5CIKA 1C23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P9A A;  3TAV A;  2OKN A;  2GU7 A;  4U6W A;  1BN5 A;  1QZY A;  4ZNG A;  2GG7 A;  2MAT A;  4U6E A;  2Q8K A;  1B59 A;  1W7V A;  2Q94 A;  4IU6 A;  1WLR A;  2GGC A;  2GG9 A;  1A16 A;  4HXX A;  4FLK A;  4IEC A;  3FMR A;  1KQ9 A;  3ROR A;  4IF7 A;  3CB5 A;  4QR8 A;  2V3Z A;  5CDV A;  4IKR A;  1BOA A;  2GG0 A;  3IG4 A;  2V3X A;  4IKT A;  1B6A A;  4FO7 A;  1CHM A;  1WN1 A;  4U1B A;  3PKA A;  5D6F A;  5FCF A;  4ZWU A;  1W2M A;  3IU9 A;  2GU6 A;  1QXZ A;  1YW7 A;  3FMQ A;  1WKM A;  2GGB A;  5D6E A;  1WBQ A;  1KP0 A;  2IW2 A;  2EA2 A;  1R5H A;  2GG3 A;  3PN9 A;  2GZ5 A;  4JUQ A;  3OOO A;  2GG5 A;  2EA4 A;  2BH3 A;  2GG8 A;  2V6C A;  3L7G A;  3BIQ A;  1YJ3 A;  3MAT A;  4S2R P;  3CB6 A;  2Q93 A;  4FLI A;  4IDY A;  4U6J A;  4S01 A;  4PV4 A;  2EVC A;  4FKC A;  4PNC A;  5FCH A;  1WL9 A;  3IL0 A;  1O0X A;  1Y1N A;  3PKD A;  2P99 A;  2Q96 A;  2BB7 A;  2EVM A;  2BWV A;  2GU4 A;  2BWY A;  1XGM A;  5CNX A;  3MR1 A;  4U69 A;  5CLS A;  2NQ6 A;  4S00 A;  4U6C A;  2BHC A;  4IKS A;  3L24 A;  2P98 A;  2BWT A;  3S6B A;  2BWU A;  4FUK A;  1PV9 A;  2ZSG A;  2GA2 A;  3CTZ A;  2GG2 A;  4OOK A;  4R60 A;  2DFI A;  1R5G A;  2B3H A;  4Z7M A;  2EVO A;  4U73 A;  3PKE A;  1QXW A;  3PKC A;  5JFR A;  3BIT A;  2BN7 A;  1YW9 A;  4IPA A;  1JAW A;  2GU5 A;  1QXY A;  1XGS A;  4U71 A;  1M35 A;  4U6Z A;  5E5B A;  4FO8 A;  1C21 A;  3MX6 A;  4A6V A;  2BWW A;  4U76 A;  4U70 A;  3RVA A;  2G6P A;  1C22 A;  3PKB A;  2BWX A;  3FM3 A;  2HOW A;  4FLL A;  5CDE A;  2ADU A;  3D27 A;  4FLJ A;  3Q6D A;  2OAZ A;  4KM3 A;  5CE6 A;  2Q92 A;  2BHA A;  5JHU A;  3OVK A;  4ZWP A;  4S2T P;  2BWS A;  4B28 A;  1XNZ A;  2B3K A;  2Q95 A;  4MAT A;  5E2C A;  3IU7 A;  3I7M A;  1WL6 A;  1R58 A;  2V3Y A;  4RGZ 1;  4RZY A;  3TB5 A;  4EGE A;  3QOC A;  4IKU A;  1YW8 A;  1XGO A;  4U75 A;  2NQ7 A;  1C27 A;  1N51 A;  4RZZ A;  1WY2 A;  4A6W A;  4ZWO A;  3PEB A;  1XGN A;  1YVM A;  5JI6 A;  1C24 A;  2BHB A;  3IU8 A;  1KQ0 A;  2GTX A;  3BIP A;  1MAT A;  3O5V A;  5CDL A;  2BHD A;  2B3L A;  5CIK A;  1C23 A; 
#chains in the Genus database with same CATH topology
 2P9A A;  3TAV A;  2OKN A;  2GU7 A;  4U6W A;  1BN5 A;  1QZY A;  4ZNG A;  2GG7 A;  2MAT A;  4U6E A;  2Q8K A;  1B59 A;  1W7V A;  2Q94 A;  4IU6 A;  1WLR A;  2GGC A;  2GG9 A;  1A16 A;  4HXX A;  4FLK A;  4IEC A;  3FMR A;  1KQ9 A;  3ROR A;  4IF7 A;  3CB5 A;  4QR8 A;  2V3Z A;  5CDV A;  4IKR A;  1BOA A;  2GG0 A;  3IG4 A;  2V3X A;  4IKT A;  1B6A A;  4FO7 A;  1CHM A;  1WN1 A;  4U1B A;  3PKA A;  5D6F A;  5FCF A;  4ZWU A;  1W2M A;  3IU9 A;  2GU6 A;  1QXZ A;  1YW7 A;  3FMQ A;  1WKM A;  2GGB A;  5D6E A;  1WBQ A;  1KP0 A;  2IW2 A;  2EA2 A;  1R5H A;  2GG3 A;  3PN9 A;  2GZ5 A;  4JUQ A;  3OOO A;  2GG5 A;  2EA4 A;  2BH3 A;  2GG8 A;  2V6C A;  3L7G A;  3BIQ A;  1YJ3 A;  3MAT A;  4S2R P;  3CB6 A;  2Q93 A;  4FLI A;  4IDY A;  4U6J A;  4S01 A;  4PV4 A;  2EVC A;  4FKC A;  4PNC A;  5FCH A;  1WL9 A;  3IL0 A;  1O0X A;  1Y1N A;  3PKD A;  2P99 A;  2Q96 A;  2BB7 A;  2EVM A;  2BWV A;  2GU4 A;  2BWY A;  1XGM A;  5CNX A;  3MR1 A;  4U69 A;  5CLS A;  2NQ6 A;  4S00 A;  4U6C A;  2BHC A;  4IKS A;  3L24 A;  2P98 A;  2BWT A;  3S6B A;  2BWU A;  4FUK A;  1PV9 A;  2ZSG A;  2GA2 A;  3CTZ A;  2GG2 A;  4OOK A;  4R60 A;  2DFI A;  1R5G A;  2B3H A;  4Z7M A;  2EVO A;  4U73 A;  3PKE A;  1QXW A;  3PKC A;  5JFR A;  3BIT A;  2BN7 A;  1YW9 A;  4IPA A;  1JAW A;  2GU5 A;  1QXY A;  1XGS A;  4U71 A;  1M35 A;  4U6Z A;  5E5B A;  4FO8 A;  1C21 A;  3MX6 A;  4A6V A;  2BWW A;  4U76 A;  4U70 A;  3RVA A;  2G6P A;  1C22 A;  3PKB A;  2BWX A;  3FM3 A;  2HOW A;  4FLL A;  5CDE A;  2ADU A;  3D27 A;  4FLJ A;  3Q6D A;  2OAZ A;  4KM3 A;  5CE6 A;  2Q92 A;  2BHA A;  5JHU A;  3OVK A;  4ZWP A;  4S2T P;  2BWS A;  4B28 A;  1XNZ A;  2B3K A;  2Q95 A;  4MAT A;  5E2C A;  3IU7 A;  3I7M A;  1WL6 A;  1R58 A;  2V3Y A;  4RGZ 1;  4RZY A;  3TB5 A;  4EGE A;  3QOC A;  4IKU A;  1YW8 A;  1XGO A;  4U75 A;  2NQ7 A;  1C27 A;  1N51 A;  4RZZ A;  1WY2 A;  4A6W A;  4ZWO A;  3PEB A;  1XGN A;  1YVM A;  5JI6 A;  1C24 A;  2BHB A;  3IU8 A;  1KQ0 A;  2GTX A;  3BIP A;  1MAT A;  3O5V A;  5CDL A;  2BHD A;  2B3L A;  5CIK A;  1C23 A; 
#chains in the Genus database with same CATH homology
 2P9A A;  3TAV A;  2OKN A;  2GU7 A;  4U6W A;  1BN5 A;  1QZY A;  4ZNG A;  2GG7 A;  2MAT A;  4U6E A;  2Q8K A;  1B59 A;  1W7V A;  2Q94 A;  4IU6 A;  1WLR A;  2GGC A;  2GG9 A;  1A16 A;  4HXX A;  4FLK A;  4IEC A;  3FMR A;  1KQ9 A;  3ROR A;  4IF7 A;  3CB5 A;  4QR8 A;  2V3Z A;  5CDV A;  4IKR A;  1BOA A;  2GG0 A;  3IG4 A;  2V3X A;  4IKT A;  1B6A A;  4FO7 A;  1CHM A;  1WN1 A;  4U1B A;  3PKA A;  5D6F A;  5FCF A;  4ZWU A;  1W2M A;  3IU9 A;  2GU6 A;  1QXZ A;  1YW7 A;  3FMQ A;  1WKM A;  2GGB A;  5D6E A;  1WBQ A;  1KP0 A;  2IW2 A;  2EA2 A;  1R5H A;  2GG3 A;  3PN9 A;  2GZ5 A;  4JUQ A;  3OOO A;  2GG5 A;  2EA4 A;  2BH3 A;  2GG8 A;  2V6C A;  3L7G A;  3BIQ A;  1YJ3 A;  3MAT A;  4S2R P;  3CB6 A;  2Q93 A;  4FLI A;  4IDY A;  4U6J A;  4S01 A;  4PV4 A;  2EVC A;  4FKC A;  4PNC A;  5FCH A;  1WL9 A;  3IL0 A;  1O0X A;  1Y1N A;  3PKD A;  2P99 A;  2Q96 A;  2BB7 A;  2EVM A;  2BWV A;  2GU4 A;  2BWY A;  1XGM A;  5CNX A;  3MR1 A;  4U69 A;  5CLS A;  2NQ6 A;  4S00 A;  4U6C A;  2BHC A;  4IKS A;  3L24 A;  2P98 A;  2BWT A;  3S6B A;  2BWU A;  4FUK A;  1PV9 A;  2ZSG A;  2GA2 A;  3CTZ A;  2GG2 A;  4OOK A;  4R60 A;  2DFI A;  1R5G A;  2B3H A;  4Z7M A;  2EVO A;  4U73 A;  3PKE A;  1QXW A;  3PKC A;  5JFR A;  3BIT A;  2BN7 A;  1YW9 A;  4IPA A;  1JAW A;  2GU5 A;  1QXY A;  1XGS A;  4U71 A;  1M35 A;  4U6Z A;  5E5B A;  4FO8 A;  1C21 A;  3MX6 A;  4A6V A;  2BWW A;  4U76 A;  4U70 A;  3RVA A;  2G6P A;  1C22 A;  3PKB A;  2BWX A;  3FM3 A;  2HOW A;  4FLL A;  5CDE A;  2ADU A;  3D27 A;  4FLJ A;  3Q6D A;  2OAZ A;  4KM3 A;  5CE6 A;  2Q92 A;  2BHA A;  5JHU A;  3OVK A;  4ZWP A;  4S2T P;  2BWS A;  4B28 A;  1XNZ A;  2B3K A;  2Q95 A;  4MAT A;  5E2C A;  3IU7 A;  3I7M A;  1WL6 A;  1R58 A;  2V3Y A;  4RGZ 1;  4RZY A;  3TB5 A;  4EGE A;  3QOC A;  4IKU A;  1YW8 A;  1XGO A;  4U75 A;  2NQ7 A;  1C27 A;  1N51 A;  4RZZ A;  1WY2 A;  4A6W A;  4ZWO A;  3PEB A;  1XGN A;  1YVM A;  5JI6 A;  1C24 A;  2BHB A;  3IU8 A;  1KQ0 A;  2GTX A;  3BIP A;  1MAT A;  3O5V A;  5CDL A;  2BHD A;  2B3L A;  5CIK A;  1C23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...