3O5VA

The crystal structure of the creatinase/prolidase n-terminal domain of an x-pro dipeptidase from streptococcus pyogenes to 1.85a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNAKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLFVYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHLNVNKFHGLQTIFSGQFNNLTPYVQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords X-PRO dipeptidase
publication title The Crystal Structure of the Creatinase/Prolidase N-terminal domain of an X-PRO dipeptidase from Streptococcus pyogenes to 1.85A
rcsb
source organism Streptococcus pyogenes m1 gas
molecule tags Hydrolase
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3o5vA00
2BH3A 1M35A 5FCHA 4FKCA 1A16A 5CIKA 4RZYA 2BHBA 3QOCA 1WBQA 5CDEA 5CDVA 5CDLA 5E2CA 3Q6DA 1PV9A 1N51A 2ZSGA 3I7MA 3IL0A 4ZWOA 3CB5A 2BHAA 3PN9A 3PEBA 1WY2A 2IW2A 4S2RP 3L7GA 1CHMA 2BWSA 4S01A 2BHCA 1WL6A 4PV4A 5FCFA 4RGZ1 1W7VA 2BWUA 2BHDA 1JAWA 3O5VA 3BIQA 3OOOA 3OVKA 2BWVA 2HOWA 4S00A 4B28A 3BITA 4ZWPA 2BN7A 2BWXA 4EGEA 5CE6A 1KP0A 3CTZA 1WLRA 2V3XA 2V3ZA 5CNXA 2BWTA 2V3YA 3CB6A 1WL9A 4R60A 3RVAA 4RZZA 4ZWUA 1W2MA 2OKNA 3BIPA 3IG4A 5E5BA 4QR8A 4ZNGA 1WN1A 2BWWA 4S2TP 3L24A 2BWYA
chains in the Genus database with same CATH superfamily
2BH3A 1M35A 5FCHA 4FKCA 1A16A 5CIKA 4RZYA 2BHBA 3QOCA 1WBQA 5CDEA 5CDVA 5CDLA 5E2CA 3Q6DA 1PV9A 1N51A 2ZSGA 3I7MA 3IL0A 4ZWOA 3CB5A 2BHAA 3PN9A 3PEBA 1WY2A 2IW2A 4S2RP 3L7GA 1CHMA 2BWSA 4S01A 2BHCA 1WL6A 4PV4A 5FCFA 4RGZ1 1W7VA 2BWUA 2BHDA 1JAWA 3O5VA 3BIQA 3OOOA 3OVKA 2BWVA 2HOWA 4S00A 4B28A 3BITA 4ZWPA 2BN7A 2BWXA 4EGEA 5CE6A 1KP0A 3CTZA 1WLRA 2V3XA 2V3ZA 5CNXA 2BWTA 2V3YA 3CB6A 1WL9A 4R60A 3RVAA 4RZZA 4ZWUA 1W2MA 2OKNA 3BIPA 3IG4A 5E5BA 4QR8A 4ZNGA 1WN1A 2BWWA 4S2TP 3L24A 2BWYA
chains in the Genus database with same CATH topology
2BH3A 1M35A 5FCHA 4FKCA 1A16A 5CIKA 4RZYA 2BHBA 3QOCA 1WBQA 5CDEA 5CDVA 5CDLA 5E2CA 3Q6DA 1PV9A 1N51A 2ZSGA 3I7MA 3IL0A 4ZWOA 3CB5A 2BHAA 3PN9A 3PEBA 1WY2A 2IW2A 4S2RP 3L7GA 1CHMA 2BWSA 4S01A 2BHCA 1WL6A 4PV4A 5FCFA 4RGZ1 1W7VA 2BWUA 2BHDA 1JAWA 3O5VA 3BIQA 3OOOA 3OVKA 2BWVA 2HOWA 4S00A 4B28A 3BITA 4ZWPA 2BN7A 2BWXA 4EGEA 5CE6A 1KP0A 3CTZA 1WLRA 2V3XA 2V3ZA 5CNXA 2BWTA 2V3YA 3CB6A 1WL9A 4R60A 3RVAA 4RZZA 4ZWUA 1W2MA 2OKNA 3BIPA 3IG4A 5E5BA 4QR8A 4ZNGA 1WN1A 2BWWA 4S2TP 3L24A 2BWYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BH3 A;  1M35 A;  5FCH A;  4FKC A;  1A16 A;  5CIK A;  4RZY A;  2BHB A;  3QOC A;  1WBQ A;  5CDE A;  5CDV A;  5CDL A;  5E2C A;  3Q6D A;  1PV9 A;  1N51 A;  2ZSG A;  3I7M A;  3IL0 A;  4ZWO A;  3CB5 A;  2BHA A;  3PN9 A;  3PEB A;  1WY2 A;  2IW2 A;  4S2R P;  3L7G A;  1CHM A;  2BWS A;  4S01 A;  2BHC A;  1WL6 A;  4PV4 A;  5FCF A;  4RGZ 1;  1W7V A;  2BWU A;  2BHD A;  1JAW A;  3O5V A;  3BIQ A;  3OOO A;  3OVK A;  2BWV A;  2HOW A;  4S00 A;  4B28 A;  3BIT A;  4ZWP A;  2BN7 A;  2BWX A;  4EGE A;  5CE6 A;  1KP0 A;  3CTZ A;  1WLR A;  2V3X A;  2V3Z A;  5CNX A;  2BWT A;  2V3Y A;  3CB6 A;  1WL9 A;  4R60 A;  3RVA A;  4RZZ A;  4ZWU A;  1W2M A;  2OKN A;  3BIP A;  3IG4 A;  5E5B A;  4QR8 A;  4ZNG A;  1WN1 A;  2BWW A;  4S2T P;  3L24 A;  2BWY A; 
#chains in the Genus database with same CATH topology
 2BH3 A;  1M35 A;  5FCH A;  4FKC A;  1A16 A;  5CIK A;  4RZY A;  2BHB A;  3QOC A;  1WBQ A;  5CDE A;  5CDV A;  5CDL A;  5E2C A;  3Q6D A;  1PV9 A;  1N51 A;  2ZSG A;  3I7M A;  3IL0 A;  4ZWO A;  3CB5 A;  2BHA A;  3PN9 A;  3PEB A;  1WY2 A;  2IW2 A;  4S2R P;  3L7G A;  1CHM A;  2BWS A;  4S01 A;  2BHC A;  1WL6 A;  4PV4 A;  5FCF A;  4RGZ 1;  1W7V A;  2BWU A;  2BHD A;  1JAW A;  3O5V A;  3BIQ A;  3OOO A;  3OVK A;  2BWV A;  2HOW A;  4S00 A;  4B28 A;  3BIT A;  4ZWP A;  2BN7 A;  2BWX A;  4EGE A;  5CE6 A;  1KP0 A;  3CTZ A;  1WLR A;  2V3X A;  2V3Z A;  5CNX A;  2BWT A;  2V3Y A;  3CB6 A;  1WL9 A;  4R60 A;  3RVA A;  4RZZ A;  4ZWU A;  1W2M A;  2OKN A;  3BIP A;  3IG4 A;  5E5B A;  4QR8 A;  4ZNG A;  1WN1 A;  2BWW A;  4S2T P;  3L24 A;  2BWY A; 
#chains in the Genus database with same CATH homology
 2BH3 A;  1M35 A;  5FCH A;  4FKC A;  1A16 A;  5CIK A;  4RZY A;  2BHB A;  3QOC A;  1WBQ A;  5CDE A;  5CDV A;  5CDL A;  5E2C A;  3Q6D A;  1PV9 A;  1N51 A;  2ZSG A;  3I7M A;  3IL0 A;  4ZWO A;  3CB5 A;  2BHA A;  3PN9 A;  3PEB A;  1WY2 A;  2IW2 A;  4S2R P;  3L7G A;  1CHM A;  2BWS A;  4S01 A;  2BHC A;  1WL6 A;  4PV4 A;  5FCF A;  4RGZ 1;  1W7V A;  2BWU A;  2BHD A;  1JAW A;  3O5V A;  3BIQ A;  3OOO A;  3OVK A;  2BWV A;  2HOW A;  4S00 A;  4B28 A;  3BIT A;  4ZWP A;  2BN7 A;  2BWX A;  4EGE A;  5CE6 A;  1KP0 A;  3CTZ A;  1WLR A;  2V3X A;  2V3Z A;  5CNX A;  2BWT A;  2V3Y A;  3CB6 A;  1WL9 A;  4R60 A;  3RVA A;  4RZZ A;  4ZWU A;  1W2M A;  2OKN A;  3BIP A;  3IG4 A;  5E5B A;  4QR8 A;  4ZNG A;  1WN1 A;  2BWW A;  4S2T P;  3L24 A;  2BWY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...