3O5VA

The crystal structure of the creatinase/prolidase n-terminal domain of an x-pro dipeptidase from streptococcus pyogenes to 1.85a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNAKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLFVYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHLNVNKFHGLQTIFSGQFNNLTPYVQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of the Creatinase/Prolidase N-terminal domain of an X-PRO dipeptidase from Streptococcus pyogenes to 1.85A
rcsb
source organism Streptococcus pyogenes m1 gas
molecule tags Hydrolase
molecule keywords X-PRO dipeptidase
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3o5vA00
2BWWA 3L7GA 3Q6DA 1W7VA 1WY2A 4RGZ1 2V3ZA 2BHAA 3CB6A 1WL9A 3QOCA 1CHMA 1PV9A 4S01A 2HOWA 5FCFA 3BIQA 5E5BA 4ZWPA 2BWUA 2V3XA 1A16A 3BIPA 2BN7A 5CDEA 3PEBA 3O5VA 1JAWA 3BITA 2BWSA 4RZYA 2BWXA 2BHCA 4RZZA 1W2MA 1WL6A 2BHBA 2OKNA 3IL0A 3CB5A 1WLRA 2IW2A 3I7MA 1M35A 4ZWOA 4S2TP 5FCHA 4B28A 1WN1A 2V3YA 3CTZA 1WBQA 2BWVA 2BH3A 3IG4A 3PN9A 4ZNGA 4S2RP 3RVAA 4QR8A 4PV4A 2BHDA 4EGEA 5CDLA 4S00A 3OVKA 4ZWUA 2ZSGA 5CNXA 5CIKA 5CDVA 3OOOA 5E2CA 2BWYA 4FKCA 1N51A 5CE6A 1KP0A 3L24A 4R60A 2BWTA
chains in the Genus database with same CATH superfamily
2BWWA 3L7GA 3Q6DA 1W7VA 1WY2A 4RGZ1 2V3ZA 2BHAA 3CB6A 1WL9A 3QOCA 1CHMA 1PV9A 4S01A 2HOWA 5FCFA 3BIQA 5E5BA 4ZWPA 2BWUA 2V3XA 1A16A 3BIPA 2BN7A 5CDEA 3PEBA 3O5VA 1JAWA 3BITA 2BWSA 4RZYA 2BWXA 2BHCA 4RZZA 1W2MA 1WL6A 2BHBA 2OKNA 3IL0A 3CB5A 1WLRA 2IW2A 3I7MA 1M35A 4ZWOA 4S2TP 5FCHA 4B28A 1WN1A 2V3YA 3CTZA 1WBQA 2BWVA 2BH3A 3IG4A 3PN9A 4ZNGA 4S2RP 3RVAA 4QR8A 4PV4A 2BHDA 4EGEA 5CDLA 4S00A 3OVKA 4ZWUA 2ZSGA 5CNXA 5CIKA 5CDVA 3OOOA 5E2CA 2BWYA 4FKCA 1N51A 5CE6A 1KP0A 3L24A 4R60A 2BWTA
chains in the Genus database with same CATH topology
2BWWA 3L7GA 3Q6DA 1W7VA 1WY2A 4RGZ1 2V3ZA 2BHAA 3CB6A 1WL9A 3QOCA 1CHMA 1PV9A 4S01A 2HOWA 5FCFA 3BIQA 5E5BA 4ZWPA 2BWUA 2V3XA 1A16A 3BIPA 2BN7A 5CDEA 3PEBA 3O5VA 1JAWA 3BITA 2BWSA 4RZYA 2BWXA 2BHCA 4RZZA 1W2MA 1WL6A 2BHBA 2OKNA 3IL0A 3CB5A 1WLRA 2IW2A 3I7MA 1M35A 4ZWOA 4S2TP 5FCHA 4B28A 1WN1A 2V3YA 3CTZA 1WBQA 2BWVA 2BH3A 3IG4A 3PN9A 4ZNGA 4S2RP 3RVAA 4QR8A 4PV4A 2BHDA 4EGEA 5CDLA 4S00A 3OVKA 4ZWUA 2ZSGA 5CNXA 5CIKA 5CDVA 3OOOA 5E2CA 2BWYA 4FKCA 1N51A 5CE6A 1KP0A 3L24A 4R60A 2BWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWW A;  3L7G A;  3Q6D A;  1W7V A;  1WY2 A;  4RGZ 1;  2V3Z A;  2BHA A;  3CB6 A;  1WL9 A;  3QOC A;  1CHM A;  1PV9 A;  4S01 A;  2HOW A;  5FCF A;  3BIQ A;  5E5B A;  4ZWP A;  2BWU A;  2V3X A;  1A16 A;  3BIP A;  2BN7 A;  5CDE A;  3PEB A;  3O5V A;  1JAW A;  3BIT A;  2BWS A;  4RZY A;  2BWX A;  2BHC A;  4RZZ A;  1W2M A;  1WL6 A;  2BHB A;  2OKN A;  3IL0 A;  3CB5 A;  1WLR A;  2IW2 A;  3I7M A;  1M35 A;  4ZWO A;  4S2T P;  5FCH A;  4B28 A;  1WN1 A;  2V3Y A;  3CTZ A;  1WBQ A;  2BWV A;  2BH3 A;  3IG4 A;  3PN9 A;  4ZNG A;  4S2R P;  3RVA A;  4QR8 A;  4PV4 A;  2BHD A;  4EGE A;  5CDL A;  4S00 A;  3OVK A;  4ZWU A;  2ZSG A;  5CNX A;  5CIK A;  5CDV A;  3OOO A;  5E2C A;  2BWY A;  4FKC A;  1N51 A;  5CE6 A;  1KP0 A;  3L24 A;  4R60 A;  2BWT A; 
#chains in the Genus database with same CATH topology
 2BWW A;  3L7G A;  3Q6D A;  1W7V A;  1WY2 A;  4RGZ 1;  2V3Z A;  2BHA A;  3CB6 A;  1WL9 A;  3QOC A;  1CHM A;  1PV9 A;  4S01 A;  2HOW A;  5FCF A;  3BIQ A;  5E5B A;  4ZWP A;  2BWU A;  2V3X A;  1A16 A;  3BIP A;  2BN7 A;  5CDE A;  3PEB A;  3O5V A;  1JAW A;  3BIT A;  2BWS A;  4RZY A;  2BWX A;  2BHC A;  4RZZ A;  1W2M A;  1WL6 A;  2BHB A;  2OKN A;  3IL0 A;  3CB5 A;  1WLR A;  2IW2 A;  3I7M A;  1M35 A;  4ZWO A;  4S2T P;  5FCH A;  4B28 A;  1WN1 A;  2V3Y A;  3CTZ A;  1WBQ A;  2BWV A;  2BH3 A;  3IG4 A;  3PN9 A;  4ZNG A;  4S2R P;  3RVA A;  4QR8 A;  4PV4 A;  2BHD A;  4EGE A;  5CDL A;  4S00 A;  3OVK A;  4ZWU A;  2ZSG A;  5CNX A;  5CIK A;  5CDV A;  3OOO A;  5E2C A;  2BWY A;  4FKC A;  1N51 A;  5CE6 A;  1KP0 A;  3L24 A;  4R60 A;  2BWT A; 
#chains in the Genus database with same CATH homology
 2BWW A;  3L7G A;  3Q6D A;  1W7V A;  1WY2 A;  4RGZ 1;  2V3Z A;  2BHA A;  3CB6 A;  1WL9 A;  3QOC A;  1CHM A;  1PV9 A;  4S01 A;  2HOW A;  5FCF A;  3BIQ A;  5E5B A;  4ZWP A;  2BWU A;  2V3X A;  1A16 A;  3BIP A;  2BN7 A;  5CDE A;  3PEB A;  3O5V A;  1JAW A;  3BIT A;  2BWS A;  4RZY A;  2BWX A;  2BHC A;  4RZZ A;  1W2M A;  1WL6 A;  2BHB A;  2OKN A;  3IL0 A;  3CB5 A;  1WLR A;  2IW2 A;  3I7M A;  1M35 A;  4ZWO A;  4S2T P;  5FCH A;  4B28 A;  1WN1 A;  2V3Y A;  3CTZ A;  1WBQ A;  2BWV A;  2BH3 A;  3IG4 A;  3PN9 A;  4ZNG A;  4S2R P;  3RVA A;  4QR8 A;  4PV4 A;  2BHD A;  4EGE A;  5CDL A;  4S00 A;  3OVK A;  4ZWU A;  2ZSG A;  5CNX A;  5CIK A;  5CDV A;  3OOO A;  5E2C A;  2BWY A;  4FKC A;  1N51 A;  5CE6 A;  1KP0 A;  3L24 A;  4R60 A;  2BWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...