3O5VA

The crystal structure of the creatinase/prolidase n-terminal domain of an x-pro dipeptidase from streptococcus pyogenes to 1.85a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
131
structure length
131
Chain Sequence
SNAKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLFVYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHLNVNKFHGLQTIFSGQFNNLTPYVQGM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords X-PRO dipeptidase
publication title The Crystal Structure of the Creatinase/Prolidase N-terminal domain of an X-PRO dipeptidase from Streptococcus pyogenes to 1.85A
rcsb
source organism Streptococcus pyogenes m1 gas
total genus 35
structure length 131
sequence length 131
chains with identical sequence B
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2010-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3o5vA00
1WL9A 1A16A 2BHDA 2BWSA 4RZZA 1CHMA 2BHBA 1PV9A 3L24A 2V3XA 2BWXA 5CDVA 5FCHA 2HOWA 2BHCA 1W7VA 2IW2A 4B28A 1N51A 5CNXA 1WL6A 4PV4A 3BIPA 3IL0A 2BWWA 5E2CA 3PN9A 3CB5A 3CB6A 4RZYA 2BWTA 2OKNA 3L7GA 4S01A 2ZSGA 3PEBA 3I7MA 1M35A 4S2RP 4ZNGA 4FKCA 4S2TP 2BWUA 4EGEA 3IG4A 3BIQA 1KP0A 2BN7A 4RGZ1 5CE6A 3CTZA 3O5VA 3BITA 2BWVA 4ZWOA 1WY2A 1WBQA 3RVAA 3OVKA 4ZWUA 1WLRA 2V3YA 3OOOA 2BWYA 3QOCA 1JAWA 4R60A 2BH3A 4QR8A 5CDEA 2V3ZA 1WN1A 5CIKA 1W2MA 5CDLA 5FCFA 5E5BA 4ZWPA 3Q6DA 4S00A 2BHAA
chains in the Genus database with same CATH superfamily
1WL9A 1A16A 2BHDA 2BWSA 4RZZA 1CHMA 2BHBA 1PV9A 3L24A 2V3XA 2BWXA 5CDVA 5FCHA 2HOWA 2BHCA 1W7VA 2IW2A 4B28A 1N51A 5CNXA 1WL6A 4PV4A 3BIPA 3IL0A 2BWWA 5E2CA 3PN9A 3CB5A 3CB6A 4RZYA 2BWTA 2OKNA 3L7GA 4S01A 2ZSGA 3PEBA 3I7MA 1M35A 4S2RP 4ZNGA 4FKCA 4S2TP 2BWUA 4EGEA 3IG4A 3BIQA 1KP0A 2BN7A 4RGZ1 5CE6A 3CTZA 3O5VA 3BITA 2BWVA 4ZWOA 1WY2A 1WBQA 3RVAA 3OVKA 4ZWUA 1WLRA 2V3YA 3OOOA 2BWYA 3QOCA 1JAWA 4R60A 2BH3A 4QR8A 5CDEA 2V3ZA 1WN1A 5CIKA 1W2MA 5CDLA 5FCFA 5E5BA 4ZWPA 3Q6DA 4S00A 2BHAA
chains in the Genus database with same CATH topology
1WL9A 1A16A 2BHDA 2BWSA 4RZZA 1CHMA 2BHBA 1PV9A 3L24A 2V3XA 2BWXA 5CDVA 5FCHA 2HOWA 2BHCA 1W7VA 2IW2A 4B28A 1N51A 5CNXA 1WL6A 4PV4A 3BIPA 3IL0A 2BWWA 5E2CA 3PN9A 3CB5A 3CB6A 4RZYA 2BWTA 2OKNA 3L7GA 4S01A 2ZSGA 3PEBA 3I7MA 1M35A 4S2RP 4ZNGA 4FKCA 4S2TP 2BWUA 4EGEA 3IG4A 3BIQA 1KP0A 2BN7A 4RGZ1 5CE6A 3CTZA 3O5VA 3BITA 2BWVA 4ZWOA 1WY2A 1WBQA 3RVAA 3OVKA 4ZWUA 1WLRA 2V3YA 3OOOA 2BWYA 3QOCA 1JAWA 4R60A 2BH3A 4QR8A 5CDEA 2V3ZA 1WN1A 5CIKA 1W2MA 5CDLA 5FCFA 5E5BA 4ZWPA 3Q6DA 4S00A 2BHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WL9 A;  1A16 A;  2BHD A;  2BWS A;  4RZZ A;  1CHM A;  2BHB A;  1PV9 A;  3L24 A;  2V3X A;  2BWX A;  5CDV A;  5FCH A;  2HOW A;  2BHC A;  1W7V A;  2IW2 A;  4B28 A;  1N51 A;  5CNX A;  1WL6 A;  4PV4 A;  3BIP A;  3IL0 A;  2BWW A;  5E2C A;  3PN9 A;  3CB5 A;  3CB6 A;  4RZY A;  2BWT A;  2OKN A;  3L7G A;  4S01 A;  2ZSG A;  3PEB A;  3I7M A;  1M35 A;  4S2R P;  4ZNG A;  4FKC A;  4S2T P;  2BWU A;  4EGE A;  3IG4 A;  3BIQ A;  1KP0 A;  2BN7 A;  4RGZ 1;  5CE6 A;  3CTZ A;  3O5V A;  3BIT A;  2BWV A;  4ZWO A;  1WY2 A;  1WBQ A;  3RVA A;  3OVK A;  4ZWU A;  1WLR A;  2V3Y A;  3OOO A;  2BWY A;  3QOC A;  1JAW A;  4R60 A;  2BH3 A;  4QR8 A;  5CDE A;  2V3Z A;  1WN1 A;  5CIK A;  1W2M A;  5CDL A;  5FCF A;  5E5B A;  4ZWP A;  3Q6D A;  4S00 A;  2BHA A; 
#chains in the Genus database with same CATH topology
 1WL9 A;  1A16 A;  2BHD A;  2BWS A;  4RZZ A;  1CHM A;  2BHB A;  1PV9 A;  3L24 A;  2V3X A;  2BWX A;  5CDV A;  5FCH A;  2HOW A;  2BHC A;  1W7V A;  2IW2 A;  4B28 A;  1N51 A;  5CNX A;  1WL6 A;  4PV4 A;  3BIP A;  3IL0 A;  2BWW A;  5E2C A;  3PN9 A;  3CB5 A;  3CB6 A;  4RZY A;  2BWT A;  2OKN A;  3L7G A;  4S01 A;  2ZSG A;  3PEB A;  3I7M A;  1M35 A;  4S2R P;  4ZNG A;  4FKC A;  4S2T P;  2BWU A;  4EGE A;  3IG4 A;  3BIQ A;  1KP0 A;  2BN7 A;  4RGZ 1;  5CE6 A;  3CTZ A;  3O5V A;  3BIT A;  2BWV A;  4ZWO A;  1WY2 A;  1WBQ A;  3RVA A;  3OVK A;  4ZWU A;  1WLR A;  2V3Y A;  3OOO A;  2BWY A;  3QOC A;  1JAW A;  4R60 A;  2BH3 A;  4QR8 A;  5CDE A;  2V3Z A;  1WN1 A;  5CIK A;  1W2M A;  5CDL A;  5FCF A;  5E5B A;  4ZWP A;  3Q6D A;  4S00 A;  2BHA A; 
#chains in the Genus database with same CATH homology
 1WL9 A;  1A16 A;  2BHD A;  2BWS A;  4RZZ A;  1CHM A;  2BHB A;  1PV9 A;  3L24 A;  2V3X A;  2BWX A;  5CDV A;  5FCH A;  2HOW A;  2BHC A;  1W7V A;  2IW2 A;  4B28 A;  1N51 A;  5CNX A;  1WL6 A;  4PV4 A;  3BIP A;  3IL0 A;  2BWW A;  5E2C A;  3PN9 A;  3CB5 A;  3CB6 A;  4RZY A;  2BWT A;  2OKN A;  3L7G A;  4S01 A;  2ZSG A;  3PEB A;  3I7M A;  1M35 A;  4S2R P;  4ZNG A;  4FKC A;  4S2T P;  2BWU A;  4EGE A;  3IG4 A;  3BIQ A;  1KP0 A;  2BN7 A;  4RGZ 1;  5CE6 A;  3CTZ A;  3O5V A;  3BIT A;  2BWV A;  4ZWO A;  1WY2 A;  1WBQ A;  3RVA A;  3OVK A;  4ZWU A;  1WLR A;  2V3Y A;  3OOO A;  2BWY A;  3QOC A;  1JAW A;  4R60 A;  2BH3 A;  4QR8 A;  5CDE A;  2V3Z A;  1WN1 A;  5CIK A;  1W2M A;  5CDL A;  5FCF A;  5E5B A;  4ZWP A;  3Q6D A;  4S00 A;  2BHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...