2BHBA

Zn substituted e. coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhbA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhbA02
2EA2A 4MATA 2GG8A 1CHMA 2GU6A 2IW2A 5FCHA 1R58A 4B28A 2GG2A 4FLLA 5D6EA 4Z7MA 3TB5A 4IKRA 1BN5A 4HXXA 4FUKA 5JHUA 1WL6A 1YVMA 2GZ5A 3RORA 4KM3A 1WBQA 4IKUA 4IKSA 2BWWA 1C24A 1KQ0A 5JI6A 4S01A 2B3HA 2GGCA 4FO7A 1YW9A 2BB7A 3TAVA 2EVMA 2NQ7A 3PKBA 2B3LA 2Q96A 2ZSGA 4RZYA 3MATA 1XGMA 2BWYA 3FMQA 2B3KA 4FLJA 2V3ZA 5JFRA 2GA2A 5FCFA 3OVKA 3S6BA 1KP0A 2G6PA 4IU6A 3O5VA 2P9AA 4U6ZA 2GU7A 4JUQA 4IKTA 1XNZA 1YW8A 3PN9A 1QXYA 4U6WA 3MR1A 1JAWA 1WL9A 4ZWOA 2BN7A 3L24A 4RZZA 3IG4A 5E5BA 4U6JA 3IL0A 4U76A 4U6CA 4U75A 5CLSA 3Q6DA 2GG9A 4A6VA 3QOCA 1YJ3A 3IU8A 1YW7A 2OAZA 2P99A 2P98A 3PKAA 3PKCA 2V6CA 5CDVA 2DFIA 2HOWA 2BWSA 3BIQA 1QZYA 3L7GA 1QXZA 2GU5A 2BHDA 5E2CA 3IU9A 2GG3A 4PNCA 4RGZ1 2V3YA 3PEBA 2BWXA 4IDYA 1R5GA 1WN1A 1A16A 1KQ9A 2ADUA 4QR8A 4ZNGA 1C21A 3FMRA 2BHAA 4U1BA 2BHBA 2BWTA 1WKMA 4U70A 1W7VA 3CB6A 4U69A 1QXWA 2BWUA 4U6EA 1B6AA 1XGOA 4FKCA 1B59A 2Q93A 2BWVA 3BITA 5CNXA 2Q94A 3PKDA 2BHCA 4S00A 2EA4A 1O0XA 3IU7A 2EVCA 4S2TP 2GU4A 1C27A 1PV9A 5CIKA 4U71A 2Q92A 4A6WA 1WY2A 4IF7A 5CDEA 4U73A 2GG5A 4ZWUA 3MX6A 4EGEA 3RVAA 3BIPA 1R5HA 1MATA 4FLIA 3CB5A 4FLKA 2GG0A 1W2MA 4R60A 2EVOA 3I7MA 2MATA 1M35A 3CTZA 2Q8KA 2OKNA 1C23A 1C22A 4ZWPA 2GG7A 5CE6A 5CDLA 2GGBA 3OOOA 2Q95A 1WLRA 1Y1NA 3FM3A 4IPAA 1N51A 2GTXA 2BH3A 1BOAA 5D6FA 2V3XA 4OOKA 4S2RP 3PKEA 4IECA 4FO8A 4PV4A 1XGNA 3D27A 2NQ6A 1XGSA
chains in the Genus database with same CATH superfamily
2EA2A 4MATA 2GG8A 1CHMA 2GU6A 2IW2A 5FCHA 1R58A 4B28A 2GG2A 4FLLA 5D6EA 4Z7MA 3TB5A 4IKRA 1BN5A 4HXXA 4FUKA 5JHUA 1WL6A 1YVMA 2GZ5A 3RORA 4KM3A 1WBQA 4IKUA 4IKSA 2BWWA 1C24A 1KQ0A 5JI6A 4S01A 2B3HA 2GGCA 4FO7A 1YW9A 2BB7A 3TAVA 2EVMA 2NQ7A 3PKBA 2B3LA 2Q96A 2ZSGA 4RZYA 3MATA 1XGMA 2BWYA 3FMQA 2B3KA 4FLJA 2V3ZA 5JFRA 2GA2A 5FCFA 3OVKA 3S6BA 1KP0A 2G6PA 4IU6A 3O5VA 2P9AA 4U6ZA 2GU7A 4JUQA 4IKTA 1XNZA 1YW8A 3PN9A 1QXYA 4U6WA 3MR1A 1JAWA 1WL9A 4ZWOA 2BN7A 3L24A 4RZZA 3IG4A 5E5BA 4U6JA 3IL0A 4U76A 4U6CA 4U75A 5CLSA 3Q6DA 2GG9A 4A6VA 3QOCA 1YJ3A 3IU8A 1YW7A 2OAZA 2P99A 2P98A 3PKAA 3PKCA 2V6CA 5CDVA 2DFIA 2HOWA 2BWSA 3BIQA 1QZYA 3L7GA 1QXZA 2GU5A 2BHDA 5E2CA 3IU9A 2GG3A 4PNCA 4RGZ1 2V3YA 3PEBA 2BWXA 4IDYA 1R5GA 1WN1A 1A16A 1KQ9A 2ADUA 4QR8A 4ZNGA 1C21A 3FMRA 2BHAA 4U1BA 2BHBA 2BWTA 1WKMA 4U70A 1W7VA 3CB6A 4U69A 1QXWA 2BWUA 4U6EA 1B6AA 1XGOA 4FKCA 1B59A 2Q93A 2BWVA 3BITA 5CNXA 2Q94A 3PKDA 2BHCA 4S00A 2EA4A 1O0XA 3IU7A 2EVCA 4S2TP 2GU4A 1C27A 1PV9A 5CIKA 4U71A 2Q92A 4A6WA 1WY2A 4IF7A 5CDEA 4U73A 2GG5A 4ZWUA 3MX6A 4EGEA 3RVAA 3BIPA 1R5HA 1MATA 4FLIA 3CB5A 4FLKA 2GG0A 1W2MA 4R60A 2EVOA 3I7MA 2MATA 1M35A 3CTZA 2Q8KA 2OKNA 1C23A 1C22A 4ZWPA 2GG7A 5CE6A 5CDLA 2GGBA 3OOOA 2Q95A 1WLRA 1Y1NA 3FM3A 4IPAA 1N51A 2GTXA 2BH3A 1BOAA 5D6FA 2V3XA 4OOKA 4S2RP 3PKEA 4IECA 4FO8A 4PV4A 1XGNA 3D27A 2NQ6A 1XGSA
chains in the Genus database with same CATH topology
2EA2A 4MATA 2GG8A 1CHMA 2GU6A 2IW2A 5FCHA 1R58A 4B28A 2GG2A 4FLLA 5D6EA 4Z7MA 3TB5A 4IKRA 1BN5A 4HXXA 4FUKA 5JHUA 1WL6A 1YVMA 2GZ5A 3RORA 4KM3A 1WBQA 4IKUA 4IKSA 2BWWA 1C24A 1KQ0A 5JI6A 4S01A 2B3HA 2GGCA 4FO7A 1YW9A 2BB7A 3TAVA 2EVMA 2NQ7A 3PKBA 2B3LA 2Q96A 2ZSGA 4RZYA 3MATA 1XGMA 2BWYA 3FMQA 2B3KA 4FLJA 2V3ZA 5JFRA 2GA2A 5FCFA 3OVKA 3S6BA 1KP0A 2G6PA 4IU6A 3O5VA 2P9AA 4U6ZA 2GU7A 4JUQA 4IKTA 1XNZA 1YW8A 3PN9A 1QXYA 4U6WA 3MR1A 1JAWA 1WL9A 4ZWOA 2BN7A 3L24A 4RZZA 3IG4A 5E5BA 4U6JA 3IL0A 4U76A 4U6CA 4U75A 5CLSA 3Q6DA 2GG9A 4A6VA 3QOCA 1YJ3A 3IU8A 1YW7A 2OAZA 2P99A 2P98A 3PKAA 3PKCA 2V6CA 5CDVA 2DFIA 2HOWA 2BWSA 3BIQA 1QZYA 3L7GA 1QXZA 2GU5A 2BHDA 5E2CA 3IU9A 2GG3A 4PNCA 4RGZ1 2V3YA 3PEBA 2BWXA 4IDYA 1R5GA 1WN1A 1A16A 1KQ9A 2ADUA 4QR8A 4ZNGA 1C21A 3FMRA 2BHAA 4U1BA 2BHBA 2BWTA 1WKMA 4U70A 1W7VA 3CB6A 4U69A 1QXWA 2BWUA 4U6EA 1B6AA 1XGOA 4FKCA 1B59A 2Q93A 2BWVA 3BITA 5CNXA 2Q94A 3PKDA 2BHCA 4S00A 2EA4A 1O0XA 3IU7A 2EVCA 4S2TP 2GU4A 1C27A 1PV9A 5CIKA 4U71A 2Q92A 4A6WA 1WY2A 4IF7A 5CDEA 4U73A 2GG5A 4ZWUA 3MX6A 4EGEA 3RVAA 3BIPA 1R5HA 1MATA 4FLIA 3CB5A 4FLKA 2GG0A 1W2MA 4R60A 2EVOA 3I7MA 2MATA 1M35A 3CTZA 2Q8KA 2OKNA 1C23A 1C22A 4ZWPA 2GG7A 5CE6A 5CDLA 2GGBA 3OOOA 2Q95A 1WLRA 1Y1NA 3FM3A 4IPAA 1N51A 2GTXA 2BH3A 1BOAA 5D6FA 2V3XA 4OOKA 4S2RP 3PKEA 4IECA 4FO8A 4PV4A 1XGNA 3D27A 2NQ6A 1XGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EA2 A;  4MAT A;  2GG8 A;  1CHM A;  2GU6 A;  2IW2 A;  5FCH A;  1R58 A;  4B28 A;  2GG2 A;  4FLL A;  5D6E A;  4Z7M A;  3TB5 A;  4IKR A;  1BN5 A;  4HXX A;  4FUK A;  5JHU A;  1WL6 A;  1YVM A;  2GZ5 A;  3ROR A;  4KM3 A;  1WBQ A;  4IKU A;  4IKS A;  2BWW A;  1C24 A;  1KQ0 A;  5JI6 A;  4S01 A;  2B3H A;  2GGC A;  4FO7 A;  1YW9 A;  2BB7 A;  3TAV A;  2EVM A;  2NQ7 A;  3PKB A;  2B3L A;  2Q96 A;  2ZSG A;  4RZY A;  3MAT A;  1XGM A;  2BWY A;  3FMQ A;  2B3K A;  4FLJ A;  2V3Z A;  5JFR A;  2GA2 A;  5FCF A;  3OVK A;  3S6B A;  1KP0 A;  2G6P A;  4IU6 A;  3O5V A;  2P9A A;  4U6Z A;  2GU7 A;  4JUQ A;  4IKT A;  1XNZ A;  1YW8 A;  3PN9 A;  1QXY A;  4U6W A;  3MR1 A;  1JAW A;  1WL9 A;  4ZWO A;  2BN7 A;  3L24 A;  4RZZ A;  3IG4 A;  5E5B A;  4U6J A;  3IL0 A;  4U76 A;  4U6C A;  4U75 A;  5CLS A;  3Q6D A;  2GG9 A;  4A6V A;  3QOC A;  1YJ3 A;  3IU8 A;  1YW7 A;  2OAZ A;  2P99 A;  2P98 A;  3PKA A;  3PKC A;  2V6C A;  5CDV A;  2DFI A;  2HOW A;  2BWS A;  3BIQ A;  1QZY A;  3L7G A;  1QXZ A;  2GU5 A;  2BHD A;  5E2C A;  3IU9 A;  2GG3 A;  4PNC A;  4RGZ 1;  2V3Y A;  3PEB A;  2BWX A;  4IDY A;  1R5G A;  1WN1 A;  1A16 A;  1KQ9 A;  2ADU A;  4QR8 A;  4ZNG A;  1C21 A;  3FMR A;  2BHA A;  4U1B A;  2BHB A;  2BWT A;  1WKM A;  4U70 A;  1W7V A;  3CB6 A;  4U69 A;  1QXW A;  2BWU A;  4U6E A;  1B6A A;  1XGO A;  4FKC A;  1B59 A;  2Q93 A;  2BWV A;  3BIT A;  5CNX A;  2Q94 A;  3PKD A;  2BHC A;  4S00 A;  2EA4 A;  1O0X A;  3IU7 A;  2EVC A;  4S2T P;  2GU4 A;  1C27 A;  1PV9 A;  5CIK A;  4U71 A;  2Q92 A;  4A6W A;  1WY2 A;  4IF7 A;  5CDE A;  4U73 A;  2GG5 A;  4ZWU A;  3MX6 A;  4EGE A;  3RVA A;  3BIP A;  1R5H A;  1MAT A;  4FLI A;  3CB5 A;  4FLK A;  2GG0 A;  1W2M A;  4R60 A;  2EVO A;  3I7M A;  2MAT A;  1M35 A;  3CTZ A;  2Q8K A;  2OKN A;  1C23 A;  1C22 A;  4ZWP A;  2GG7 A;  5CE6 A;  5CDL A;  2GGB A;  3OOO A;  2Q95 A;  1WLR A;  1Y1N A;  3FM3 A;  4IPA A;  1N51 A;  2GTX A;  2BH3 A;  1BOA A;  5D6F A;  2V3X A;  4OOK A;  4S2R P;  3PKE A;  4IEC A;  4FO8 A;  4PV4 A;  1XGN A;  3D27 A;  2NQ6 A;  1XGS A; 
#chains in the Genus database with same CATH topology
 2EA2 A;  4MAT A;  2GG8 A;  1CHM A;  2GU6 A;  2IW2 A;  5FCH A;  1R58 A;  4B28 A;  2GG2 A;  4FLL A;  5D6E A;  4Z7M A;  3TB5 A;  4IKR A;  1BN5 A;  4HXX A;  4FUK A;  5JHU A;  1WL6 A;  1YVM A;  2GZ5 A;  3ROR A;  4KM3 A;  1WBQ A;  4IKU A;  4IKS A;  2BWW A;  1C24 A;  1KQ0 A;  5JI6 A;  4S01 A;  2B3H A;  2GGC A;  4FO7 A;  1YW9 A;  2BB7 A;  3TAV A;  2EVM A;  2NQ7 A;  3PKB A;  2B3L A;  2Q96 A;  2ZSG A;  4RZY A;  3MAT A;  1XGM A;  2BWY A;  3FMQ A;  2B3K A;  4FLJ A;  2V3Z A;  5JFR A;  2GA2 A;  5FCF A;  3OVK A;  3S6B A;  1KP0 A;  2G6P A;  4IU6 A;  3O5V A;  2P9A A;  4U6Z A;  2GU7 A;  4JUQ A;  4IKT A;  1XNZ A;  1YW8 A;  3PN9 A;  1QXY A;  4U6W A;  3MR1 A;  1JAW A;  1WL9 A;  4ZWO A;  2BN7 A;  3L24 A;  4RZZ A;  3IG4 A;  5E5B A;  4U6J A;  3IL0 A;  4U76 A;  4U6C A;  4U75 A;  5CLS A;  3Q6D A;  2GG9 A;  4A6V A;  3QOC A;  1YJ3 A;  3IU8 A;  1YW7 A;  2OAZ A;  2P99 A;  2P98 A;  3PKA A;  3PKC A;  2V6C A;  5CDV A;  2DFI A;  2HOW A;  2BWS A;  3BIQ A;  1QZY A;  3L7G A;  1QXZ A;  2GU5 A;  2BHD A;  5E2C A;  3IU9 A;  2GG3 A;  4PNC A;  4RGZ 1;  2V3Y A;  3PEB A;  2BWX A;  4IDY A;  1R5G A;  1WN1 A;  1A16 A;  1KQ9 A;  2ADU A;  4QR8 A;  4ZNG A;  1C21 A;  3FMR A;  2BHA A;  4U1B A;  2BHB A;  2BWT A;  1WKM A;  4U70 A;  1W7V A;  3CB6 A;  4U69 A;  1QXW A;  2BWU A;  4U6E A;  1B6A A;  1XGO A;  4FKC A;  1B59 A;  2Q93 A;  2BWV A;  3BIT A;  5CNX A;  2Q94 A;  3PKD A;  2BHC A;  4S00 A;  2EA4 A;  1O0X A;  3IU7 A;  2EVC A;  4S2T P;  2GU4 A;  1C27 A;  1PV9 A;  5CIK A;  4U71 A;  2Q92 A;  4A6W A;  1WY2 A;  4IF7 A;  5CDE A;  4U73 A;  2GG5 A;  4ZWU A;  3MX6 A;  4EGE A;  3RVA A;  3BIP A;  1R5H A;  1MAT A;  4FLI A;  3CB5 A;  4FLK A;  2GG0 A;  1W2M A;  4R60 A;  2EVO A;  3I7M A;  2MAT A;  1M35 A;  3CTZ A;  2Q8K A;  2OKN A;  1C23 A;  1C22 A;  4ZWP A;  2GG7 A;  5CE6 A;  5CDL A;  2GGB A;  3OOO A;  2Q95 A;  1WLR A;  1Y1N A;  3FM3 A;  4IPA A;  1N51 A;  2GTX A;  2BH3 A;  1BOA A;  5D6F A;  2V3X A;  4OOK A;  4S2R P;  3PKE A;  4IEC A;  4FO8 A;  4PV4 A;  1XGN A;  3D27 A;  2NQ6 A;  1XGS A; 
#chains in the Genus database with same CATH homology
 2EA2 A;  4MAT A;  2GG8 A;  1CHM A;  2GU6 A;  2IW2 A;  5FCH A;  1R58 A;  4B28 A;  2GG2 A;  4FLL A;  5D6E A;  4Z7M A;  3TB5 A;  4IKR A;  1BN5 A;  4HXX A;  4FUK A;  5JHU A;  1WL6 A;  1YVM A;  2GZ5 A;  3ROR A;  4KM3 A;  1WBQ A;  4IKU A;  4IKS A;  2BWW A;  1C24 A;  1KQ0 A;  5JI6 A;  4S01 A;  2B3H A;  2GGC A;  4FO7 A;  1YW9 A;  2BB7 A;  3TAV A;  2EVM A;  2NQ7 A;  3PKB A;  2B3L A;  2Q96 A;  2ZSG A;  4RZY A;  3MAT A;  1XGM A;  2BWY A;  3FMQ A;  2B3K A;  4FLJ A;  2V3Z A;  5JFR A;  2GA2 A;  5FCF A;  3OVK A;  3S6B A;  1KP0 A;  2G6P A;  4IU6 A;  3O5V A;  2P9A A;  4U6Z A;  2GU7 A;  4JUQ A;  4IKT A;  1XNZ A;  1YW8 A;  3PN9 A;  1QXY A;  4U6W A;  3MR1 A;  1JAW A;  1WL9 A;  4ZWO A;  2BN7 A;  3L24 A;  4RZZ A;  3IG4 A;  5E5B A;  4U6J A;  3IL0 A;  4U76 A;  4U6C A;  4U75 A;  5CLS A;  3Q6D A;  2GG9 A;  4A6V A;  3QOC A;  1YJ3 A;  3IU8 A;  1YW7 A;  2OAZ A;  2P99 A;  2P98 A;  3PKA A;  3PKC A;  2V6C A;  5CDV A;  2DFI A;  2HOW A;  2BWS A;  3BIQ A;  1QZY A;  3L7G A;  1QXZ A;  2GU5 A;  2BHD A;  5E2C A;  3IU9 A;  2GG3 A;  4PNC A;  4RGZ 1;  2V3Y A;  3PEB A;  2BWX A;  4IDY A;  1R5G A;  1WN1 A;  1A16 A;  1KQ9 A;  2ADU A;  4QR8 A;  4ZNG A;  1C21 A;  3FMR A;  2BHA A;  4U1B A;  2BHB A;  2BWT A;  1WKM A;  4U70 A;  1W7V A;  3CB6 A;  4U69 A;  1QXW A;  2BWU A;  4U6E A;  1B6A A;  1XGO A;  4FKC A;  1B59 A;  2Q93 A;  2BWV A;  3BIT A;  5CNX A;  2Q94 A;  3PKD A;  2BHC A;  4S00 A;  2EA4 A;  1O0X A;  3IU7 A;  2EVC A;  4S2T P;  2GU4 A;  1C27 A;  1PV9 A;  5CIK A;  4U71 A;  2Q92 A;  4A6W A;  1WY2 A;  4IF7 A;  5CDE A;  4U73 A;  2GG5 A;  4ZWU A;  3MX6 A;  4EGE A;  3RVA A;  3BIP A;  1R5H A;  1MAT A;  4FLI A;  3CB5 A;  4FLK A;  2GG0 A;  1W2M A;  4R60 A;  2EVO A;  3I7M A;  2MAT A;  1M35 A;  3CTZ A;  2Q8K A;  2OKN A;  1C23 A;  1C22 A;  4ZWP A;  2GG7 A;  5CE6 A;  5CDL A;  2GGB A;  3OOO A;  2Q95 A;  1WLR A;  1Y1N A;  3FM3 A;  4IPA A;  1N51 A;  2GTX A;  2BH3 A;  1BOA A;  5D6F A;  2V3X A;  4OOK A;  4S2R P;  3PKE A;  4IEC A;  4FO8 A;  4PV4 A;  1XGN A;  3D27 A;  2NQ6 A;  1XGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...