3O5VA

The crystal structure of the creatinase/prolidase n-terminal domain of an x-pro dipeptidase from streptococcus pyogenes to 1.85a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNAKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLFVYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHLNVNKFHGLQTIFSGQFNNLTPYVQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Creatinase/Prolidase N-terminal domain of an X-PRO dipeptidase from Streptococcus pyogenes to 1.85A
rcsb
source organism Streptococcus pyogenes m1 gas
molecule tags Hydrolase
molecule keywords X-PRO dipeptidase
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3o5vA00
4R60A 1WL9A 2BHAA 5CDEA 2BWUA 1JAWA 2BWTA 5E2CA 4RZZA 1N51A 1CHMA 2BWYA 3QOCA 5E5BA 3BIQA 4S00A 4ZWUA 2BHBA 3BITA 4RGZ1 4B28A 2ZSGA 2BH3A 2BHDA 3RVAA 1WN1A 2BN7A 3IL0A 3O5VA 3OOOA 2OKNA 2BWXA 4RZYA 1W2MA 3Q6DA 3CB5A 3IG4A 1M35A 2IW2A 3CTZA 3L24A 3L7GA 4FKCA 4ZNGA 3PN9A 2BWSA 3PEBA 5CDVA 1PV9A 2BHCA 4ZWOA 4S2TP 2BWWA 5CIKA 5CNXA 5FCHA 3OVKA 2HOWA 1WL6A 4S01A 2BWVA 1KP0A 2V3YA 1A16A 4QR8A 4S2RP 1W7VA 5CE6A 1WBQA 1WY2A 4PV4A 3I7MA 2V3ZA 5FCFA 3BIPA 4EGEA 2V3XA 4ZWPA 3CB6A 5CDLA 1WLRA
chains in the Genus database with same CATH superfamily
4R60A 1WL9A 2BHAA 5CDEA 2BWUA 1JAWA 2BWTA 5E2CA 4RZZA 1N51A 1CHMA 2BWYA 3QOCA 5E5BA 3BIQA 4S00A 4ZWUA 2BHBA 3BITA 4RGZ1 4B28A 2ZSGA 2BH3A 2BHDA 3RVAA 1WN1A 2BN7A 3IL0A 3O5VA 3OOOA 2OKNA 2BWXA 4RZYA 1W2MA 3Q6DA 3CB5A 3IG4A 1M35A 2IW2A 3CTZA 3L24A 3L7GA 4FKCA 4ZNGA 3PN9A 2BWSA 3PEBA 5CDVA 1PV9A 2BHCA 4ZWOA 4S2TP 2BWWA 5CIKA 5CNXA 5FCHA 3OVKA 2HOWA 1WL6A 4S01A 2BWVA 1KP0A 2V3YA 1A16A 4QR8A 4S2RP 1W7VA 5CE6A 1WBQA 1WY2A 4PV4A 3I7MA 2V3ZA 5FCFA 3BIPA 4EGEA 2V3XA 4ZWPA 3CB6A 5CDLA 1WLRA
chains in the Genus database with same CATH topology
4R60A 1WL9A 2BHAA 5CDEA 2BWUA 1JAWA 2BWTA 5E2CA 4RZZA 1N51A 1CHMA 2BWYA 3QOCA 5E5BA 3BIQA 4S00A 4ZWUA 2BHBA 3BITA 4RGZ1 4B28A 2ZSGA 2BH3A 2BHDA 3RVAA 1WN1A 2BN7A 3IL0A 3O5VA 3OOOA 2OKNA 2BWXA 4RZYA 1W2MA 3Q6DA 3CB5A 3IG4A 1M35A 2IW2A 3CTZA 3L24A 3L7GA 4FKCA 4ZNGA 3PN9A 2BWSA 3PEBA 5CDVA 1PV9A 2BHCA 4ZWOA 4S2TP 2BWWA 5CIKA 5CNXA 5FCHA 3OVKA 2HOWA 1WL6A 4S01A 2BWVA 1KP0A 2V3YA 1A16A 4QR8A 4S2RP 1W7VA 5CE6A 1WBQA 1WY2A 4PV4A 3I7MA 2V3ZA 5FCFA 3BIPA 4EGEA 2V3XA 4ZWPA 3CB6A 5CDLA 1WLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R60 A;  1WL9 A;  2BHA A;  5CDE A;  2BWU A;  1JAW A;  2BWT A;  5E2C A;  4RZZ A;  1N51 A;  1CHM A;  2BWY A;  3QOC A;  5E5B A;  3BIQ A;  4S00 A;  4ZWU A;  2BHB A;  3BIT A;  4RGZ 1;  4B28 A;  2ZSG A;  2BH3 A;  2BHD A;  3RVA A;  1WN1 A;  2BN7 A;  3IL0 A;  3O5V A;  3OOO A;  2OKN A;  2BWX A;  4RZY A;  1W2M A;  3Q6D A;  3CB5 A;  3IG4 A;  1M35 A;  2IW2 A;  3CTZ A;  3L24 A;  3L7G A;  4FKC A;  4ZNG A;  3PN9 A;  2BWS A;  3PEB A;  5CDV A;  1PV9 A;  2BHC A;  4ZWO A;  4S2T P;  2BWW A;  5CIK A;  5CNX A;  5FCH A;  3OVK A;  2HOW A;  1WL6 A;  4S01 A;  2BWV A;  1KP0 A;  2V3Y A;  1A16 A;  4QR8 A;  4S2R P;  1W7V A;  5CE6 A;  1WBQ A;  1WY2 A;  4PV4 A;  3I7M A;  2V3Z A;  5FCF A;  3BIP A;  4EGE A;  2V3X A;  4ZWP A;  3CB6 A;  5CDL A;  1WLR A; 
#chains in the Genus database with same CATH topology
 4R60 A;  1WL9 A;  2BHA A;  5CDE A;  2BWU A;  1JAW A;  2BWT A;  5E2C A;  4RZZ A;  1N51 A;  1CHM A;  2BWY A;  3QOC A;  5E5B A;  3BIQ A;  4S00 A;  4ZWU A;  2BHB A;  3BIT A;  4RGZ 1;  4B28 A;  2ZSG A;  2BH3 A;  2BHD A;  3RVA A;  1WN1 A;  2BN7 A;  3IL0 A;  3O5V A;  3OOO A;  2OKN A;  2BWX A;  4RZY A;  1W2M A;  3Q6D A;  3CB5 A;  3IG4 A;  1M35 A;  2IW2 A;  3CTZ A;  3L24 A;  3L7G A;  4FKC A;  4ZNG A;  3PN9 A;  2BWS A;  3PEB A;  5CDV A;  1PV9 A;  2BHC A;  4ZWO A;  4S2T P;  2BWW A;  5CIK A;  5CNX A;  5FCH A;  3OVK A;  2HOW A;  1WL6 A;  4S01 A;  2BWV A;  1KP0 A;  2V3Y A;  1A16 A;  4QR8 A;  4S2R P;  1W7V A;  5CE6 A;  1WBQ A;  1WY2 A;  4PV4 A;  3I7M A;  2V3Z A;  5FCF A;  3BIP A;  4EGE A;  2V3X A;  4ZWP A;  3CB6 A;  5CDL A;  1WLR A; 
#chains in the Genus database with same CATH homology
 4R60 A;  1WL9 A;  2BHA A;  5CDE A;  2BWU A;  1JAW A;  2BWT A;  5E2C A;  4RZZ A;  1N51 A;  1CHM A;  2BWY A;  3QOC A;  5E5B A;  3BIQ A;  4S00 A;  4ZWU A;  2BHB A;  3BIT A;  4RGZ 1;  4B28 A;  2ZSG A;  2BH3 A;  2BHD A;  3RVA A;  1WN1 A;  2BN7 A;  3IL0 A;  3O5V A;  3OOO A;  2OKN A;  2BWX A;  4RZY A;  1W2M A;  3Q6D A;  3CB5 A;  3IG4 A;  1M35 A;  2IW2 A;  3CTZ A;  3L24 A;  3L7G A;  4FKC A;  4ZNG A;  3PN9 A;  2BWS A;  3PEB A;  5CDV A;  1PV9 A;  2BHC A;  4ZWO A;  4S2T P;  2BWW A;  5CIK A;  5CNX A;  5FCH A;  3OVK A;  2HOW A;  1WL6 A;  4S01 A;  2BWV A;  1KP0 A;  2V3Y A;  1A16 A;  4QR8 A;  4S2R P;  1W7V A;  5CE6 A;  1WBQ A;  1WY2 A;  4PV4 A;  3I7M A;  2V3Z A;  5FCF A;  3BIP A;  4EGE A;  2V3X A;  4ZWP A;  3CB6 A;  5CDL A;  1WLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...