1WL9A

Structure of aminopeptidase p from e. coli
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
total genus 156
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wl9A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wl9A02
4FLLA 4IF7A 4Z7MA 3D27A 3FMQA 3MR1A 4MATA 4PV4A 2Q94A 2BN7A 4EGEA 1W7VA 2BWWA 1Y1NA 5D6FA 5D6EA 3PKDA 4KM3A 3PKBA 2GG0A 2GG8A 3BIQA 1CHMA 1YW8A 4IKRA 3RVAA 1M35A 1N51A 3TB5A 4A6WA 5E5BA 5CDVA 1C21A 3I7MA 2GA2A 4IKSA 1XGNA 3FM3A 4S00A 3IG4A 3O5VA 1XNZA 3L24A 3IU9A 4JUQA 4B28A 2P99A 2MATA 3BIPA 2BHCA 3BITA 3MATA 1MATA 4U6CA 3RORA 2Q96A 4U6WA 3IL0A 1R58A 4ZWOA 5CDLA 1B6AA 2EVOA 2V3XA 3PEBA 2GTXA 2HOWA 2OKNA 4U6JA 4U6EA 1WKMA 1XGOA 4U70A 4RZZA 4RGZ1 1WLRA 2P98A 2NQ6A 2GZ5A 3FMRA 1QXWA 1BOAA 1WL9A 4ZNGA 4FLJA 4FLKA 2GG5A 4FLIA 2Q93A 4U1BA 1WL6A 2EVCA 2G6PA 4IKTA 5JFRA 1YJ3A 1BN5A 2EVMA 1XGMA 2BWSA 2BWTA 4IU6A 2GGBA 4ZWPA 1JAWA 4IPAA 3QOCA 3L7GA 4QR8A 2BWUA 2Q95A 5FCHA 1R5GA 3PN9A 2IW2A 4A6VA 2B3KA 2EA4A 1QXZA 3S6BA 2Q92A 3Q6DA 2V3YA 1KQ0A 3PKAA 4PNCA 3TAVA 4ZWUA 4FO7A 2Q8KA 2B3HA 3OVKA 1W2MA 1WBQA 5JI6A 5CLSA 2BHDA 1KQ9A 3CB6A 1R5HA 2NQ7A 1B59A 4FO8A 1A16A 2BHAA 2GU4A 3PKEA 3IU7A 2GG7A 1XGSA 5CDEA 3OOOA 4S2RP 3PKCA 2GG3A 4IDYA 1C27A 5CIKA 2V6CA 1YW7A 4U76A 4HXXA 1QXYA 3CTZA 2BH3A 3CB5A 4OOKA 4U75A 2V3ZA 4U69A 2ZSGA 2BWYA 2B3LA 2BHBA 1QZYA 5JHUA 2OAZA 1O0XA 4S2TP 5E2CA 2BB7A 1WY2A 2BWVA 4S01A 1PV9A 2GU5A 1C24A 1YW9A 4FUKA 4U71A 4R60A 2P9AA 1WN1A 4IKUA 3MX6A 2GU7A 5CNXA 3IU8A 2BWXA 4IECA 2GG2A 2DFIA 2EA2A 1C23A 2GU6A 2GGCA 5FCFA 2GG9A 5CE6A 2ADUA 1YVMA 4U73A 4RZYA 1KP0A 4FKCA 1C22A 4U6ZA
chains in the Genus database with same CATH superfamily
4FLLA 4IF7A 4Z7MA 3D27A 3FMQA 3MR1A 4MATA 4PV4A 2Q94A 2BN7A 4EGEA 1W7VA 2BWWA 1Y1NA 5D6FA 5D6EA 3PKDA 4KM3A 3PKBA 2GG0A 2GG8A 3BIQA 1CHMA 1YW8A 4IKRA 3RVAA 1M35A 1N51A 3TB5A 4A6WA 5E5BA 5CDVA 1C21A 3I7MA 2GA2A 4IKSA 1XGNA 3FM3A 4S00A 3IG4A 3O5VA 1XNZA 3L24A 3IU9A 4JUQA 4B28A 2P99A 2MATA 3BIPA 2BHCA 3BITA 3MATA 1MATA 4U6CA 3RORA 2Q96A 4U6WA 3IL0A 1R58A 4ZWOA 5CDLA 1B6AA 2EVOA 2V3XA 3PEBA 2GTXA 2HOWA 2OKNA 4U6JA 4U6EA 1WKMA 1XGOA 4U70A 4RZZA 4RGZ1 1WLRA 2P98A 2NQ6A 2GZ5A 3FMRA 1QXWA 1BOAA 1WL9A 4ZNGA 4FLJA 4FLKA 2GG5A 4FLIA 2Q93A 4U1BA 1WL6A 2EVCA 2G6PA 4IKTA 5JFRA 1YJ3A 1BN5A 2EVMA 1XGMA 2BWSA 2BWTA 4IU6A 2GGBA 4ZWPA 1JAWA 4IPAA 3QOCA 3L7GA 4QR8A 2BWUA 2Q95A 5FCHA 1R5GA 3PN9A 2IW2A 4A6VA 2B3KA 2EA4A 1QXZA 3S6BA 2Q92A 3Q6DA 2V3YA 1KQ0A 3PKAA 4PNCA 3TAVA 4ZWUA 4FO7A 2Q8KA 2B3HA 3OVKA 1W2MA 1WBQA 5JI6A 5CLSA 2BHDA 1KQ9A 3CB6A 1R5HA 2NQ7A 1B59A 4FO8A 1A16A 2BHAA 2GU4A 3PKEA 3IU7A 2GG7A 1XGSA 5CDEA 3OOOA 4S2RP 3PKCA 2GG3A 4IDYA 1C27A 5CIKA 2V6CA 1YW7A 4U76A 4HXXA 1QXYA 3CTZA 2BH3A 3CB5A 4OOKA 4U75A 2V3ZA 4U69A 2ZSGA 2BWYA 2B3LA 2BHBA 1QZYA 5JHUA 2OAZA 1O0XA 4S2TP 5E2CA 2BB7A 1WY2A 2BWVA 4S01A 1PV9A 2GU5A 1C24A 1YW9A 4FUKA 4U71A 4R60A 2P9AA 1WN1A 4IKUA 3MX6A 2GU7A 5CNXA 3IU8A 2BWXA 4IECA 2GG2A 2DFIA 2EA2A 1C23A 2GU6A 2GGCA 5FCFA 2GG9A 5CE6A 2ADUA 1YVMA 4U73A 4RZYA 1KP0A 4FKCA 1C22A 4U6ZA
chains in the Genus database with same CATH topology
4FLLA 4IF7A 4Z7MA 3D27A 3FMQA 3MR1A 4MATA 4PV4A 2Q94A 2BN7A 4EGEA 1W7VA 2BWWA 1Y1NA 5D6FA 5D6EA 3PKDA 4KM3A 3PKBA 2GG0A 2GG8A 3BIQA 1CHMA 1YW8A 4IKRA 3RVAA 1M35A 1N51A 3TB5A 4A6WA 5E5BA 5CDVA 1C21A 3I7MA 2GA2A 4IKSA 1XGNA 3FM3A 4S00A 3IG4A 3O5VA 1XNZA 3L24A 3IU9A 4JUQA 4B28A 2P99A 2MATA 3BIPA 2BHCA 3BITA 3MATA 1MATA 4U6CA 3RORA 2Q96A 4U6WA 3IL0A 1R58A 4ZWOA 5CDLA 1B6AA 2EVOA 2V3XA 3PEBA 2GTXA 2HOWA 2OKNA 4U6JA 4U6EA 1WKMA 1XGOA 4U70A 4RZZA 4RGZ1 1WLRA 2P98A 2NQ6A 2GZ5A 3FMRA 1QXWA 1BOAA 1WL9A 4ZNGA 4FLJA 4FLKA 2GG5A 4FLIA 2Q93A 4U1BA 1WL6A 2EVCA 2G6PA 4IKTA 5JFRA 1YJ3A 1BN5A 2EVMA 1XGMA 2BWSA 2BWTA 4IU6A 2GGBA 4ZWPA 1JAWA 4IPAA 3QOCA 3L7GA 4QR8A 2BWUA 2Q95A 5FCHA 1R5GA 3PN9A 2IW2A 4A6VA 2B3KA 2EA4A 1QXZA 3S6BA 2Q92A 3Q6DA 2V3YA 1KQ0A 3PKAA 4PNCA 3TAVA 4ZWUA 4FO7A 2Q8KA 2B3HA 3OVKA 1W2MA 1WBQA 5JI6A 5CLSA 2BHDA 1KQ9A 3CB6A 1R5HA 2NQ7A 1B59A 4FO8A 1A16A 2BHAA 2GU4A 3PKEA 3IU7A 2GG7A 1XGSA 5CDEA 3OOOA 4S2RP 3PKCA 2GG3A 4IDYA 1C27A 5CIKA 2V6CA 1YW7A 4U76A 4HXXA 1QXYA 3CTZA 2BH3A 3CB5A 4OOKA 4U75A 2V3ZA 4U69A 2ZSGA 2BWYA 2B3LA 2BHBA 1QZYA 5JHUA 2OAZA 1O0XA 4S2TP 5E2CA 2BB7A 1WY2A 2BWVA 4S01A 1PV9A 2GU5A 1C24A 1YW9A 4FUKA 4U71A 4R60A 2P9AA 1WN1A 4IKUA 3MX6A 2GU7A 5CNXA 3IU8A 2BWXA 4IECA 2GG2A 2DFIA 2EA2A 1C23A 2GU6A 2GGCA 5FCFA 2GG9A 5CE6A 2ADUA 1YVMA 4U73A 4RZYA 1KP0A 4FKCA 1C22A 4U6ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FLL A;  4IF7 A;  4Z7M A;  3D27 A;  3FMQ A;  3MR1 A;  4MAT A;  4PV4 A;  2Q94 A;  2BN7 A;  4EGE A;  1W7V A;  2BWW A;  1Y1N A;  5D6F A;  5D6E A;  3PKD A;  4KM3 A;  3PKB A;  2GG0 A;  2GG8 A;  3BIQ A;  1CHM A;  1YW8 A;  4IKR A;  3RVA A;  1M35 A;  1N51 A;  3TB5 A;  4A6W A;  5E5B A;  5CDV A;  1C21 A;  3I7M A;  2GA2 A;  4IKS A;  1XGN A;  3FM3 A;  4S00 A;  3IG4 A;  3O5V A;  1XNZ A;  3L24 A;  3IU9 A;  4JUQ A;  4B28 A;  2P99 A;  2MAT A;  3BIP A;  2BHC A;  3BIT A;  3MAT A;  1MAT A;  4U6C A;  3ROR A;  2Q96 A;  4U6W A;  3IL0 A;  1R58 A;  4ZWO A;  5CDL A;  1B6A A;  2EVO A;  2V3X A;  3PEB A;  2GTX A;  2HOW A;  2OKN A;  4U6J A;  4U6E A;  1WKM A;  1XGO A;  4U70 A;  4RZZ A;  4RGZ 1;  1WLR A;  2P98 A;  2NQ6 A;  2GZ5 A;  3FMR A;  1QXW A;  1BOA A;  1WL9 A;  4ZNG A;  4FLJ A;  4FLK A;  2GG5 A;  4FLI A;  2Q93 A;  4U1B A;  1WL6 A;  2EVC A;  2G6P A;  4IKT A;  5JFR A;  1YJ3 A;  1BN5 A;  2EVM A;  1XGM A;  2BWS A;  2BWT A;  4IU6 A;  2GGB A;  4ZWP A;  1JAW A;  4IPA A;  3QOC A;  3L7G A;  4QR8 A;  2BWU A;  2Q95 A;  5FCH A;  1R5G A;  3PN9 A;  2IW2 A;  4A6V A;  2B3K A;  2EA4 A;  1QXZ A;  3S6B A;  2Q92 A;  3Q6D A;  2V3Y A;  1KQ0 A;  3PKA A;  4PNC A;  3TAV A;  4ZWU A;  4FO7 A;  2Q8K A;  2B3H A;  3OVK A;  1W2M A;  1WBQ A;  5JI6 A;  5CLS A;  2BHD A;  1KQ9 A;  3CB6 A;  1R5H A;  2NQ7 A;  1B59 A;  4FO8 A;  1A16 A;  2BHA A;  2GU4 A;  3PKE A;  3IU7 A;  2GG7 A;  1XGS A;  5CDE A;  3OOO A;  4S2R P;  3PKC A;  2GG3 A;  4IDY A;  1C27 A;  5CIK A;  2V6C A;  1YW7 A;  4U76 A;  4HXX A;  1QXY A;  3CTZ A;  2BH3 A;  3CB5 A;  4OOK A;  4U75 A;  2V3Z A;  4U69 A;  2ZSG A;  2BWY A;  2B3L A;  2BHB A;  1QZY A;  5JHU A;  2OAZ A;  1O0X A;  4S2T P;  5E2C A;  2BB7 A;  1WY2 A;  2BWV A;  4S01 A;  1PV9 A;  2GU5 A;  1C24 A;  1YW9 A;  4FUK A;  4U71 A;  4R60 A;  2P9A A;  1WN1 A;  4IKU A;  3MX6 A;  2GU7 A;  5CNX A;  3IU8 A;  2BWX A;  4IEC A;  2GG2 A;  2DFI A;  2EA2 A;  1C23 A;  2GU6 A;  2GGC A;  5FCF A;  2GG9 A;  5CE6 A;  2ADU A;  1YVM A;  4U73 A;  4RZY A;  1KP0 A;  4FKC A;  1C22 A;  4U6Z A; 
#chains in the Genus database with same CATH topology
 4FLL A;  4IF7 A;  4Z7M A;  3D27 A;  3FMQ A;  3MR1 A;  4MAT A;  4PV4 A;  2Q94 A;  2BN7 A;  4EGE A;  1W7V A;  2BWW A;  1Y1N A;  5D6F A;  5D6E A;  3PKD A;  4KM3 A;  3PKB A;  2GG0 A;  2GG8 A;  3BIQ A;  1CHM A;  1YW8 A;  4IKR A;  3RVA A;  1M35 A;  1N51 A;  3TB5 A;  4A6W A;  5E5B A;  5CDV A;  1C21 A;  3I7M A;  2GA2 A;  4IKS A;  1XGN A;  3FM3 A;  4S00 A;  3IG4 A;  3O5V A;  1XNZ A;  3L24 A;  3IU9 A;  4JUQ A;  4B28 A;  2P99 A;  2MAT A;  3BIP A;  2BHC A;  3BIT A;  3MAT A;  1MAT A;  4U6C A;  3ROR A;  2Q96 A;  4U6W A;  3IL0 A;  1R58 A;  4ZWO A;  5CDL A;  1B6A A;  2EVO A;  2V3X A;  3PEB A;  2GTX A;  2HOW A;  2OKN A;  4U6J A;  4U6E A;  1WKM A;  1XGO A;  4U70 A;  4RZZ A;  4RGZ 1;  1WLR A;  2P98 A;  2NQ6 A;  2GZ5 A;  3FMR A;  1QXW A;  1BOA A;  1WL9 A;  4ZNG A;  4FLJ A;  4FLK A;  2GG5 A;  4FLI A;  2Q93 A;  4U1B A;  1WL6 A;  2EVC A;  2G6P A;  4IKT A;  5JFR A;  1YJ3 A;  1BN5 A;  2EVM A;  1XGM A;  2BWS A;  2BWT A;  4IU6 A;  2GGB A;  4ZWP A;  1JAW A;  4IPA A;  3QOC A;  3L7G A;  4QR8 A;  2BWU A;  2Q95 A;  5FCH A;  1R5G A;  3PN9 A;  2IW2 A;  4A6V A;  2B3K A;  2EA4 A;  1QXZ A;  3S6B A;  2Q92 A;  3Q6D A;  2V3Y A;  1KQ0 A;  3PKA A;  4PNC A;  3TAV A;  4ZWU A;  4FO7 A;  2Q8K A;  2B3H A;  3OVK A;  1W2M A;  1WBQ A;  5JI6 A;  5CLS A;  2BHD A;  1KQ9 A;  3CB6 A;  1R5H A;  2NQ7 A;  1B59 A;  4FO8 A;  1A16 A;  2BHA A;  2GU4 A;  3PKE A;  3IU7 A;  2GG7 A;  1XGS A;  5CDE A;  3OOO A;  4S2R P;  3PKC A;  2GG3 A;  4IDY A;  1C27 A;  5CIK A;  2V6C A;  1YW7 A;  4U76 A;  4HXX A;  1QXY A;  3CTZ A;  2BH3 A;  3CB5 A;  4OOK A;  4U75 A;  2V3Z A;  4U69 A;  2ZSG A;  2BWY A;  2B3L A;  2BHB A;  1QZY A;  5JHU A;  2OAZ A;  1O0X A;  4S2T P;  5E2C A;  2BB7 A;  1WY2 A;  2BWV A;  4S01 A;  1PV9 A;  2GU5 A;  1C24 A;  1YW9 A;  4FUK A;  4U71 A;  4R60 A;  2P9A A;  1WN1 A;  4IKU A;  3MX6 A;  2GU7 A;  5CNX A;  3IU8 A;  2BWX A;  4IEC A;  2GG2 A;  2DFI A;  2EA2 A;  1C23 A;  2GU6 A;  2GGC A;  5FCF A;  2GG9 A;  5CE6 A;  2ADU A;  1YVM A;  4U73 A;  4RZY A;  1KP0 A;  4FKC A;  1C22 A;  4U6Z A; 
#chains in the Genus database with same CATH homology
 4FLL A;  4IF7 A;  4Z7M A;  3D27 A;  3FMQ A;  3MR1 A;  4MAT A;  4PV4 A;  2Q94 A;  2BN7 A;  4EGE A;  1W7V A;  2BWW A;  1Y1N A;  5D6F A;  5D6E A;  3PKD A;  4KM3 A;  3PKB A;  2GG0 A;  2GG8 A;  3BIQ A;  1CHM A;  1YW8 A;  4IKR A;  3RVA A;  1M35 A;  1N51 A;  3TB5 A;  4A6W A;  5E5B A;  5CDV A;  1C21 A;  3I7M A;  2GA2 A;  4IKS A;  1XGN A;  3FM3 A;  4S00 A;  3IG4 A;  3O5V A;  1XNZ A;  3L24 A;  3IU9 A;  4JUQ A;  4B28 A;  2P99 A;  2MAT A;  3BIP A;  2BHC A;  3BIT A;  3MAT A;  1MAT A;  4U6C A;  3ROR A;  2Q96 A;  4U6W A;  3IL0 A;  1R58 A;  4ZWO A;  5CDL A;  1B6A A;  2EVO A;  2V3X A;  3PEB A;  2GTX A;  2HOW A;  2OKN A;  4U6J A;  4U6E A;  1WKM A;  1XGO A;  4U70 A;  4RZZ A;  4RGZ 1;  1WLR A;  2P98 A;  2NQ6 A;  2GZ5 A;  3FMR A;  1QXW A;  1BOA A;  1WL9 A;  4ZNG A;  4FLJ A;  4FLK A;  2GG5 A;  4FLI A;  2Q93 A;  4U1B A;  1WL6 A;  2EVC A;  2G6P A;  4IKT A;  5JFR A;  1YJ3 A;  1BN5 A;  2EVM A;  1XGM A;  2BWS A;  2BWT A;  4IU6 A;  2GGB A;  4ZWP A;  1JAW A;  4IPA A;  3QOC A;  3L7G A;  4QR8 A;  2BWU A;  2Q95 A;  5FCH A;  1R5G A;  3PN9 A;  2IW2 A;  4A6V A;  2B3K A;  2EA4 A;  1QXZ A;  3S6B A;  2Q92 A;  3Q6D A;  2V3Y A;  1KQ0 A;  3PKA A;  4PNC A;  3TAV A;  4ZWU A;  4FO7 A;  2Q8K A;  2B3H A;  3OVK A;  1W2M A;  1WBQ A;  5JI6 A;  5CLS A;  2BHD A;  1KQ9 A;  3CB6 A;  1R5H A;  2NQ7 A;  1B59 A;  4FO8 A;  1A16 A;  2BHA A;  2GU4 A;  3PKE A;  3IU7 A;  2GG7 A;  1XGS A;  5CDE A;  3OOO A;  4S2R P;  3PKC A;  2GG3 A;  4IDY A;  1C27 A;  5CIK A;  2V6C A;  1YW7 A;  4U76 A;  4HXX A;  1QXY A;  3CTZ A;  2BH3 A;  3CB5 A;  4OOK A;  4U75 A;  2V3Z A;  4U69 A;  2ZSG A;  2BWY A;  2B3L A;  2BHB A;  1QZY A;  5JHU A;  2OAZ A;  1O0X A;  4S2T P;  5E2C A;  2BB7 A;  1WY2 A;  2BWV A;  4S01 A;  1PV9 A;  2GU5 A;  1C24 A;  1YW9 A;  4FUK A;  4U71 A;  4R60 A;  2P9A A;  1WN1 A;  4IKU A;  3MX6 A;  2GU7 A;  5CNX A;  3IU8 A;  2BWX A;  4IEC A;  2GG2 A;  2DFI A;  2EA2 A;  1C23 A;  2GU6 A;  2GGC A;  5FCF A;  2GG9 A;  5CE6 A;  2ADU A;  1YVM A;  4U73 A;  4RZY A;  1KP0 A;  4FKC A;  1C22 A;  4U6Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...