1WL9A

Structure of aminopeptidase p from e. coli
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords Xaa-Pro aminopeptidase
total genus 156
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wl9A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wl9A02
1KP0A 4PNCA 3QOCA 3S6BA 2GG9A 1JAWA 2BHDA 4S01A 4IKSA 3RVAA 1BOAA 4U6EA 3Q6DA 3TB5A 2MATA 3BIQA 3PKBA 4FLLA 5E2CA 4S00A 1C24A 4FLIA 3TAVA 5CNXA 2Q94A 3OVKA 2HOWA 4OOKA 2GG2A 1BN5A 1WBQA 2GTXA 2OKNA 3OOOA 4FKCA 2Q95A 3IU8A 5JHUA 1YVMA 2NQ7A 1WLRA 4IECA 2GU4A 4EGEA 4PV4A 2EA4A 5D6EA 2BHAA 2GU6A 1N51A 4U76A 3O5VA 1XGOA 1KQ9A 4U75A 2P99A 3IU7A 3IU9A 2GGBA 2BWTA 1QZYA 1XNZA 2GZ5A 4U6WA 1XGMA 4U6CA 1B6AA 4RGZ1 2EA2A 3BIPA 1O0XA 3I7MA 2GG3A 5E5BA 4HXXA 5CDLA 3MX6A 3CB5A 4S2RP 1WY2A 1WKMA 2EVMA 4U73A 5D6FA 5CDEA 2IW2A 1QXZA 3PKAA 1QXWA 2GU5A 2BWXA 4R60A 1R5GA 4RZYA 4FLKA 2GG5A 3FMRA 1YW8A 1M35A 2Q92A 3RORA 4RZZA 2B3LA 4KM3A 2V3YA 3CB6A 1XGNA 2Q8KA 3PKEA 3IG4A 2BWVA 5CE6A 1MATA 3MATA 2V6CA 2P9AA 3L7GA 1WN1A 2DFIA 3PKDA 1KQ0A 4FO8A 4B28A 4JUQA 1R58A 1C23A 4FLJA 2GG7A 2GG8A 4ZNGA 4A6VA 2BWWA 1YW9A 4S2TP 3BITA 2NQ6A 2BWUA 2ZSGA 2B3HA 4U71A 4FO7A 3PN9A 4ZWUA 1C22A 5CIKA 3IL0A 1XGSA 2BB7A 4IF7A 2BHCA 3FM3A 3MR1A 5CLSA 1A16A 1WL9A 1YJ3A 4QR8A 2G6PA 2Q96A 2BWSA 4ZWOA 4A6WA 3L24A 4U1BA 4U69A 3CTZA 5JI6A 1Y1NA 3PEBA 2OAZA 4U70A 5JFRA 1WL6A 4IKTA 4IDYA 1C27A 2GG0A 3D27A 2B3KA 3PKCA 4FUKA 2P98A 1W2MA 2V3ZA 2BWYA 2GA2A 2BN7A 1B59A 1R5HA 4U6ZA 4IPAA 4IU6A 2GU7A 2GGCA 2V3XA 5CDVA 1W7VA 2EVOA 4Z7MA 4MATA 5FCFA 1YW7A 2BH3A 4IKRA 2Q93A 1C21A 4IKUA 3FMQA 2EVCA 1PV9A 5FCHA 4U6JA 2ADUA 1QXYA 4ZWPA 2BHBA 1CHMA
chains in the Genus database with same CATH superfamily
1KP0A 4PNCA 3QOCA 3S6BA 2GG9A 1JAWA 2BHDA 4S01A 4IKSA 3RVAA 1BOAA 4U6EA 3Q6DA 3TB5A 2MATA 3BIQA 3PKBA 4FLLA 5E2CA 4S00A 1C24A 4FLIA 3TAVA 5CNXA 2Q94A 3OVKA 2HOWA 4OOKA 2GG2A 1BN5A 1WBQA 2GTXA 2OKNA 3OOOA 4FKCA 2Q95A 3IU8A 5JHUA 1YVMA 2NQ7A 1WLRA 4IECA 2GU4A 4EGEA 4PV4A 2EA4A 5D6EA 2BHAA 2GU6A 1N51A 4U76A 3O5VA 1XGOA 1KQ9A 4U75A 2P99A 3IU7A 3IU9A 2GGBA 2BWTA 1QZYA 1XNZA 2GZ5A 4U6WA 1XGMA 4U6CA 1B6AA 4RGZ1 2EA2A 3BIPA 1O0XA 3I7MA 2GG3A 5E5BA 4HXXA 5CDLA 3MX6A 3CB5A 4S2RP 1WY2A 1WKMA 2EVMA 4U73A 5D6FA 5CDEA 2IW2A 1QXZA 3PKAA 1QXWA 2GU5A 2BWXA 4R60A 1R5GA 4RZYA 4FLKA 2GG5A 3FMRA 1YW8A 1M35A 2Q92A 3RORA 4RZZA 2B3LA 4KM3A 2V3YA 3CB6A 1XGNA 2Q8KA 3PKEA 3IG4A 2BWVA 5CE6A 1MATA 3MATA 2V6CA 2P9AA 3L7GA 1WN1A 2DFIA 3PKDA 1KQ0A 4FO8A 4B28A 4JUQA 1R58A 1C23A 4FLJA 2GG7A 2GG8A 4ZNGA 4A6VA 2BWWA 1YW9A 4S2TP 3BITA 2NQ6A 2BWUA 2ZSGA 2B3HA 4U71A 4FO7A 3PN9A 4ZWUA 1C22A 5CIKA 3IL0A 1XGSA 2BB7A 4IF7A 2BHCA 3FM3A 3MR1A 5CLSA 1A16A 1WL9A 1YJ3A 4QR8A 2G6PA 2Q96A 2BWSA 4ZWOA 4A6WA 3L24A 4U1BA 4U69A 3CTZA 5JI6A 1Y1NA 3PEBA 2OAZA 4U70A 5JFRA 1WL6A 4IKTA 4IDYA 1C27A 2GG0A 3D27A 2B3KA 3PKCA 4FUKA 2P98A 1W2MA 2V3ZA 2BWYA 2GA2A 2BN7A 1B59A 1R5HA 4U6ZA 4IPAA 4IU6A 2GU7A 2GGCA 2V3XA 5CDVA 1W7VA 2EVOA 4Z7MA 4MATA 5FCFA 1YW7A 2BH3A 4IKRA 2Q93A 1C21A 4IKUA 3FMQA 2EVCA 1PV9A 5FCHA 4U6JA 2ADUA 1QXYA 4ZWPA 2BHBA 1CHMA
chains in the Genus database with same CATH topology
1KP0A 4PNCA 3QOCA 3S6BA 2GG9A 1JAWA 2BHDA 4S01A 4IKSA 3RVAA 1BOAA 4U6EA 3Q6DA 3TB5A 2MATA 3BIQA 3PKBA 4FLLA 5E2CA 4S00A 1C24A 4FLIA 3TAVA 5CNXA 2Q94A 3OVKA 2HOWA 4OOKA 2GG2A 1BN5A 1WBQA 2GTXA 2OKNA 3OOOA 4FKCA 2Q95A 3IU8A 5JHUA 1YVMA 2NQ7A 1WLRA 4IECA 2GU4A 4EGEA 4PV4A 2EA4A 5D6EA 2BHAA 2GU6A 1N51A 4U76A 3O5VA 1XGOA 1KQ9A 4U75A 2P99A 3IU7A 3IU9A 2GGBA 2BWTA 1QZYA 1XNZA 2GZ5A 4U6WA 1XGMA 4U6CA 1B6AA 4RGZ1 2EA2A 3BIPA 1O0XA 3I7MA 2GG3A 5E5BA 4HXXA 5CDLA 3MX6A 3CB5A 4S2RP 1WY2A 1WKMA 2EVMA 4U73A 5D6FA 5CDEA 2IW2A 1QXZA 3PKAA 1QXWA 2GU5A 2BWXA 4R60A 1R5GA 4RZYA 4FLKA 2GG5A 3FMRA 1YW8A 1M35A 2Q92A 3RORA 4RZZA 2B3LA 4KM3A 2V3YA 3CB6A 1XGNA 2Q8KA 3PKEA 3IG4A 2BWVA 5CE6A 1MATA 3MATA 2V6CA 2P9AA 3L7GA 1WN1A 2DFIA 3PKDA 1KQ0A 4FO8A 4B28A 4JUQA 1R58A 1C23A 4FLJA 2GG7A 2GG8A 4ZNGA 4A6VA 2BWWA 1YW9A 4S2TP 3BITA 2NQ6A 2BWUA 2ZSGA 2B3HA 4U71A 4FO7A 3PN9A 4ZWUA 1C22A 5CIKA 3IL0A 1XGSA 2BB7A 4IF7A 2BHCA 3FM3A 3MR1A 5CLSA 1A16A 1WL9A 1YJ3A 4QR8A 2G6PA 2Q96A 2BWSA 4ZWOA 4A6WA 3L24A 4U1BA 4U69A 3CTZA 5JI6A 1Y1NA 3PEBA 2OAZA 4U70A 5JFRA 1WL6A 4IKTA 4IDYA 1C27A 2GG0A 3D27A 2B3KA 3PKCA 4FUKA 2P98A 1W2MA 2V3ZA 2BWYA 2GA2A 2BN7A 1B59A 1R5HA 4U6ZA 4IPAA 4IU6A 2GU7A 2GGCA 2V3XA 5CDVA 1W7VA 2EVOA 4Z7MA 4MATA 5FCFA 1YW7A 2BH3A 4IKRA 2Q93A 1C21A 4IKUA 3FMQA 2EVCA 1PV9A 5FCHA 4U6JA 2ADUA 1QXYA 4ZWPA 2BHBA 1CHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KP0 A;  4PNC A;  3QOC A;  3S6B A;  2GG9 A;  1JAW A;  2BHD A;  4S01 A;  4IKS A;  3RVA A;  1BOA A;  4U6E A;  3Q6D A;  3TB5 A;  2MAT A;  3BIQ A;  3PKB A;  4FLL A;  5E2C A;  4S00 A;  1C24 A;  4FLI A;  3TAV A;  5CNX A;  2Q94 A;  3OVK A;  2HOW A;  4OOK A;  2GG2 A;  1BN5 A;  1WBQ A;  2GTX A;  2OKN A;  3OOO A;  4FKC A;  2Q95 A;  3IU8 A;  5JHU A;  1YVM A;  2NQ7 A;  1WLR A;  4IEC A;  2GU4 A;  4EGE A;  4PV4 A;  2EA4 A;  5D6E A;  2BHA A;  2GU6 A;  1N51 A;  4U76 A;  3O5V A;  1XGO A;  1KQ9 A;  4U75 A;  2P99 A;  3IU7 A;  3IU9 A;  2GGB A;  2BWT A;  1QZY A;  1XNZ A;  2GZ5 A;  4U6W A;  1XGM A;  4U6C A;  1B6A A;  4RGZ 1;  2EA2 A;  3BIP A;  1O0X A;  3I7M A;  2GG3 A;  5E5B A;  4HXX A;  5CDL A;  3MX6 A;  3CB5 A;  4S2R P;  1WY2 A;  1WKM A;  2EVM A;  4U73 A;  5D6F A;  5CDE A;  2IW2 A;  1QXZ A;  3PKA A;  1QXW A;  2GU5 A;  2BWX A;  4R60 A;  1R5G A;  4RZY A;  4FLK A;  2GG5 A;  3FMR A;  1YW8 A;  1M35 A;  2Q92 A;  3ROR A;  4RZZ A;  2B3L A;  4KM3 A;  2V3Y A;  3CB6 A;  1XGN A;  2Q8K A;  3PKE A;  3IG4 A;  2BWV A;  5CE6 A;  1MAT A;  3MAT A;  2V6C A;  2P9A A;  3L7G A;  1WN1 A;  2DFI A;  3PKD A;  1KQ0 A;  4FO8 A;  4B28 A;  4JUQ A;  1R58 A;  1C23 A;  4FLJ A;  2GG7 A;  2GG8 A;  4ZNG A;  4A6V A;  2BWW A;  1YW9 A;  4S2T P;  3BIT A;  2NQ6 A;  2BWU A;  2ZSG A;  2B3H A;  4U71 A;  4FO7 A;  3PN9 A;  4ZWU A;  1C22 A;  5CIK A;  3IL0 A;  1XGS A;  2BB7 A;  4IF7 A;  2BHC A;  3FM3 A;  3MR1 A;  5CLS A;  1A16 A;  1WL9 A;  1YJ3 A;  4QR8 A;  2G6P A;  2Q96 A;  2BWS A;  4ZWO A;  4A6W A;  3L24 A;  4U1B A;  4U69 A;  3CTZ A;  5JI6 A;  1Y1N A;  3PEB A;  2OAZ A;  4U70 A;  5JFR A;  1WL6 A;  4IKT A;  4IDY A;  1C27 A;  2GG0 A;  3D27 A;  2B3K A;  3PKC A;  4FUK A;  2P98 A;  1W2M A;  2V3Z A;  2BWY A;  2GA2 A;  2BN7 A;  1B59 A;  1R5H A;  4U6Z A;  4IPA A;  4IU6 A;  2GU7 A;  2GGC A;  2V3X A;  5CDV A;  1W7V A;  2EVO A;  4Z7M A;  4MAT A;  5FCF A;  1YW7 A;  2BH3 A;  4IKR A;  2Q93 A;  1C21 A;  4IKU A;  3FMQ A;  2EVC A;  1PV9 A;  5FCH A;  4U6J A;  2ADU A;  1QXY A;  4ZWP A;  2BHB A;  1CHM A; 
#chains in the Genus database with same CATH topology
 1KP0 A;  4PNC A;  3QOC A;  3S6B A;  2GG9 A;  1JAW A;  2BHD A;  4S01 A;  4IKS A;  3RVA A;  1BOA A;  4U6E A;  3Q6D A;  3TB5 A;  2MAT A;  3BIQ A;  3PKB A;  4FLL A;  5E2C A;  4S00 A;  1C24 A;  4FLI A;  3TAV A;  5CNX A;  2Q94 A;  3OVK A;  2HOW A;  4OOK A;  2GG2 A;  1BN5 A;  1WBQ A;  2GTX A;  2OKN A;  3OOO A;  4FKC A;  2Q95 A;  3IU8 A;  5JHU A;  1YVM A;  2NQ7 A;  1WLR A;  4IEC A;  2GU4 A;  4EGE A;  4PV4 A;  2EA4 A;  5D6E A;  2BHA A;  2GU6 A;  1N51 A;  4U76 A;  3O5V A;  1XGO A;  1KQ9 A;  4U75 A;  2P99 A;  3IU7 A;  3IU9 A;  2GGB A;  2BWT A;  1QZY A;  1XNZ A;  2GZ5 A;  4U6W A;  1XGM A;  4U6C A;  1B6A A;  4RGZ 1;  2EA2 A;  3BIP A;  1O0X A;  3I7M A;  2GG3 A;  5E5B A;  4HXX A;  5CDL A;  3MX6 A;  3CB5 A;  4S2R P;  1WY2 A;  1WKM A;  2EVM A;  4U73 A;  5D6F A;  5CDE A;  2IW2 A;  1QXZ A;  3PKA A;  1QXW A;  2GU5 A;  2BWX A;  4R60 A;  1R5G A;  4RZY A;  4FLK A;  2GG5 A;  3FMR A;  1YW8 A;  1M35 A;  2Q92 A;  3ROR A;  4RZZ A;  2B3L A;  4KM3 A;  2V3Y A;  3CB6 A;  1XGN A;  2Q8K A;  3PKE A;  3IG4 A;  2BWV A;  5CE6 A;  1MAT A;  3MAT A;  2V6C A;  2P9A A;  3L7G A;  1WN1 A;  2DFI A;  3PKD A;  1KQ0 A;  4FO8 A;  4B28 A;  4JUQ A;  1R58 A;  1C23 A;  4FLJ A;  2GG7 A;  2GG8 A;  4ZNG A;  4A6V A;  2BWW A;  1YW9 A;  4S2T P;  3BIT A;  2NQ6 A;  2BWU A;  2ZSG A;  2B3H A;  4U71 A;  4FO7 A;  3PN9 A;  4ZWU A;  1C22 A;  5CIK A;  3IL0 A;  1XGS A;  2BB7 A;  4IF7 A;  2BHC A;  3FM3 A;  3MR1 A;  5CLS A;  1A16 A;  1WL9 A;  1YJ3 A;  4QR8 A;  2G6P A;  2Q96 A;  2BWS A;  4ZWO A;  4A6W A;  3L24 A;  4U1B A;  4U69 A;  3CTZ A;  5JI6 A;  1Y1N A;  3PEB A;  2OAZ A;  4U70 A;  5JFR A;  1WL6 A;  4IKT A;  4IDY A;  1C27 A;  2GG0 A;  3D27 A;  2B3K A;  3PKC A;  4FUK A;  2P98 A;  1W2M A;  2V3Z A;  2BWY A;  2GA2 A;  2BN7 A;  1B59 A;  1R5H A;  4U6Z A;  4IPA A;  4IU6 A;  2GU7 A;  2GGC A;  2V3X A;  5CDV A;  1W7V A;  2EVO A;  4Z7M A;  4MAT A;  5FCF A;  1YW7 A;  2BH3 A;  4IKR A;  2Q93 A;  1C21 A;  4IKU A;  3FMQ A;  2EVC A;  1PV9 A;  5FCH A;  4U6J A;  2ADU A;  1QXY A;  4ZWP A;  2BHB A;  1CHM A; 
#chains in the Genus database with same CATH homology
 1KP0 A;  4PNC A;  3QOC A;  3S6B A;  2GG9 A;  1JAW A;  2BHD A;  4S01 A;  4IKS A;  3RVA A;  1BOA A;  4U6E A;  3Q6D A;  3TB5 A;  2MAT A;  3BIQ A;  3PKB A;  4FLL A;  5E2C A;  4S00 A;  1C24 A;  4FLI A;  3TAV A;  5CNX A;  2Q94 A;  3OVK A;  2HOW A;  4OOK A;  2GG2 A;  1BN5 A;  1WBQ A;  2GTX A;  2OKN A;  3OOO A;  4FKC A;  2Q95 A;  3IU8 A;  5JHU A;  1YVM A;  2NQ7 A;  1WLR A;  4IEC A;  2GU4 A;  4EGE A;  4PV4 A;  2EA4 A;  5D6E A;  2BHA A;  2GU6 A;  1N51 A;  4U76 A;  3O5V A;  1XGO A;  1KQ9 A;  4U75 A;  2P99 A;  3IU7 A;  3IU9 A;  2GGB A;  2BWT A;  1QZY A;  1XNZ A;  2GZ5 A;  4U6W A;  1XGM A;  4U6C A;  1B6A A;  4RGZ 1;  2EA2 A;  3BIP A;  1O0X A;  3I7M A;  2GG3 A;  5E5B A;  4HXX A;  5CDL A;  3MX6 A;  3CB5 A;  4S2R P;  1WY2 A;  1WKM A;  2EVM A;  4U73 A;  5D6F A;  5CDE A;  2IW2 A;  1QXZ A;  3PKA A;  1QXW A;  2GU5 A;  2BWX A;  4R60 A;  1R5G A;  4RZY A;  4FLK A;  2GG5 A;  3FMR A;  1YW8 A;  1M35 A;  2Q92 A;  3ROR A;  4RZZ A;  2B3L A;  4KM3 A;  2V3Y A;  3CB6 A;  1XGN A;  2Q8K A;  3PKE A;  3IG4 A;  2BWV A;  5CE6 A;  1MAT A;  3MAT A;  2V6C A;  2P9A A;  3L7G A;  1WN1 A;  2DFI A;  3PKD A;  1KQ0 A;  4FO8 A;  4B28 A;  4JUQ A;  1R58 A;  1C23 A;  4FLJ A;  2GG7 A;  2GG8 A;  4ZNG A;  4A6V A;  2BWW A;  1YW9 A;  4S2T P;  3BIT A;  2NQ6 A;  2BWU A;  2ZSG A;  2B3H A;  4U71 A;  4FO7 A;  3PN9 A;  4ZWU A;  1C22 A;  5CIK A;  3IL0 A;  1XGS A;  2BB7 A;  4IF7 A;  2BHC A;  3FM3 A;  3MR1 A;  5CLS A;  1A16 A;  1WL9 A;  1YJ3 A;  4QR8 A;  2G6P A;  2Q96 A;  2BWS A;  4ZWO A;  4A6W A;  3L24 A;  4U1B A;  4U69 A;  3CTZ A;  5JI6 A;  1Y1N A;  3PEB A;  2OAZ A;  4U70 A;  5JFR A;  1WL6 A;  4IKT A;  4IDY A;  1C27 A;  2GG0 A;  3D27 A;  2B3K A;  3PKC A;  4FUK A;  2P98 A;  1W2M A;  2V3Z A;  2BWY A;  2GA2 A;  2BN7 A;  1B59 A;  1R5H A;  4U6Z A;  4IPA A;  4IU6 A;  2GU7 A;  2GGC A;  2V3X A;  5CDV A;  1W7V A;  2EVO A;  4Z7M A;  4MAT A;  5FCF A;  1YW7 A;  2BH3 A;  4IKR A;  2Q93 A;  1C21 A;  4IKU A;  3FMQ A;  2EVC A;  1PV9 A;  5FCH A;  4U6J A;  2ADU A;  1QXY A;  4ZWP A;  2BHB A;  1CHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...