1WL9A

Structure of aminopeptidase p from e. coli
Total Genus 156
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
156
sequence length
440
structure length
439
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xaa-Pro aminopeptidase
publication title Structural and functional implications of metal ion selection in aminopeptidase p, a metalloprotease with a dinuclear metal center
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 156
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2004-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 1wl9A01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 1wl9A02
3FMRA 1CHMA 1C22A 2GG3A 2Q96A 4S01A 1KQ0A 1XGSA 5FCHA 4IDYA 5D6EA 1C27A 3BITA 2BN7A 3FM3A 4FLJA 4IKRA 5D6FA 1PV9A 2GU7A 4Z7MA 3MR1A 4A6VA 2IW2A 1QZYA 2EVCA 2G6PA 3BIPA 4FO7A 5JFRA 4IU6A 3PN9A 4U71A 5E2CA 2GG0A 3MX6A 2BH3A 1C23A 1WLRA 1XNZA 5E5BA 2Q8KA 1WL9A 1XGOA 4IPAA 2GU6A 1Y1NA 3CB5A 4FLLA 1YVMA 2B3HA 2BHBA 3IG4A 3IL0A 3CTZA 3QOCA 1WKMA 4U6CA 2BWSA 2OKNA 4ZWPA 4PV4A 2BB7A 1M35A 2BWXA 4FKCA 2GG8A 4IKUA 2GA2A 2GG5A 4U6ZA 2ZSGA 1QXWA 2GGBA 4FLIA 4U6WA 2Q94A 2V3YA 2MATA 2Q92A 3PKAA 1C24A 4U69A 4ZNGA 2P99A 2EA2A 4MATA 2GU5A 2V3XA 3O5VA 1YW7A 2DFIA 2GTXA 4U1BA 2BWWA 1WN1A 1XGMA 1QXYA 4ZWOA 2GG2A 2Q95A 3OOOA 5CE6A 4FLKA 2GGCA 4RZZA 4S00A 3PEBA 2B3KA 2BHAA 4U76A 4RGZ1 4HXXA 2GU4A 3CB6A 3RVAA 2HOWA 3PKBA 5JI6A 4RZYA 3OVKA 2BWUA 4PNCA 3MATA 3FMQA 2BHCA 2NQ6A 4IKSA 4EGEA 1QXZA 1YW8A 1O0XA 2P98A 3IU9A 4S2TP 3TAVA 1A16A 4QR8A 2ADUA 1KP0A 3IU8A 5CDEA 2Q93A 4S2RP 4U6EA 1BN5A 1R58A 2BWVA 3IU7A 2V6CA 4IECA 4KM3A 1B59A 2OAZA 4FO8A 4B28A 3PKCA 2BHDA 2GZ5A 1WBQA 3D27A 2NQ7A 1W2MA 1YW9A 4U73A 3S6BA 3PKDA 5CIKA 1MATA 4JUQA 1C21A 3TB5A 1BOAA 3BIQA 1XGNA 3L24A 4FUKA 2B3LA 5CLSA 4R60A 2V3ZA 4OOKA 3RORA 2P9AA 2BWYA 1B6AA 4U75A 4A6WA 4IF7A 1N51A 5CDLA 4IKTA 3Q6DA 5FCFA 1JAWA 4U6JA 1WY2A 3PKEA 2BWTA 1R5GA 4U70A 1YJ3A 5CNXA 1KQ9A 2EVMA 1W7VA 5CDVA 3I7MA 2GG9A 3L7GA 2GG7A 1R5HA 4ZWUA 2EVOA 5JHUA 2EA4A 1WL6A
chains in the Genus database with same CATH superfamily
3FMRA 1CHMA 1C22A 2GG3A 2Q96A 4S01A 1KQ0A 1XGSA 5FCHA 4IDYA 5D6EA 1C27A 3BITA 2BN7A 3FM3A 4FLJA 4IKRA 5D6FA 1PV9A 2GU7A 4Z7MA 3MR1A 4A6VA 2IW2A 1QZYA 2EVCA 2G6PA 3BIPA 4FO7A 5JFRA 4IU6A 3PN9A 4U71A 5E2CA 2GG0A 3MX6A 2BH3A 1C23A 1WLRA 1XNZA 5E5BA 2Q8KA 1WL9A 1XGOA 4IPAA 2GU6A 1Y1NA 3CB5A 4FLLA 1YVMA 2B3HA 2BHBA 3IG4A 3IL0A 3CTZA 3QOCA 1WKMA 4U6CA 2BWSA 2OKNA 4ZWPA 4PV4A 2BB7A 1M35A 2BWXA 4FKCA 2GG8A 4IKUA 2GA2A 2GG5A 4U6ZA 2ZSGA 1QXWA 2GGBA 4FLIA 4U6WA 2Q94A 2V3YA 2MATA 2Q92A 3PKAA 1C24A 4U69A 4ZNGA 2P99A 2EA2A 4MATA 2GU5A 2V3XA 3O5VA 1YW7A 2DFIA 2GTXA 4U1BA 2BWWA 1WN1A 1XGMA 1QXYA 4ZWOA 2GG2A 2Q95A 3OOOA 5CE6A 4FLKA 2GGCA 4RZZA 4S00A 3PEBA 2B3KA 2BHAA 4U76A 4RGZ1 4HXXA 2GU4A 3CB6A 3RVAA 2HOWA 3PKBA 5JI6A 4RZYA 3OVKA 2BWUA 4PNCA 3MATA 3FMQA 2BHCA 2NQ6A 4IKSA 4EGEA 1QXZA 1YW8A 1O0XA 2P98A 3IU9A 4S2TP 3TAVA 1A16A 4QR8A 2ADUA 1KP0A 3IU8A 5CDEA 2Q93A 4S2RP 4U6EA 1BN5A 1R58A 2BWVA 3IU7A 2V6CA 4IECA 4KM3A 1B59A 2OAZA 4FO8A 4B28A 3PKCA 2BHDA 2GZ5A 1WBQA 3D27A 2NQ7A 1W2MA 1YW9A 4U73A 3S6BA 3PKDA 5CIKA 1MATA 4JUQA 1C21A 3TB5A 1BOAA 3BIQA 1XGNA 3L24A 4FUKA 2B3LA 5CLSA 4R60A 2V3ZA 4OOKA 3RORA 2P9AA 2BWYA 1B6AA 4U75A 4A6WA 4IF7A 1N51A 5CDLA 4IKTA 3Q6DA 5FCFA 1JAWA 4U6JA 1WY2A 3PKEA 2BWTA 1R5GA 4U70A 1YJ3A 5CNXA 1KQ9A 2EVMA 1W7VA 5CDVA 3I7MA 2GG9A 3L7GA 2GG7A 1R5HA 4ZWUA 2EVOA 5JHUA 2EA4A 1WL6A
chains in the Genus database with same CATH topology
3FMRA 1CHMA 1C22A 2GG3A 2Q96A 4S01A 1KQ0A 1XGSA 5FCHA 4IDYA 5D6EA 1C27A 3BITA 2BN7A 3FM3A 4FLJA 4IKRA 5D6FA 1PV9A 2GU7A 4Z7MA 3MR1A 4A6VA 2IW2A 1QZYA 2EVCA 2G6PA 3BIPA 4FO7A 5JFRA 4IU6A 3PN9A 4U71A 5E2CA 2GG0A 3MX6A 2BH3A 1C23A 1WLRA 1XNZA 5E5BA 2Q8KA 1WL9A 1XGOA 4IPAA 2GU6A 1Y1NA 3CB5A 4FLLA 1YVMA 2B3HA 2BHBA 3IG4A 3IL0A 3CTZA 3QOCA 1WKMA 4U6CA 2BWSA 2OKNA 4ZWPA 4PV4A 2BB7A 1M35A 2BWXA 4FKCA 2GG8A 4IKUA 2GA2A 2GG5A 4U6ZA 2ZSGA 1QXWA 2GGBA 4FLIA 4U6WA 2Q94A 2V3YA 2MATA 2Q92A 3PKAA 1C24A 4U69A 4ZNGA 2P99A 2EA2A 4MATA 2GU5A 2V3XA 3O5VA 1YW7A 2DFIA 2GTXA 4U1BA 2BWWA 1WN1A 1XGMA 1QXYA 4ZWOA 2GG2A 2Q95A 3OOOA 5CE6A 4FLKA 2GGCA 4RZZA 4S00A 3PEBA 2B3KA 2BHAA 4U76A 4RGZ1 4HXXA 2GU4A 3CB6A 3RVAA 2HOWA 3PKBA 5JI6A 4RZYA 3OVKA 2BWUA 4PNCA 3MATA 3FMQA 2BHCA 2NQ6A 4IKSA 4EGEA 1QXZA 1YW8A 1O0XA 2P98A 3IU9A 4S2TP 3TAVA 1A16A 4QR8A 2ADUA 1KP0A 3IU8A 5CDEA 2Q93A 4S2RP 4U6EA 1BN5A 1R58A 2BWVA 3IU7A 2V6CA 4IECA 4KM3A 1B59A 2OAZA 4FO8A 4B28A 3PKCA 2BHDA 2GZ5A 1WBQA 3D27A 2NQ7A 1W2MA 1YW9A 4U73A 3S6BA 3PKDA 5CIKA 1MATA 4JUQA 1C21A 3TB5A 1BOAA 3BIQA 1XGNA 3L24A 4FUKA 2B3LA 5CLSA 4R60A 2V3ZA 4OOKA 3RORA 2P9AA 2BWYA 1B6AA 4U75A 4A6WA 4IF7A 1N51A 5CDLA 4IKTA 3Q6DA 5FCFA 1JAWA 4U6JA 1WY2A 3PKEA 2BWTA 1R5GA 4U70A 1YJ3A 5CNXA 1KQ9A 2EVMA 1W7VA 5CDVA 3I7MA 2GG9A 3L7GA 2GG7A 1R5HA 4ZWUA 2EVOA 5JHUA 2EA4A 1WL6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FMR A;  1CHM A;  1C22 A;  2GG3 A;  2Q96 A;  4S01 A;  1KQ0 A;  1XGS A;  5FCH A;  4IDY A;  5D6E A;  1C27 A;  3BIT A;  2BN7 A;  3FM3 A;  4FLJ A;  4IKR A;  5D6F A;  1PV9 A;  2GU7 A;  4Z7M A;  3MR1 A;  4A6V A;  2IW2 A;  1QZY A;  2EVC A;  2G6P A;  3BIP A;  4FO7 A;  5JFR A;  4IU6 A;  3PN9 A;  4U71 A;  5E2C A;  2GG0 A;  3MX6 A;  2BH3 A;  1C23 A;  1WLR A;  1XNZ A;  5E5B A;  2Q8K A;  1WL9 A;  1XGO A;  4IPA A;  2GU6 A;  1Y1N A;  3CB5 A;  4FLL A;  1YVM A;  2B3H A;  2BHB A;  3IG4 A;  3IL0 A;  3CTZ A;  3QOC A;  1WKM A;  4U6C A;  2BWS A;  2OKN A;  4ZWP A;  4PV4 A;  2BB7 A;  1M35 A;  2BWX A;  4FKC A;  2GG8 A;  4IKU A;  2GA2 A;  2GG5 A;  4U6Z A;  2ZSG A;  1QXW A;  2GGB A;  4FLI A;  4U6W A;  2Q94 A;  2V3Y A;  2MAT A;  2Q92 A;  3PKA A;  1C24 A;  4U69 A;  4ZNG A;  2P99 A;  2EA2 A;  4MAT A;  2GU5 A;  2V3X A;  3O5V A;  1YW7 A;  2DFI A;  2GTX A;  4U1B A;  2BWW A;  1WN1 A;  1XGM A;  1QXY A;  4ZWO A;  2GG2 A;  2Q95 A;  3OOO A;  5CE6 A;  4FLK A;  2GGC A;  4RZZ A;  4S00 A;  3PEB A;  2B3K A;  2BHA A;  4U76 A;  4RGZ 1;  4HXX A;  2GU4 A;  3CB6 A;  3RVA A;  2HOW A;  3PKB A;  5JI6 A;  4RZY A;  3OVK A;  2BWU A;  4PNC A;  3MAT A;  3FMQ A;  2BHC A;  2NQ6 A;  4IKS A;  4EGE A;  1QXZ A;  1YW8 A;  1O0X A;  2P98 A;  3IU9 A;  4S2T P;  3TAV A;  1A16 A;  4QR8 A;  2ADU A;  1KP0 A;  3IU8 A;  5CDE A;  2Q93 A;  4S2R P;  4U6E A;  1BN5 A;  1R58 A;  2BWV A;  3IU7 A;  2V6C A;  4IEC A;  4KM3 A;  1B59 A;  2OAZ A;  4FO8 A;  4B28 A;  3PKC A;  2BHD A;  2GZ5 A;  1WBQ A;  3D27 A;  2NQ7 A;  1W2M A;  1YW9 A;  4U73 A;  3S6B A;  3PKD A;  5CIK A;  1MAT A;  4JUQ A;  1C21 A;  3TB5 A;  1BOA A;  3BIQ A;  1XGN A;  3L24 A;  4FUK A;  2B3L A;  5CLS A;  4R60 A;  2V3Z A;  4OOK A;  3ROR A;  2P9A A;  2BWY A;  1B6A A;  4U75 A;  4A6W A;  4IF7 A;  1N51 A;  5CDL A;  4IKT A;  3Q6D A;  5FCF A;  1JAW A;  4U6J A;  1WY2 A;  3PKE A;  2BWT A;  1R5G A;  4U70 A;  1YJ3 A;  5CNX A;  1KQ9 A;  2EVM A;  1W7V A;  5CDV A;  3I7M A;  2GG9 A;  3L7G A;  2GG7 A;  1R5H A;  4ZWU A;  2EVO A;  5JHU A;  2EA4 A;  1WL6 A; 
#chains in the Genus database with same CATH topology
 3FMR A;  1CHM A;  1C22 A;  2GG3 A;  2Q96 A;  4S01 A;  1KQ0 A;  1XGS A;  5FCH A;  4IDY A;  5D6E A;  1C27 A;  3BIT A;  2BN7 A;  3FM3 A;  4FLJ A;  4IKR A;  5D6F A;  1PV9 A;  2GU7 A;  4Z7M A;  3MR1 A;  4A6V A;  2IW2 A;  1QZY A;  2EVC A;  2G6P A;  3BIP A;  4FO7 A;  5JFR A;  4IU6 A;  3PN9 A;  4U71 A;  5E2C A;  2GG0 A;  3MX6 A;  2BH3 A;  1C23 A;  1WLR A;  1XNZ A;  5E5B A;  2Q8K A;  1WL9 A;  1XGO A;  4IPA A;  2GU6 A;  1Y1N A;  3CB5 A;  4FLL A;  1YVM A;  2B3H A;  2BHB A;  3IG4 A;  3IL0 A;  3CTZ A;  3QOC A;  1WKM A;  4U6C A;  2BWS A;  2OKN A;  4ZWP A;  4PV4 A;  2BB7 A;  1M35 A;  2BWX A;  4FKC A;  2GG8 A;  4IKU A;  2GA2 A;  2GG5 A;  4U6Z A;  2ZSG A;  1QXW A;  2GGB A;  4FLI A;  4U6W A;  2Q94 A;  2V3Y A;  2MAT A;  2Q92 A;  3PKA A;  1C24 A;  4U69 A;  4ZNG A;  2P99 A;  2EA2 A;  4MAT A;  2GU5 A;  2V3X A;  3O5V A;  1YW7 A;  2DFI A;  2GTX A;  4U1B A;  2BWW A;  1WN1 A;  1XGM A;  1QXY A;  4ZWO A;  2GG2 A;  2Q95 A;  3OOO A;  5CE6 A;  4FLK A;  2GGC A;  4RZZ A;  4S00 A;  3PEB A;  2B3K A;  2BHA A;  4U76 A;  4RGZ 1;  4HXX A;  2GU4 A;  3CB6 A;  3RVA A;  2HOW A;  3PKB A;  5JI6 A;  4RZY A;  3OVK A;  2BWU A;  4PNC A;  3MAT A;  3FMQ A;  2BHC A;  2NQ6 A;  4IKS A;  4EGE A;  1QXZ A;  1YW8 A;  1O0X A;  2P98 A;  3IU9 A;  4S2T P;  3TAV A;  1A16 A;  4QR8 A;  2ADU A;  1KP0 A;  3IU8 A;  5CDE A;  2Q93 A;  4S2R P;  4U6E A;  1BN5 A;  1R58 A;  2BWV A;  3IU7 A;  2V6C A;  4IEC A;  4KM3 A;  1B59 A;  2OAZ A;  4FO8 A;  4B28 A;  3PKC A;  2BHD A;  2GZ5 A;  1WBQ A;  3D27 A;  2NQ7 A;  1W2M A;  1YW9 A;  4U73 A;  3S6B A;  3PKD A;  5CIK A;  1MAT A;  4JUQ A;  1C21 A;  3TB5 A;  1BOA A;  3BIQ A;  1XGN A;  3L24 A;  4FUK A;  2B3L A;  5CLS A;  4R60 A;  2V3Z A;  4OOK A;  3ROR A;  2P9A A;  2BWY A;  1B6A A;  4U75 A;  4A6W A;  4IF7 A;  1N51 A;  5CDL A;  4IKT A;  3Q6D A;  5FCF A;  1JAW A;  4U6J A;  1WY2 A;  3PKE A;  2BWT A;  1R5G A;  4U70 A;  1YJ3 A;  5CNX A;  1KQ9 A;  2EVM A;  1W7V A;  5CDV A;  3I7M A;  2GG9 A;  3L7G A;  2GG7 A;  1R5H A;  4ZWU A;  2EVO A;  5JHU A;  2EA4 A;  1WL6 A; 
#chains in the Genus database with same CATH homology
 3FMR A;  1CHM A;  1C22 A;  2GG3 A;  2Q96 A;  4S01 A;  1KQ0 A;  1XGS A;  5FCH A;  4IDY A;  5D6E A;  1C27 A;  3BIT A;  2BN7 A;  3FM3 A;  4FLJ A;  4IKR A;  5D6F A;  1PV9 A;  2GU7 A;  4Z7M A;  3MR1 A;  4A6V A;  2IW2 A;  1QZY A;  2EVC A;  2G6P A;  3BIP A;  4FO7 A;  5JFR A;  4IU6 A;  3PN9 A;  4U71 A;  5E2C A;  2GG0 A;  3MX6 A;  2BH3 A;  1C23 A;  1WLR A;  1XNZ A;  5E5B A;  2Q8K A;  1WL9 A;  1XGO A;  4IPA A;  2GU6 A;  1Y1N A;  3CB5 A;  4FLL A;  1YVM A;  2B3H A;  2BHB A;  3IG4 A;  3IL0 A;  3CTZ A;  3QOC A;  1WKM A;  4U6C A;  2BWS A;  2OKN A;  4ZWP A;  4PV4 A;  2BB7 A;  1M35 A;  2BWX A;  4FKC A;  2GG8 A;  4IKU A;  2GA2 A;  2GG5 A;  4U6Z A;  2ZSG A;  1QXW A;  2GGB A;  4FLI A;  4U6W A;  2Q94 A;  2V3Y A;  2MAT A;  2Q92 A;  3PKA A;  1C24 A;  4U69 A;  4ZNG A;  2P99 A;  2EA2 A;  4MAT A;  2GU5 A;  2V3X A;  3O5V A;  1YW7 A;  2DFI A;  2GTX A;  4U1B A;  2BWW A;  1WN1 A;  1XGM A;  1QXY A;  4ZWO A;  2GG2 A;  2Q95 A;  3OOO A;  5CE6 A;  4FLK A;  2GGC A;  4RZZ A;  4S00 A;  3PEB A;  2B3K A;  2BHA A;  4U76 A;  4RGZ 1;  4HXX A;  2GU4 A;  3CB6 A;  3RVA A;  2HOW A;  3PKB A;  5JI6 A;  4RZY A;  3OVK A;  2BWU A;  4PNC A;  3MAT A;  3FMQ A;  2BHC A;  2NQ6 A;  4IKS A;  4EGE A;  1QXZ A;  1YW8 A;  1O0X A;  2P98 A;  3IU9 A;  4S2T P;  3TAV A;  1A16 A;  4QR8 A;  2ADU A;  1KP0 A;  3IU8 A;  5CDE A;  2Q93 A;  4S2R P;  4U6E A;  1BN5 A;  1R58 A;  2BWV A;  3IU7 A;  2V6C A;  4IEC A;  4KM3 A;  1B59 A;  2OAZ A;  4FO8 A;  4B28 A;  3PKC A;  2BHD A;  2GZ5 A;  1WBQ A;  3D27 A;  2NQ7 A;  1W2M A;  1YW9 A;  4U73 A;  3S6B A;  3PKD A;  5CIK A;  1MAT A;  4JUQ A;  1C21 A;  3TB5 A;  1BOA A;  3BIQ A;  1XGN A;  3L24 A;  4FUK A;  2B3L A;  5CLS A;  4R60 A;  2V3Z A;  4OOK A;  3ROR A;  2P9A A;  2BWY A;  1B6A A;  4U75 A;  4A6W A;  4IF7 A;  1N51 A;  5CDL A;  4IKT A;  3Q6D A;  5FCF A;  1JAW A;  4U6J A;  1WY2 A;  3PKE A;  2BWT A;  1R5G A;  4U70 A;  1YJ3 A;  5CNX A;  1KQ9 A;  2EVM A;  1W7V A;  5CDV A;  3I7M A;  2GG9 A;  3L7G A;  2GG7 A;  1R5H A;  4ZWU A;  2EVO A;  5JHU A;  2EA4 A;  1WL6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...