2BHBA

Zn substituted e. coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhbA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhbA02
4FKCA 1WLRA 1R5GA 5CDEA 1R58A 4PNCA 3MR1A 2Q93A 2V6CA 5JI6A 2BWTA 1Y1NA 3IU8A 4U6JA 4B28A 1R5HA 3S6BA 1N51A 2EVCA 1YJ3A 3IG4A 3FMRA 2OKNA 4Z7MA 2B3KA 2V3YA 5CNXA 3L7GA 2GA2A 4U73A 3BIPA 5JFRA 5JHUA 1XGSA 5CLSA 2GZ5A 2BH3A 4U6WA 1B6AA 5E5BA 2DFIA 2V3ZA 4S00A 1MATA 2Q8KA 3TAVA 5FCHA 2MATA 3PKEA 2HOWA 1B59A 4U75A 2BWWA 2IW2A 3QOCA 1QXWA 4IKUA 5CDLA 3BITA 2BHDA 4A6WA 3Q6DA 4S2RP 4FLIA 2BWYA 1WL9A 2GTXA 1A16A 4QR8A 2V3XA 5D6FA 4RZZA 4IU6A 4U1BA 1XGMA 4U6EA 2EVOA 4PV4A 1YW7A 4OOKA 2BWVA 1YW9A 2GG8A 2P9AA 1QZYA 2B3LA 1W7VA 3IU7A 4FO7A 4IKSA 2GU6A 2GGBA 4IKTA 4IKRA 3PEBA 1JAWA 3L24A 4FLLA 3OOOA 1WY2A 4RGZ1 2NQ7A 2ZSGA 4ZWOA 1WL6A 3MX6A 3PN9A 4U71A 4ZWPA 2GG2A 4IECA 4JUQA 5CIKA 4ZNGA 1C24A 4ZWUA 2BWXA 3MATA 2B3HA 1C23A 2EA4A 3IU9A 1QXYA 1C27A 3CB6A 3PKBA 3RORA 4U6ZA 5CDVA 1QXZA 5CE6A 3O5VA 2ADUA 4FUKA 2GU5A 2GG3A 3PKAA 3PKCA 1CHMA 2Q92A 3FM3A 4FLKA 1BOAA 1PV9A 5FCFA 1XNZA 2Q95A 1XGOA 2BWSA 3I7MA 3CB5A 2G6PA 1XGNA 4S2TP 4IDYA 4U76A 4MATA 4KM3A 1WBQA 3PKDA 4FLJA 2GG7A 2BWUA 2BHBA 3FMQA 2GU7A 4HXXA 3IL0A 5D6EA 3OVKA 4U6CA 1W2MA 2EA2A 3TB5A 1WKMA 2Q94A 4EGEA 2GG9A 2GG0A 1YVMA 2BHAA 3RVAA 2OAZA 2P98A 5E2CA 2GG5A 4IPAA 2EVMA 1C22A 1YW8A 4RZYA 1M35A 4R60A 1KQ0A 2GU4A 2NQ6A 4IF7A 1O0XA 4U69A 2BN7A 2P99A 1C21A 2Q96A 1KQ9A 3BIQA 2BB7A 1WN1A 4S01A 1BN5A 2BHCA 4A6VA 3D27A 4U70A 1KP0A 4FO8A 3CTZA 2GGCA
chains in the Genus database with same CATH superfamily
4FKCA 1WLRA 1R5GA 5CDEA 1R58A 4PNCA 3MR1A 2Q93A 2V6CA 5JI6A 2BWTA 1Y1NA 3IU8A 4U6JA 4B28A 1R5HA 3S6BA 1N51A 2EVCA 1YJ3A 3IG4A 3FMRA 2OKNA 4Z7MA 2B3KA 2V3YA 5CNXA 3L7GA 2GA2A 4U73A 3BIPA 5JFRA 5JHUA 1XGSA 5CLSA 2GZ5A 2BH3A 4U6WA 1B6AA 5E5BA 2DFIA 2V3ZA 4S00A 1MATA 2Q8KA 3TAVA 5FCHA 2MATA 3PKEA 2HOWA 1B59A 4U75A 2BWWA 2IW2A 3QOCA 1QXWA 4IKUA 5CDLA 3BITA 2BHDA 4A6WA 3Q6DA 4S2RP 4FLIA 2BWYA 1WL9A 2GTXA 1A16A 4QR8A 2V3XA 5D6FA 4RZZA 4IU6A 4U1BA 1XGMA 4U6EA 2EVOA 4PV4A 1YW7A 4OOKA 2BWVA 1YW9A 2GG8A 2P9AA 1QZYA 2B3LA 1W7VA 3IU7A 4FO7A 4IKSA 2GU6A 2GGBA 4IKTA 4IKRA 3PEBA 1JAWA 3L24A 4FLLA 3OOOA 1WY2A 4RGZ1 2NQ7A 2ZSGA 4ZWOA 1WL6A 3MX6A 3PN9A 4U71A 4ZWPA 2GG2A 4IECA 4JUQA 5CIKA 4ZNGA 1C24A 4ZWUA 2BWXA 3MATA 2B3HA 1C23A 2EA4A 3IU9A 1QXYA 1C27A 3CB6A 3PKBA 3RORA 4U6ZA 5CDVA 1QXZA 5CE6A 3O5VA 2ADUA 4FUKA 2GU5A 2GG3A 3PKAA 3PKCA 1CHMA 2Q92A 3FM3A 4FLKA 1BOAA 1PV9A 5FCFA 1XNZA 2Q95A 1XGOA 2BWSA 3I7MA 3CB5A 2G6PA 1XGNA 4S2TP 4IDYA 4U76A 4MATA 4KM3A 1WBQA 3PKDA 4FLJA 2GG7A 2BWUA 2BHBA 3FMQA 2GU7A 4HXXA 3IL0A 5D6EA 3OVKA 4U6CA 1W2MA 2EA2A 3TB5A 1WKMA 2Q94A 4EGEA 2GG9A 2GG0A 1YVMA 2BHAA 3RVAA 2OAZA 2P98A 5E2CA 2GG5A 4IPAA 2EVMA 1C22A 1YW8A 4RZYA 1M35A 4R60A 1KQ0A 2GU4A 2NQ6A 4IF7A 1O0XA 4U69A 2BN7A 2P99A 1C21A 2Q96A 1KQ9A 3BIQA 2BB7A 1WN1A 4S01A 1BN5A 2BHCA 4A6VA 3D27A 4U70A 1KP0A 4FO8A 3CTZA 2GGCA
chains in the Genus database with same CATH topology
4FKCA 1WLRA 1R5GA 5CDEA 1R58A 4PNCA 3MR1A 2Q93A 2V6CA 5JI6A 2BWTA 1Y1NA 3IU8A 4U6JA 4B28A 1R5HA 3S6BA 1N51A 2EVCA 1YJ3A 3IG4A 3FMRA 2OKNA 4Z7MA 2B3KA 2V3YA 5CNXA 3L7GA 2GA2A 4U73A 3BIPA 5JFRA 5JHUA 1XGSA 5CLSA 2GZ5A 2BH3A 4U6WA 1B6AA 5E5BA 2DFIA 2V3ZA 4S00A 1MATA 2Q8KA 3TAVA 5FCHA 2MATA 3PKEA 2HOWA 1B59A 4U75A 2BWWA 2IW2A 3QOCA 1QXWA 4IKUA 5CDLA 3BITA 2BHDA 4A6WA 3Q6DA 4S2RP 4FLIA 2BWYA 1WL9A 2GTXA 1A16A 4QR8A 2V3XA 5D6FA 4RZZA 4IU6A 4U1BA 1XGMA 4U6EA 2EVOA 4PV4A 1YW7A 4OOKA 2BWVA 1YW9A 2GG8A 2P9AA 1QZYA 2B3LA 1W7VA 3IU7A 4FO7A 4IKSA 2GU6A 2GGBA 4IKTA 4IKRA 3PEBA 1JAWA 3L24A 4FLLA 3OOOA 1WY2A 4RGZ1 2NQ7A 2ZSGA 4ZWOA 1WL6A 3MX6A 3PN9A 4U71A 4ZWPA 2GG2A 4IECA 4JUQA 5CIKA 4ZNGA 1C24A 4ZWUA 2BWXA 3MATA 2B3HA 1C23A 2EA4A 3IU9A 1QXYA 1C27A 3CB6A 3PKBA 3RORA 4U6ZA 5CDVA 1QXZA 5CE6A 3O5VA 2ADUA 4FUKA 2GU5A 2GG3A 3PKAA 3PKCA 1CHMA 2Q92A 3FM3A 4FLKA 1BOAA 1PV9A 5FCFA 1XNZA 2Q95A 1XGOA 2BWSA 3I7MA 3CB5A 2G6PA 1XGNA 4S2TP 4IDYA 4U76A 4MATA 4KM3A 1WBQA 3PKDA 4FLJA 2GG7A 2BWUA 2BHBA 3FMQA 2GU7A 4HXXA 3IL0A 5D6EA 3OVKA 4U6CA 1W2MA 2EA2A 3TB5A 1WKMA 2Q94A 4EGEA 2GG9A 2GG0A 1YVMA 2BHAA 3RVAA 2OAZA 2P98A 5E2CA 2GG5A 4IPAA 2EVMA 1C22A 1YW8A 4RZYA 1M35A 4R60A 1KQ0A 2GU4A 2NQ6A 4IF7A 1O0XA 4U69A 2BN7A 2P99A 1C21A 2Q96A 1KQ9A 3BIQA 2BB7A 1WN1A 4S01A 1BN5A 2BHCA 4A6VA 3D27A 4U70A 1KP0A 4FO8A 3CTZA 2GGCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FKC A;  1WLR A;  1R5G A;  5CDE A;  1R58 A;  4PNC A;  3MR1 A;  2Q93 A;  2V6C A;  5JI6 A;  2BWT A;  1Y1N A;  3IU8 A;  4U6J A;  4B28 A;  1R5H A;  3S6B A;  1N51 A;  2EVC A;  1YJ3 A;  3IG4 A;  3FMR A;  2OKN A;  4Z7M A;  2B3K A;  2V3Y A;  5CNX A;  3L7G A;  2GA2 A;  4U73 A;  3BIP A;  5JFR A;  5JHU A;  1XGS A;  5CLS A;  2GZ5 A;  2BH3 A;  4U6W A;  1B6A A;  5E5B A;  2DFI A;  2V3Z A;  4S00 A;  1MAT A;  2Q8K A;  3TAV A;  5FCH A;  2MAT A;  3PKE A;  2HOW A;  1B59 A;  4U75 A;  2BWW A;  2IW2 A;  3QOC A;  1QXW A;  4IKU A;  5CDL A;  3BIT A;  2BHD A;  4A6W A;  3Q6D A;  4S2R P;  4FLI A;  2BWY A;  1WL9 A;  2GTX A;  1A16 A;  4QR8 A;  2V3X A;  5D6F A;  4RZZ A;  4IU6 A;  4U1B A;  1XGM A;  4U6E A;  2EVO A;  4PV4 A;  1YW7 A;  4OOK A;  2BWV A;  1YW9 A;  2GG8 A;  2P9A A;  1QZY A;  2B3L A;  1W7V A;  3IU7 A;  4FO7 A;  4IKS A;  2GU6 A;  2GGB A;  4IKT A;  4IKR A;  3PEB A;  1JAW A;  3L24 A;  4FLL A;  3OOO A;  1WY2 A;  4RGZ 1;  2NQ7 A;  2ZSG A;  4ZWO A;  1WL6 A;  3MX6 A;  3PN9 A;  4U71 A;  4ZWP A;  2GG2 A;  4IEC A;  4JUQ A;  5CIK A;  4ZNG A;  1C24 A;  4ZWU A;  2BWX A;  3MAT A;  2B3H A;  1C23 A;  2EA4 A;  3IU9 A;  1QXY A;  1C27 A;  3CB6 A;  3PKB A;  3ROR A;  4U6Z A;  5CDV A;  1QXZ A;  5CE6 A;  3O5V A;  2ADU A;  4FUK A;  2GU5 A;  2GG3 A;  3PKA A;  3PKC A;  1CHM A;  2Q92 A;  3FM3 A;  4FLK A;  1BOA A;  1PV9 A;  5FCF A;  1XNZ A;  2Q95 A;  1XGO A;  2BWS A;  3I7M A;  3CB5 A;  2G6P A;  1XGN A;  4S2T P;  4IDY A;  4U76 A;  4MAT A;  4KM3 A;  1WBQ A;  3PKD A;  4FLJ A;  2GG7 A;  2BWU A;  2BHB A;  3FMQ A;  2GU7 A;  4HXX A;  3IL0 A;  5D6E A;  3OVK A;  4U6C A;  1W2M A;  2EA2 A;  3TB5 A;  1WKM A;  2Q94 A;  4EGE A;  2GG9 A;  2GG0 A;  1YVM A;  2BHA A;  3RVA A;  2OAZ A;  2P98 A;  5E2C A;  2GG5 A;  4IPA A;  2EVM A;  1C22 A;  1YW8 A;  4RZY A;  1M35 A;  4R60 A;  1KQ0 A;  2GU4 A;  2NQ6 A;  4IF7 A;  1O0X A;  4U69 A;  2BN7 A;  2P99 A;  1C21 A;  2Q96 A;  1KQ9 A;  3BIQ A;  2BB7 A;  1WN1 A;  4S01 A;  1BN5 A;  2BHC A;  4A6V A;  3D27 A;  4U70 A;  1KP0 A;  4FO8 A;  3CTZ A;  2GGC A; 
#chains in the Genus database with same CATH topology
 4FKC A;  1WLR A;  1R5G A;  5CDE A;  1R58 A;  4PNC A;  3MR1 A;  2Q93 A;  2V6C A;  5JI6 A;  2BWT A;  1Y1N A;  3IU8 A;  4U6J A;  4B28 A;  1R5H A;  3S6B A;  1N51 A;  2EVC A;  1YJ3 A;  3IG4 A;  3FMR A;  2OKN A;  4Z7M A;  2B3K A;  2V3Y A;  5CNX A;  3L7G A;  2GA2 A;  4U73 A;  3BIP A;  5JFR A;  5JHU A;  1XGS A;  5CLS A;  2GZ5 A;  2BH3 A;  4U6W A;  1B6A A;  5E5B A;  2DFI A;  2V3Z A;  4S00 A;  1MAT A;  2Q8K A;  3TAV A;  5FCH A;  2MAT A;  3PKE A;  2HOW A;  1B59 A;  4U75 A;  2BWW A;  2IW2 A;  3QOC A;  1QXW A;  4IKU A;  5CDL A;  3BIT A;  2BHD A;  4A6W A;  3Q6D A;  4S2R P;  4FLI A;  2BWY A;  1WL9 A;  2GTX A;  1A16 A;  4QR8 A;  2V3X A;  5D6F A;  4RZZ A;  4IU6 A;  4U1B A;  1XGM A;  4U6E A;  2EVO A;  4PV4 A;  1YW7 A;  4OOK A;  2BWV A;  1YW9 A;  2GG8 A;  2P9A A;  1QZY A;  2B3L A;  1W7V A;  3IU7 A;  4FO7 A;  4IKS A;  2GU6 A;  2GGB A;  4IKT A;  4IKR A;  3PEB A;  1JAW A;  3L24 A;  4FLL A;  3OOO A;  1WY2 A;  4RGZ 1;  2NQ7 A;  2ZSG A;  4ZWO A;  1WL6 A;  3MX6 A;  3PN9 A;  4U71 A;  4ZWP A;  2GG2 A;  4IEC A;  4JUQ A;  5CIK A;  4ZNG A;  1C24 A;  4ZWU A;  2BWX A;  3MAT A;  2B3H A;  1C23 A;  2EA4 A;  3IU9 A;  1QXY A;  1C27 A;  3CB6 A;  3PKB A;  3ROR A;  4U6Z A;  5CDV A;  1QXZ A;  5CE6 A;  3O5V A;  2ADU A;  4FUK A;  2GU5 A;  2GG3 A;  3PKA A;  3PKC A;  1CHM A;  2Q92 A;  3FM3 A;  4FLK A;  1BOA A;  1PV9 A;  5FCF A;  1XNZ A;  2Q95 A;  1XGO A;  2BWS A;  3I7M A;  3CB5 A;  2G6P A;  1XGN A;  4S2T P;  4IDY A;  4U76 A;  4MAT A;  4KM3 A;  1WBQ A;  3PKD A;  4FLJ A;  2GG7 A;  2BWU A;  2BHB A;  3FMQ A;  2GU7 A;  4HXX A;  3IL0 A;  5D6E A;  3OVK A;  4U6C A;  1W2M A;  2EA2 A;  3TB5 A;  1WKM A;  2Q94 A;  4EGE A;  2GG9 A;  2GG0 A;  1YVM A;  2BHA A;  3RVA A;  2OAZ A;  2P98 A;  5E2C A;  2GG5 A;  4IPA A;  2EVM A;  1C22 A;  1YW8 A;  4RZY A;  1M35 A;  4R60 A;  1KQ0 A;  2GU4 A;  2NQ6 A;  4IF7 A;  1O0X A;  4U69 A;  2BN7 A;  2P99 A;  1C21 A;  2Q96 A;  1KQ9 A;  3BIQ A;  2BB7 A;  1WN1 A;  4S01 A;  1BN5 A;  2BHC A;  4A6V A;  3D27 A;  4U70 A;  1KP0 A;  4FO8 A;  3CTZ A;  2GGC A; 
#chains in the Genus database with same CATH homology
 4FKC A;  1WLR A;  1R5G A;  5CDE A;  1R58 A;  4PNC A;  3MR1 A;  2Q93 A;  2V6C A;  5JI6 A;  2BWT A;  1Y1N A;  3IU8 A;  4U6J A;  4B28 A;  1R5H A;  3S6B A;  1N51 A;  2EVC A;  1YJ3 A;  3IG4 A;  3FMR A;  2OKN A;  4Z7M A;  2B3K A;  2V3Y A;  5CNX A;  3L7G A;  2GA2 A;  4U73 A;  3BIP A;  5JFR A;  5JHU A;  1XGS A;  5CLS A;  2GZ5 A;  2BH3 A;  4U6W A;  1B6A A;  5E5B A;  2DFI A;  2V3Z A;  4S00 A;  1MAT A;  2Q8K A;  3TAV A;  5FCH A;  2MAT A;  3PKE A;  2HOW A;  1B59 A;  4U75 A;  2BWW A;  2IW2 A;  3QOC A;  1QXW A;  4IKU A;  5CDL A;  3BIT A;  2BHD A;  4A6W A;  3Q6D A;  4S2R P;  4FLI A;  2BWY A;  1WL9 A;  2GTX A;  1A16 A;  4QR8 A;  2V3X A;  5D6F A;  4RZZ A;  4IU6 A;  4U1B A;  1XGM A;  4U6E A;  2EVO A;  4PV4 A;  1YW7 A;  4OOK A;  2BWV A;  1YW9 A;  2GG8 A;  2P9A A;  1QZY A;  2B3L A;  1W7V A;  3IU7 A;  4FO7 A;  4IKS A;  2GU6 A;  2GGB A;  4IKT A;  4IKR A;  3PEB A;  1JAW A;  3L24 A;  4FLL A;  3OOO A;  1WY2 A;  4RGZ 1;  2NQ7 A;  2ZSG A;  4ZWO A;  1WL6 A;  3MX6 A;  3PN9 A;  4U71 A;  4ZWP A;  2GG2 A;  4IEC A;  4JUQ A;  5CIK A;  4ZNG A;  1C24 A;  4ZWU A;  2BWX A;  3MAT A;  2B3H A;  1C23 A;  2EA4 A;  3IU9 A;  1QXY A;  1C27 A;  3CB6 A;  3PKB A;  3ROR A;  4U6Z A;  5CDV A;  1QXZ A;  5CE6 A;  3O5V A;  2ADU A;  4FUK A;  2GU5 A;  2GG3 A;  3PKA A;  3PKC A;  1CHM A;  2Q92 A;  3FM3 A;  4FLK A;  1BOA A;  1PV9 A;  5FCF A;  1XNZ A;  2Q95 A;  1XGO A;  2BWS A;  3I7M A;  3CB5 A;  2G6P A;  1XGN A;  4S2T P;  4IDY A;  4U76 A;  4MAT A;  4KM3 A;  1WBQ A;  3PKD A;  4FLJ A;  2GG7 A;  2BWU A;  2BHB A;  3FMQ A;  2GU7 A;  4HXX A;  3IL0 A;  5D6E A;  3OVK A;  4U6C A;  1W2M A;  2EA2 A;  3TB5 A;  1WKM A;  2Q94 A;  4EGE A;  2GG9 A;  2GG0 A;  1YVM A;  2BHA A;  3RVA A;  2OAZ A;  2P98 A;  5E2C A;  2GG5 A;  4IPA A;  2EVM A;  1C22 A;  1YW8 A;  4RZY A;  1M35 A;  4R60 A;  1KQ0 A;  2GU4 A;  2NQ6 A;  4IF7 A;  1O0X A;  4U69 A;  2BN7 A;  2P99 A;  1C21 A;  2Q96 A;  1KQ9 A;  3BIQ A;  2BB7 A;  1WN1 A;  4S01 A;  1BN5 A;  2BHC A;  4A6V A;  3D27 A;  4U70 A;  1KP0 A;  4FO8 A;  3CTZ A;  2GGC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...