1WL9A

Structure of aminopeptidase p from e. coli
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase
total genus 156
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wl9A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wl9A02
3TAVA 1A16A 2ADUA 5CDVA 3TB5A 4MATA 2GG0A 2BB7A 1M35A 4U73A 4U6WA 3CB5A 3L24A 2V3YA 1CHMA 4FKCA 2GG2A 2Q92A 2V6CA 2GU5A 2BWYA 3PKCA 5JI6A 4A6VA 4RZYA 1YW9A 3OVKA 1YW8A 1BOAA 1MATA 4FO8A 3BIQA 5JFRA 5CDEA 1PV9A 3QOCA 1XGSA 1O0XA 3PKBA 4JUQA 5FCHA 1YW7A 4U76A 3S6BA 3PEBA 4R60A 4S00A 4HXXA 1XGOA 3IU7A 2OAZA 2BWXA 3Q6DA 1BN5A 4Z7MA 2BHBA 1WY2A 2V3ZA 2MATA 3PKDA 1WKMA 1XGNA 2GU4A 3O5VA 4FLKA 5E5BA 2G6PA 4FLLA 2Q93A 1W7VA 4ZWOA 3CB6A 4S01A 1KQ9A 1W2MA 2V3XA 3FMQA 1KQ0A 4IDYA 4FLJA 4A6WA 2NQ6A 4QR8A 1WLRA 1KP0A 4IKSA 4U70A 1XGMA 2GTXA 2IW2A 2EA2A 4S2TP 4B28A 4U69A 3L7GA 4IF7A 2GG3A 1YJ3A 2EA4A 4RZZA 2GGCA 2BHAA 3IL0A 3OOOA 2GG8A 1YVMA 1WL6A 2GG7A 2EVMA 2Q95A 3MR1A 4FUKA 4U6ZA 2EVOA 2BWVA 2DFIA 5CIKA 2GG5A 3RORA 2BWWA 3BIPA 5CNXA 4ZWPA 1R5HA 4EGEA 1XNZA 2B3HA 4IECA 3MX6A 3I7MA 5E2CA 3PN9A 1WN1A 2GU7A 1R58A 3PKAA 2OKNA 1QXYA 4FLIA 4U1BA 2B3KA 1R5GA 2BHCA 2BHDA 4KM3A 1B59A 1C22A 5CE6A 4PNCA 4ZNGA 1QZYA 3MATA 1C27A 4U71A 1JAWA 2P98A 2GG9A 4IKTA 5D6EA 2BWUA 3RVAA 2B3LA 2Q94A 5JHUA 4RGZ1 3CTZA 4ZWUA 2HOWA 3IU8A 4PV4A 3FM3A 4IKRA 4IPAA 2ZSGA 1WBQA 1C23A 2P9AA 4FO7A 2NQ7A 1N51A 4U6EA 2GA2A 4U6JA 3D27A 4OOKA 2BN7A 3BITA 5CDLA 1WL9A 3IG4A 1Y1NA 3FMRA 2GGBA 2P99A 4IU6A 1B6AA 1C24A 2Q96A 2BWTA 4S2RP 3IU9A 4IKUA 2GU6A 4U6CA 5FCFA 5CLSA 2GZ5A 5D6FA 3PKEA 1C21A 2BH3A 1QXWA 2BWSA 4U75A 2EVCA 2Q8KA 1QXZA
chains in the Genus database with same CATH superfamily
3TAVA 1A16A 2ADUA 5CDVA 3TB5A 4MATA 2GG0A 2BB7A 1M35A 4U73A 4U6WA 3CB5A 3L24A 2V3YA 1CHMA 4FKCA 2GG2A 2Q92A 2V6CA 2GU5A 2BWYA 3PKCA 5JI6A 4A6VA 4RZYA 1YW9A 3OVKA 1YW8A 1BOAA 1MATA 4FO8A 3BIQA 5JFRA 5CDEA 1PV9A 3QOCA 1XGSA 1O0XA 3PKBA 4JUQA 5FCHA 1YW7A 4U76A 3S6BA 3PEBA 4R60A 4S00A 4HXXA 1XGOA 3IU7A 2OAZA 2BWXA 3Q6DA 1BN5A 4Z7MA 2BHBA 1WY2A 2V3ZA 2MATA 3PKDA 1WKMA 1XGNA 2GU4A 3O5VA 4FLKA 5E5BA 2G6PA 4FLLA 2Q93A 1W7VA 4ZWOA 3CB6A 4S01A 1KQ9A 1W2MA 2V3XA 3FMQA 1KQ0A 4IDYA 4FLJA 4A6WA 2NQ6A 4QR8A 1WLRA 1KP0A 4IKSA 4U70A 1XGMA 2GTXA 2IW2A 2EA2A 4S2TP 4B28A 4U69A 3L7GA 4IF7A 2GG3A 1YJ3A 2EA4A 4RZZA 2GGCA 2BHAA 3IL0A 3OOOA 2GG8A 1YVMA 1WL6A 2GG7A 2EVMA 2Q95A 3MR1A 4FUKA 4U6ZA 2EVOA 2BWVA 2DFIA 5CIKA 2GG5A 3RORA 2BWWA 3BIPA 5CNXA 4ZWPA 1R5HA 4EGEA 1XNZA 2B3HA 4IECA 3MX6A 3I7MA 5E2CA 3PN9A 1WN1A 2GU7A 1R58A 3PKAA 2OKNA 1QXYA 4FLIA 4U1BA 2B3KA 1R5GA 2BHCA 2BHDA 4KM3A 1B59A 1C22A 5CE6A 4PNCA 4ZNGA 1QZYA 3MATA 1C27A 4U71A 1JAWA 2P98A 2GG9A 4IKTA 5D6EA 2BWUA 3RVAA 2B3LA 2Q94A 5JHUA 4RGZ1 3CTZA 4ZWUA 2HOWA 3IU8A 4PV4A 3FM3A 4IKRA 4IPAA 2ZSGA 1WBQA 1C23A 2P9AA 4FO7A 2NQ7A 1N51A 4U6EA 2GA2A 4U6JA 3D27A 4OOKA 2BN7A 3BITA 5CDLA 1WL9A 3IG4A 1Y1NA 3FMRA 2GGBA 2P99A 4IU6A 1B6AA 1C24A 2Q96A 2BWTA 4S2RP 3IU9A 4IKUA 2GU6A 4U6CA 5FCFA 5CLSA 2GZ5A 5D6FA 3PKEA 1C21A 2BH3A 1QXWA 2BWSA 4U75A 2EVCA 2Q8KA 1QXZA
chains in the Genus database with same CATH topology
3TAVA 1A16A 2ADUA 5CDVA 3TB5A 4MATA 2GG0A 2BB7A 1M35A 4U73A 4U6WA 3CB5A 3L24A 2V3YA 1CHMA 4FKCA 2GG2A 2Q92A 2V6CA 2GU5A 2BWYA 3PKCA 5JI6A 4A6VA 4RZYA 1YW9A 3OVKA 1YW8A 1BOAA 1MATA 4FO8A 3BIQA 5JFRA 5CDEA 1PV9A 3QOCA 1XGSA 1O0XA 3PKBA 4JUQA 5FCHA 1YW7A 4U76A 3S6BA 3PEBA 4R60A 4S00A 4HXXA 1XGOA 3IU7A 2OAZA 2BWXA 3Q6DA 1BN5A 4Z7MA 2BHBA 1WY2A 2V3ZA 2MATA 3PKDA 1WKMA 1XGNA 2GU4A 3O5VA 4FLKA 5E5BA 2G6PA 4FLLA 2Q93A 1W7VA 4ZWOA 3CB6A 4S01A 1KQ9A 1W2MA 2V3XA 3FMQA 1KQ0A 4IDYA 4FLJA 4A6WA 2NQ6A 4QR8A 1WLRA 1KP0A 4IKSA 4U70A 1XGMA 2GTXA 2IW2A 2EA2A 4S2TP 4B28A 4U69A 3L7GA 4IF7A 2GG3A 1YJ3A 2EA4A 4RZZA 2GGCA 2BHAA 3IL0A 3OOOA 2GG8A 1YVMA 1WL6A 2GG7A 2EVMA 2Q95A 3MR1A 4FUKA 4U6ZA 2EVOA 2BWVA 2DFIA 5CIKA 2GG5A 3RORA 2BWWA 3BIPA 5CNXA 4ZWPA 1R5HA 4EGEA 1XNZA 2B3HA 4IECA 3MX6A 3I7MA 5E2CA 3PN9A 1WN1A 2GU7A 1R58A 3PKAA 2OKNA 1QXYA 4FLIA 4U1BA 2B3KA 1R5GA 2BHCA 2BHDA 4KM3A 1B59A 1C22A 5CE6A 4PNCA 4ZNGA 1QZYA 3MATA 1C27A 4U71A 1JAWA 2P98A 2GG9A 4IKTA 5D6EA 2BWUA 3RVAA 2B3LA 2Q94A 5JHUA 4RGZ1 3CTZA 4ZWUA 2HOWA 3IU8A 4PV4A 3FM3A 4IKRA 4IPAA 2ZSGA 1WBQA 1C23A 2P9AA 4FO7A 2NQ7A 1N51A 4U6EA 2GA2A 4U6JA 3D27A 4OOKA 2BN7A 3BITA 5CDLA 1WL9A 3IG4A 1Y1NA 3FMRA 2GGBA 2P99A 4IU6A 1B6AA 1C24A 2Q96A 2BWTA 4S2RP 3IU9A 4IKUA 2GU6A 4U6CA 5FCFA 5CLSA 2GZ5A 5D6FA 3PKEA 1C21A 2BH3A 1QXWA 2BWSA 4U75A 2EVCA 2Q8KA 1QXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TAV A;  1A16 A;  2ADU A;  5CDV A;  3TB5 A;  4MAT A;  2GG0 A;  2BB7 A;  1M35 A;  4U73 A;  4U6W A;  3CB5 A;  3L24 A;  2V3Y A;  1CHM A;  4FKC A;  2GG2 A;  2Q92 A;  2V6C A;  2GU5 A;  2BWY A;  3PKC A;  5JI6 A;  4A6V A;  4RZY A;  1YW9 A;  3OVK A;  1YW8 A;  1BOA A;  1MAT A;  4FO8 A;  3BIQ A;  5JFR A;  5CDE A;  1PV9 A;  3QOC A;  1XGS A;  1O0X A;  3PKB A;  4JUQ A;  5FCH A;  1YW7 A;  4U76 A;  3S6B A;  3PEB A;  4R60 A;  4S00 A;  4HXX A;  1XGO A;  3IU7 A;  2OAZ A;  2BWX A;  3Q6D A;  1BN5 A;  4Z7M A;  2BHB A;  1WY2 A;  2V3Z A;  2MAT A;  3PKD A;  1WKM A;  1XGN A;  2GU4 A;  3O5V A;  4FLK A;  5E5B A;  2G6P A;  4FLL A;  2Q93 A;  1W7V A;  4ZWO A;  3CB6 A;  4S01 A;  1KQ9 A;  1W2M A;  2V3X A;  3FMQ A;  1KQ0 A;  4IDY A;  4FLJ A;  4A6W A;  2NQ6 A;  4QR8 A;  1WLR A;  1KP0 A;  4IKS A;  4U70 A;  1XGM A;  2GTX A;  2IW2 A;  2EA2 A;  4S2T P;  4B28 A;  4U69 A;  3L7G A;  4IF7 A;  2GG3 A;  1YJ3 A;  2EA4 A;  4RZZ A;  2GGC A;  2BHA A;  3IL0 A;  3OOO A;  2GG8 A;  1YVM A;  1WL6 A;  2GG7 A;  2EVM A;  2Q95 A;  3MR1 A;  4FUK A;  4U6Z A;  2EVO A;  2BWV A;  2DFI A;  5CIK A;  2GG5 A;  3ROR A;  2BWW A;  3BIP A;  5CNX A;  4ZWP A;  1R5H A;  4EGE A;  1XNZ A;  2B3H A;  4IEC A;  3MX6 A;  3I7M A;  5E2C A;  3PN9 A;  1WN1 A;  2GU7 A;  1R58 A;  3PKA A;  2OKN A;  1QXY A;  4FLI A;  4U1B A;  2B3K A;  1R5G A;  2BHC A;  2BHD A;  4KM3 A;  1B59 A;  1C22 A;  5CE6 A;  4PNC A;  4ZNG A;  1QZY A;  3MAT A;  1C27 A;  4U71 A;  1JAW A;  2P98 A;  2GG9 A;  4IKT A;  5D6E A;  2BWU A;  3RVA A;  2B3L A;  2Q94 A;  5JHU A;  4RGZ 1;  3CTZ A;  4ZWU A;  2HOW A;  3IU8 A;  4PV4 A;  3FM3 A;  4IKR A;  4IPA A;  2ZSG A;  1WBQ A;  1C23 A;  2P9A A;  4FO7 A;  2NQ7 A;  1N51 A;  4U6E A;  2GA2 A;  4U6J A;  3D27 A;  4OOK A;  2BN7 A;  3BIT A;  5CDL A;  1WL9 A;  3IG4 A;  1Y1N A;  3FMR A;  2GGB A;  2P99 A;  4IU6 A;  1B6A A;  1C24 A;  2Q96 A;  2BWT A;  4S2R P;  3IU9 A;  4IKU A;  2GU6 A;  4U6C A;  5FCF A;  5CLS A;  2GZ5 A;  5D6F A;  3PKE A;  1C21 A;  2BH3 A;  1QXW A;  2BWS A;  4U75 A;  2EVC A;  2Q8K A;  1QXZ A; 
#chains in the Genus database with same CATH topology
 3TAV A;  1A16 A;  2ADU A;  5CDV A;  3TB5 A;  4MAT A;  2GG0 A;  2BB7 A;  1M35 A;  4U73 A;  4U6W A;  3CB5 A;  3L24 A;  2V3Y A;  1CHM A;  4FKC A;  2GG2 A;  2Q92 A;  2V6C A;  2GU5 A;  2BWY A;  3PKC A;  5JI6 A;  4A6V A;  4RZY A;  1YW9 A;  3OVK A;  1YW8 A;  1BOA A;  1MAT A;  4FO8 A;  3BIQ A;  5JFR A;  5CDE A;  1PV9 A;  3QOC A;  1XGS A;  1O0X A;  3PKB A;  4JUQ A;  5FCH A;  1YW7 A;  4U76 A;  3S6B A;  3PEB A;  4R60 A;  4S00 A;  4HXX A;  1XGO A;  3IU7 A;  2OAZ A;  2BWX A;  3Q6D A;  1BN5 A;  4Z7M A;  2BHB A;  1WY2 A;  2V3Z A;  2MAT A;  3PKD A;  1WKM A;  1XGN A;  2GU4 A;  3O5V A;  4FLK A;  5E5B A;  2G6P A;  4FLL A;  2Q93 A;  1W7V A;  4ZWO A;  3CB6 A;  4S01 A;  1KQ9 A;  1W2M A;  2V3X A;  3FMQ A;  1KQ0 A;  4IDY A;  4FLJ A;  4A6W A;  2NQ6 A;  4QR8 A;  1WLR A;  1KP0 A;  4IKS A;  4U70 A;  1XGM A;  2GTX A;  2IW2 A;  2EA2 A;  4S2T P;  4B28 A;  4U69 A;  3L7G A;  4IF7 A;  2GG3 A;  1YJ3 A;  2EA4 A;  4RZZ A;  2GGC A;  2BHA A;  3IL0 A;  3OOO A;  2GG8 A;  1YVM A;  1WL6 A;  2GG7 A;  2EVM A;  2Q95 A;  3MR1 A;  4FUK A;  4U6Z A;  2EVO A;  2BWV A;  2DFI A;  5CIK A;  2GG5 A;  3ROR A;  2BWW A;  3BIP A;  5CNX A;  4ZWP A;  1R5H A;  4EGE A;  1XNZ A;  2B3H A;  4IEC A;  3MX6 A;  3I7M A;  5E2C A;  3PN9 A;  1WN1 A;  2GU7 A;  1R58 A;  3PKA A;  2OKN A;  1QXY A;  4FLI A;  4U1B A;  2B3K A;  1R5G A;  2BHC A;  2BHD A;  4KM3 A;  1B59 A;  1C22 A;  5CE6 A;  4PNC A;  4ZNG A;  1QZY A;  3MAT A;  1C27 A;  4U71 A;  1JAW A;  2P98 A;  2GG9 A;  4IKT A;  5D6E A;  2BWU A;  3RVA A;  2B3L A;  2Q94 A;  5JHU A;  4RGZ 1;  3CTZ A;  4ZWU A;  2HOW A;  3IU8 A;  4PV4 A;  3FM3 A;  4IKR A;  4IPA A;  2ZSG A;  1WBQ A;  1C23 A;  2P9A A;  4FO7 A;  2NQ7 A;  1N51 A;  4U6E A;  2GA2 A;  4U6J A;  3D27 A;  4OOK A;  2BN7 A;  3BIT A;  5CDL A;  1WL9 A;  3IG4 A;  1Y1N A;  3FMR A;  2GGB A;  2P99 A;  4IU6 A;  1B6A A;  1C24 A;  2Q96 A;  2BWT A;  4S2R P;  3IU9 A;  4IKU A;  2GU6 A;  4U6C A;  5FCF A;  5CLS A;  2GZ5 A;  5D6F A;  3PKE A;  1C21 A;  2BH3 A;  1QXW A;  2BWS A;  4U75 A;  2EVC A;  2Q8K A;  1QXZ A; 
#chains in the Genus database with same CATH homology
 3TAV A;  1A16 A;  2ADU A;  5CDV A;  3TB5 A;  4MAT A;  2GG0 A;  2BB7 A;  1M35 A;  4U73 A;  4U6W A;  3CB5 A;  3L24 A;  2V3Y A;  1CHM A;  4FKC A;  2GG2 A;  2Q92 A;  2V6C A;  2GU5 A;  2BWY A;  3PKC A;  5JI6 A;  4A6V A;  4RZY A;  1YW9 A;  3OVK A;  1YW8 A;  1BOA A;  1MAT A;  4FO8 A;  3BIQ A;  5JFR A;  5CDE A;  1PV9 A;  3QOC A;  1XGS A;  1O0X A;  3PKB A;  4JUQ A;  5FCH A;  1YW7 A;  4U76 A;  3S6B A;  3PEB A;  4R60 A;  4S00 A;  4HXX A;  1XGO A;  3IU7 A;  2OAZ A;  2BWX A;  3Q6D A;  1BN5 A;  4Z7M A;  2BHB A;  1WY2 A;  2V3Z A;  2MAT A;  3PKD A;  1WKM A;  1XGN A;  2GU4 A;  3O5V A;  4FLK A;  5E5B A;  2G6P A;  4FLL A;  2Q93 A;  1W7V A;  4ZWO A;  3CB6 A;  4S01 A;  1KQ9 A;  1W2M A;  2V3X A;  3FMQ A;  1KQ0 A;  4IDY A;  4FLJ A;  4A6W A;  2NQ6 A;  4QR8 A;  1WLR A;  1KP0 A;  4IKS A;  4U70 A;  1XGM A;  2GTX A;  2IW2 A;  2EA2 A;  4S2T P;  4B28 A;  4U69 A;  3L7G A;  4IF7 A;  2GG3 A;  1YJ3 A;  2EA4 A;  4RZZ A;  2GGC A;  2BHA A;  3IL0 A;  3OOO A;  2GG8 A;  1YVM A;  1WL6 A;  2GG7 A;  2EVM A;  2Q95 A;  3MR1 A;  4FUK A;  4U6Z A;  2EVO A;  2BWV A;  2DFI A;  5CIK A;  2GG5 A;  3ROR A;  2BWW A;  3BIP A;  5CNX A;  4ZWP A;  1R5H A;  4EGE A;  1XNZ A;  2B3H A;  4IEC A;  3MX6 A;  3I7M A;  5E2C A;  3PN9 A;  1WN1 A;  2GU7 A;  1R58 A;  3PKA A;  2OKN A;  1QXY A;  4FLI A;  4U1B A;  2B3K A;  1R5G A;  2BHC A;  2BHD A;  4KM3 A;  1B59 A;  1C22 A;  5CE6 A;  4PNC A;  4ZNG A;  1QZY A;  3MAT A;  1C27 A;  4U71 A;  1JAW A;  2P98 A;  2GG9 A;  4IKT A;  5D6E A;  2BWU A;  3RVA A;  2B3L A;  2Q94 A;  5JHU A;  4RGZ 1;  3CTZ A;  4ZWU A;  2HOW A;  3IU8 A;  4PV4 A;  3FM3 A;  4IKR A;  4IPA A;  2ZSG A;  1WBQ A;  1C23 A;  2P9A A;  4FO7 A;  2NQ7 A;  1N51 A;  4U6E A;  2GA2 A;  4U6J A;  3D27 A;  4OOK A;  2BN7 A;  3BIT A;  5CDL A;  1WL9 A;  3IG4 A;  1Y1N A;  3FMR A;  2GGB A;  2P99 A;  4IU6 A;  1B6A A;  1C24 A;  2Q96 A;  2BWT A;  4S2R P;  3IU9 A;  4IKU A;  2GU6 A;  4U6C A;  5FCF A;  5CLS A;  2GZ5 A;  5D6F A;  3PKE A;  1C21 A;  2BH3 A;  1QXW A;  2BWS A;  4U75 A;  2EVC A;  2Q8K A;  1QXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...