2BHBA

Zn substituted e. coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhbA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhbA02
2B3LA 5E5BA 3I7MA 5CIKA 1QXZA 4S2RP 2EVCA 2GTXA 4U6CA 1B59A 1KP0A 4ZWUA 2Q92A 5FCFA 5FCHA 4MATA 2B3KA 2BWWA 3IU7A 4U1BA 2V6CA 2Q96A 3D27A 3OOOA 2GU7A 5CE6A 1XNZA 1WKMA 4U71A 4IKUA 3PN9A 4FLKA 5E2CA 2ZSGA 4A6WA 1YW7A 2P98A 4HXXA 3PKEA 1WL9A 2NQ6A 1WN1A 4FO7A 2GG0A 2G6PA 4U76A 4FKCA 3O5VA 2EVMA 5CDVA 2GGCA 4ZWOA 2MATA 1M35A 4FLJA 4U6WA 1PV9A 2GG7A 2NQ7A 2Q8KA 2HOWA 3BIQA 3IG4A 3S6BA 2GU5A 3IU9A 3FMRA 1XGOA 1MATA 5JHUA 1WBQA 4S2TP 3PKAA 1BOAA 2OAZA 1JAWA 1QXWA 2V3XA 2GGBA 1N51A 4ZNGA 2BWSA 2P99A 2Q94A 4IF7A 4S01A 4RZZA 3MX6A 2BB7A 3IU8A 2BH3A 2GA2A 2V3YA 4FLIA 1C22A 1KQ9A 1R5GA 5JI6A 4U73A 1QXYA 4IECA 4IU6A 2Q93A 2P9AA 1YJ3A 1C21A 2GG8A 1A16A 3TAVA 2Q95A 4FLLA 3MR1A 1XGNA 3FM3A 5D6EA 2DFIA 4IPAA 2EA2A 2BWYA 4OOKA 4A6VA 2GZ5A 3QOCA 4JUQA 5CLSA 4IKRA 3IL0A 3Q6DA 4IDYA 2BWXA 2GU6A 2GG9A 4PNCA 2BWUA 1C27A 3RORA 5JFRA 4QR8A 4R60A 1O0XA 4U6EA 3CTZA 4U75A 1WL6A 3PEBA 2BWTA 4Z7MA 1XGSA 5D6FA 1CHMA 2BHCA 1WY2A 2ADUA 4IKSA 1Y1NA 1KQ0A 2OKNA 2GG5A 3CB6A 2EVOA 5CNXA 1R5HA 1R58A 3PKDA 4KM3A 3BIPA 2BHDA 3FMQA 3L7GA 4S00A 5CDEA 4U70A 3MATA 3BITA 1W7VA 2BHAA 4EGEA 4RGZ1 2BN7A 1C24A 3L24A 1BN5A 1YVMA 2B3HA 4RZYA 4PV4A 2GG3A 4U6JA 4B28A 3OVKA 1XGMA 3CB5A 1YW8A 1B6AA 3RVAA 3PKBA 2BWVA 5CDLA 4FUKA 1QZYA 2GU4A 3TB5A 1WLRA 1W2MA 3PKCA 2BHBA 2GG2A 1C23A 2IW2A 2EA4A 4FO8A 4IKTA 4U69A 4U6ZA 1YW9A 2V3ZA 4ZWPA
chains in the Genus database with same CATH superfamily
2B3LA 5E5BA 3I7MA 5CIKA 1QXZA 4S2RP 2EVCA 2GTXA 4U6CA 1B59A 1KP0A 4ZWUA 2Q92A 5FCFA 5FCHA 4MATA 2B3KA 2BWWA 3IU7A 4U1BA 2V6CA 2Q96A 3D27A 3OOOA 2GU7A 5CE6A 1XNZA 1WKMA 4U71A 4IKUA 3PN9A 4FLKA 5E2CA 2ZSGA 4A6WA 1YW7A 2P98A 4HXXA 3PKEA 1WL9A 2NQ6A 1WN1A 4FO7A 2GG0A 2G6PA 4U76A 4FKCA 3O5VA 2EVMA 5CDVA 2GGCA 4ZWOA 2MATA 1M35A 4FLJA 4U6WA 1PV9A 2GG7A 2NQ7A 2Q8KA 2HOWA 3BIQA 3IG4A 3S6BA 2GU5A 3IU9A 3FMRA 1XGOA 1MATA 5JHUA 1WBQA 4S2TP 3PKAA 1BOAA 2OAZA 1JAWA 1QXWA 2V3XA 2GGBA 1N51A 4ZNGA 2BWSA 2P99A 2Q94A 4IF7A 4S01A 4RZZA 3MX6A 2BB7A 3IU8A 2BH3A 2GA2A 2V3YA 4FLIA 1C22A 1KQ9A 1R5GA 5JI6A 4U73A 1QXYA 4IECA 4IU6A 2Q93A 2P9AA 1YJ3A 1C21A 2GG8A 1A16A 3TAVA 2Q95A 4FLLA 3MR1A 1XGNA 3FM3A 5D6EA 2DFIA 4IPAA 2EA2A 2BWYA 4OOKA 4A6VA 2GZ5A 3QOCA 4JUQA 5CLSA 4IKRA 3IL0A 3Q6DA 4IDYA 2BWXA 2GU6A 2GG9A 4PNCA 2BWUA 1C27A 3RORA 5JFRA 4QR8A 4R60A 1O0XA 4U6EA 3CTZA 4U75A 1WL6A 3PEBA 2BWTA 4Z7MA 1XGSA 5D6FA 1CHMA 2BHCA 1WY2A 2ADUA 4IKSA 1Y1NA 1KQ0A 2OKNA 2GG5A 3CB6A 2EVOA 5CNXA 1R5HA 1R58A 3PKDA 4KM3A 3BIPA 2BHDA 3FMQA 3L7GA 4S00A 5CDEA 4U70A 3MATA 3BITA 1W7VA 2BHAA 4EGEA 4RGZ1 2BN7A 1C24A 3L24A 1BN5A 1YVMA 2B3HA 4RZYA 4PV4A 2GG3A 4U6JA 4B28A 3OVKA 1XGMA 3CB5A 1YW8A 1B6AA 3RVAA 3PKBA 2BWVA 5CDLA 4FUKA 1QZYA 2GU4A 3TB5A 1WLRA 1W2MA 3PKCA 2BHBA 2GG2A 1C23A 2IW2A 2EA4A 4FO8A 4IKTA 4U69A 4U6ZA 1YW9A 2V3ZA 4ZWPA
chains in the Genus database with same CATH topology
2B3LA 5E5BA 3I7MA 5CIKA 1QXZA 4S2RP 2EVCA 2GTXA 4U6CA 1B59A 1KP0A 4ZWUA 2Q92A 5FCFA 5FCHA 4MATA 2B3KA 2BWWA 3IU7A 4U1BA 2V6CA 2Q96A 3D27A 3OOOA 2GU7A 5CE6A 1XNZA 1WKMA 4U71A 4IKUA 3PN9A 4FLKA 5E2CA 2ZSGA 4A6WA 1YW7A 2P98A 4HXXA 3PKEA 1WL9A 2NQ6A 1WN1A 4FO7A 2GG0A 2G6PA 4U76A 4FKCA 3O5VA 2EVMA 5CDVA 2GGCA 4ZWOA 2MATA 1M35A 4FLJA 4U6WA 1PV9A 2GG7A 2NQ7A 2Q8KA 2HOWA 3BIQA 3IG4A 3S6BA 2GU5A 3IU9A 3FMRA 1XGOA 1MATA 5JHUA 1WBQA 4S2TP 3PKAA 1BOAA 2OAZA 1JAWA 1QXWA 2V3XA 2GGBA 1N51A 4ZNGA 2BWSA 2P99A 2Q94A 4IF7A 4S01A 4RZZA 3MX6A 2BB7A 3IU8A 2BH3A 2GA2A 2V3YA 4FLIA 1C22A 1KQ9A 1R5GA 5JI6A 4U73A 1QXYA 4IECA 4IU6A 2Q93A 2P9AA 1YJ3A 1C21A 2GG8A 1A16A 3TAVA 2Q95A 4FLLA 3MR1A 1XGNA 3FM3A 5D6EA 2DFIA 4IPAA 2EA2A 2BWYA 4OOKA 4A6VA 2GZ5A 3QOCA 4JUQA 5CLSA 4IKRA 3IL0A 3Q6DA 4IDYA 2BWXA 2GU6A 2GG9A 4PNCA 2BWUA 1C27A 3RORA 5JFRA 4QR8A 4R60A 1O0XA 4U6EA 3CTZA 4U75A 1WL6A 3PEBA 2BWTA 4Z7MA 1XGSA 5D6FA 1CHMA 2BHCA 1WY2A 2ADUA 4IKSA 1Y1NA 1KQ0A 2OKNA 2GG5A 3CB6A 2EVOA 5CNXA 1R5HA 1R58A 3PKDA 4KM3A 3BIPA 2BHDA 3FMQA 3L7GA 4S00A 5CDEA 4U70A 3MATA 3BITA 1W7VA 2BHAA 4EGEA 4RGZ1 2BN7A 1C24A 3L24A 1BN5A 1YVMA 2B3HA 4RZYA 4PV4A 2GG3A 4U6JA 4B28A 3OVKA 1XGMA 3CB5A 1YW8A 1B6AA 3RVAA 3PKBA 2BWVA 5CDLA 4FUKA 1QZYA 2GU4A 3TB5A 1WLRA 1W2MA 3PKCA 2BHBA 2GG2A 1C23A 2IW2A 2EA4A 4FO8A 4IKTA 4U69A 4U6ZA 1YW9A 2V3ZA 4ZWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B3L A;  5E5B A;  3I7M A;  5CIK A;  1QXZ A;  4S2R P;  2EVC A;  2GTX A;  4U6C A;  1B59 A;  1KP0 A;  4ZWU A;  2Q92 A;  5FCF A;  5FCH A;  4MAT A;  2B3K A;  2BWW A;  3IU7 A;  4U1B A;  2V6C A;  2Q96 A;  3D27 A;  3OOO A;  2GU7 A;  5CE6 A;  1XNZ A;  1WKM A;  4U71 A;  4IKU A;  3PN9 A;  4FLK A;  5E2C A;  2ZSG A;  4A6W A;  1YW7 A;  2P98 A;  4HXX A;  3PKE A;  1WL9 A;  2NQ6 A;  1WN1 A;  4FO7 A;  2GG0 A;  2G6P A;  4U76 A;  4FKC A;  3O5V A;  2EVM A;  5CDV A;  2GGC A;  4ZWO A;  2MAT A;  1M35 A;  4FLJ A;  4U6W A;  1PV9 A;  2GG7 A;  2NQ7 A;  2Q8K A;  2HOW A;  3BIQ A;  3IG4 A;  3S6B A;  2GU5 A;  3IU9 A;  3FMR A;  1XGO A;  1MAT A;  5JHU A;  1WBQ A;  4S2T P;  3PKA A;  1BOA A;  2OAZ A;  1JAW A;  1QXW A;  2V3X A;  2GGB A;  1N51 A;  4ZNG A;  2BWS A;  2P99 A;  2Q94 A;  4IF7 A;  4S01 A;  4RZZ A;  3MX6 A;  2BB7 A;  3IU8 A;  2BH3 A;  2GA2 A;  2V3Y A;  4FLI A;  1C22 A;  1KQ9 A;  1R5G A;  5JI6 A;  4U73 A;  1QXY A;  4IEC A;  4IU6 A;  2Q93 A;  2P9A A;  1YJ3 A;  1C21 A;  2GG8 A;  1A16 A;  3TAV A;  2Q95 A;  4FLL A;  3MR1 A;  1XGN A;  3FM3 A;  5D6E A;  2DFI A;  4IPA A;  2EA2 A;  2BWY A;  4OOK A;  4A6V A;  2GZ5 A;  3QOC A;  4JUQ A;  5CLS A;  4IKR A;  3IL0 A;  3Q6D A;  4IDY A;  2BWX A;  2GU6 A;  2GG9 A;  4PNC A;  2BWU A;  1C27 A;  3ROR A;  5JFR A;  4QR8 A;  4R60 A;  1O0X A;  4U6E A;  3CTZ A;  4U75 A;  1WL6 A;  3PEB A;  2BWT A;  4Z7M A;  1XGS A;  5D6F A;  1CHM A;  2BHC A;  1WY2 A;  2ADU A;  4IKS A;  1Y1N A;  1KQ0 A;  2OKN A;  2GG5 A;  3CB6 A;  2EVO A;  5CNX A;  1R5H A;  1R58 A;  3PKD A;  4KM3 A;  3BIP A;  2BHD A;  3FMQ A;  3L7G A;  4S00 A;  5CDE A;  4U70 A;  3MAT A;  3BIT A;  1W7V A;  2BHA A;  4EGE A;  4RGZ 1;  2BN7 A;  1C24 A;  3L24 A;  1BN5 A;  1YVM A;  2B3H A;  4RZY A;  4PV4 A;  2GG3 A;  4U6J A;  4B28 A;  3OVK A;  1XGM A;  3CB5 A;  1YW8 A;  1B6A A;  3RVA A;  3PKB A;  2BWV A;  5CDL A;  4FUK A;  1QZY A;  2GU4 A;  3TB5 A;  1WLR A;  1W2M A;  3PKC A;  2BHB A;  2GG2 A;  1C23 A;  2IW2 A;  2EA4 A;  4FO8 A;  4IKT A;  4U69 A;  4U6Z A;  1YW9 A;  2V3Z A;  4ZWP A; 
#chains in the Genus database with same CATH topology
 2B3L A;  5E5B A;  3I7M A;  5CIK A;  1QXZ A;  4S2R P;  2EVC A;  2GTX A;  4U6C A;  1B59 A;  1KP0 A;  4ZWU A;  2Q92 A;  5FCF A;  5FCH A;  4MAT A;  2B3K A;  2BWW A;  3IU7 A;  4U1B A;  2V6C A;  2Q96 A;  3D27 A;  3OOO A;  2GU7 A;  5CE6 A;  1XNZ A;  1WKM A;  4U71 A;  4IKU A;  3PN9 A;  4FLK A;  5E2C A;  2ZSG A;  4A6W A;  1YW7 A;  2P98 A;  4HXX A;  3PKE A;  1WL9 A;  2NQ6 A;  1WN1 A;  4FO7 A;  2GG0 A;  2G6P A;  4U76 A;  4FKC A;  3O5V A;  2EVM A;  5CDV A;  2GGC A;  4ZWO A;  2MAT A;  1M35 A;  4FLJ A;  4U6W A;  1PV9 A;  2GG7 A;  2NQ7 A;  2Q8K A;  2HOW A;  3BIQ A;  3IG4 A;  3S6B A;  2GU5 A;  3IU9 A;  3FMR A;  1XGO A;  1MAT A;  5JHU A;  1WBQ A;  4S2T P;  3PKA A;  1BOA A;  2OAZ A;  1JAW A;  1QXW A;  2V3X A;  2GGB A;  1N51 A;  4ZNG A;  2BWS A;  2P99 A;  2Q94 A;  4IF7 A;  4S01 A;  4RZZ A;  3MX6 A;  2BB7 A;  3IU8 A;  2BH3 A;  2GA2 A;  2V3Y A;  4FLI A;  1C22 A;  1KQ9 A;  1R5G A;  5JI6 A;  4U73 A;  1QXY A;  4IEC A;  4IU6 A;  2Q93 A;  2P9A A;  1YJ3 A;  1C21 A;  2GG8 A;  1A16 A;  3TAV A;  2Q95 A;  4FLL A;  3MR1 A;  1XGN A;  3FM3 A;  5D6E A;  2DFI A;  4IPA A;  2EA2 A;  2BWY A;  4OOK A;  4A6V A;  2GZ5 A;  3QOC A;  4JUQ A;  5CLS A;  4IKR A;  3IL0 A;  3Q6D A;  4IDY A;  2BWX A;  2GU6 A;  2GG9 A;  4PNC A;  2BWU A;  1C27 A;  3ROR A;  5JFR A;  4QR8 A;  4R60 A;  1O0X A;  4U6E A;  3CTZ A;  4U75 A;  1WL6 A;  3PEB A;  2BWT A;  4Z7M A;  1XGS A;  5D6F A;  1CHM A;  2BHC A;  1WY2 A;  2ADU A;  4IKS A;  1Y1N A;  1KQ0 A;  2OKN A;  2GG5 A;  3CB6 A;  2EVO A;  5CNX A;  1R5H A;  1R58 A;  3PKD A;  4KM3 A;  3BIP A;  2BHD A;  3FMQ A;  3L7G A;  4S00 A;  5CDE A;  4U70 A;  3MAT A;  3BIT A;  1W7V A;  2BHA A;  4EGE A;  4RGZ 1;  2BN7 A;  1C24 A;  3L24 A;  1BN5 A;  1YVM A;  2B3H A;  4RZY A;  4PV4 A;  2GG3 A;  4U6J A;  4B28 A;  3OVK A;  1XGM A;  3CB5 A;  1YW8 A;  1B6A A;  3RVA A;  3PKB A;  2BWV A;  5CDL A;  4FUK A;  1QZY A;  2GU4 A;  3TB5 A;  1WLR A;  1W2M A;  3PKC A;  2BHB A;  2GG2 A;  1C23 A;  2IW2 A;  2EA4 A;  4FO8 A;  4IKT A;  4U69 A;  4U6Z A;  1YW9 A;  2V3Z A;  4ZWP A; 
#chains in the Genus database with same CATH homology
 2B3L A;  5E5B A;  3I7M A;  5CIK A;  1QXZ A;  4S2R P;  2EVC A;  2GTX A;  4U6C A;  1B59 A;  1KP0 A;  4ZWU A;  2Q92 A;  5FCF A;  5FCH A;  4MAT A;  2B3K A;  2BWW A;  3IU7 A;  4U1B A;  2V6C A;  2Q96 A;  3D27 A;  3OOO A;  2GU7 A;  5CE6 A;  1XNZ A;  1WKM A;  4U71 A;  4IKU A;  3PN9 A;  4FLK A;  5E2C A;  2ZSG A;  4A6W A;  1YW7 A;  2P98 A;  4HXX A;  3PKE A;  1WL9 A;  2NQ6 A;  1WN1 A;  4FO7 A;  2GG0 A;  2G6P A;  4U76 A;  4FKC A;  3O5V A;  2EVM A;  5CDV A;  2GGC A;  4ZWO A;  2MAT A;  1M35 A;  4FLJ A;  4U6W A;  1PV9 A;  2GG7 A;  2NQ7 A;  2Q8K A;  2HOW A;  3BIQ A;  3IG4 A;  3S6B A;  2GU5 A;  3IU9 A;  3FMR A;  1XGO A;  1MAT A;  5JHU A;  1WBQ A;  4S2T P;  3PKA A;  1BOA A;  2OAZ A;  1JAW A;  1QXW A;  2V3X A;  2GGB A;  1N51 A;  4ZNG A;  2BWS A;  2P99 A;  2Q94 A;  4IF7 A;  4S01 A;  4RZZ A;  3MX6 A;  2BB7 A;  3IU8 A;  2BH3 A;  2GA2 A;  2V3Y A;  4FLI A;  1C22 A;  1KQ9 A;  1R5G A;  5JI6 A;  4U73 A;  1QXY A;  4IEC A;  4IU6 A;  2Q93 A;  2P9A A;  1YJ3 A;  1C21 A;  2GG8 A;  1A16 A;  3TAV A;  2Q95 A;  4FLL A;  3MR1 A;  1XGN A;  3FM3 A;  5D6E A;  2DFI A;  4IPA A;  2EA2 A;  2BWY A;  4OOK A;  4A6V A;  2GZ5 A;  3QOC A;  4JUQ A;  5CLS A;  4IKR A;  3IL0 A;  3Q6D A;  4IDY A;  2BWX A;  2GU6 A;  2GG9 A;  4PNC A;  2BWU A;  1C27 A;  3ROR A;  5JFR A;  4QR8 A;  4R60 A;  1O0X A;  4U6E A;  3CTZ A;  4U75 A;  1WL6 A;  3PEB A;  2BWT A;  4Z7M A;  1XGS A;  5D6F A;  1CHM A;  2BHC A;  1WY2 A;  2ADU A;  4IKS A;  1Y1N A;  1KQ0 A;  2OKN A;  2GG5 A;  3CB6 A;  2EVO A;  5CNX A;  1R5H A;  1R58 A;  3PKD A;  4KM3 A;  3BIP A;  2BHD A;  3FMQ A;  3L7G A;  4S00 A;  5CDE A;  4U70 A;  3MAT A;  3BIT A;  1W7V A;  2BHA A;  4EGE A;  4RGZ 1;  2BN7 A;  1C24 A;  3L24 A;  1BN5 A;  1YVM A;  2B3H A;  4RZY A;  4PV4 A;  2GG3 A;  4U6J A;  4B28 A;  3OVK A;  1XGM A;  3CB5 A;  1YW8 A;  1B6A A;  3RVA A;  3PKB A;  2BWV A;  5CDL A;  4FUK A;  1QZY A;  2GU4 A;  3TB5 A;  1WLR A;  1W2M A;  3PKC A;  2BHB A;  2GG2 A;  1C23 A;  2IW2 A;  2EA4 A;  4FO8 A;  4IKT A;  4U69 A;  4U6Z A;  1YW9 A;  2V3Z A;  4ZWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...