2BHBA

Zn substituted e. coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
total genus 160
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhbA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhbA02
3IU9A 3PKCA 1BOAA 3S6BA 2OKNA 3L24A 4FLLA 2NQ6A 5D6FA 2GU5A 5JHUA 3BIPA 1QXWA 2Q94A 4U76A 4U70A 4ZWUA 2P99A 2NQ7A 1YW9A 3PKAA 2GG8A 1XGSA 1MATA 2GG9A 4EGEA 2EVOA 2BHCA 1XGOA 2GU7A 3L7GA 2V3YA 4RZZA 3IG4A 4R60A 3BITA 2V3ZA 4FUKA 4U69A 5JI6A 3PEBA 4U75A 4IKSA 1WKMA 1QXZA 1C23A 2BWUA 4U6CA 2B3HA 1JAWA 4MATA 2BB7A 1PV9A 3FM3A 1WL6A 4PV4A 3BIQA 5CE6A 2GU4A 1KQ9A 4FO7A 2BWWA 1XNZA 2OAZA 3RVAA 2V3XA 4ZWPA 2EA4A 3Q6DA 4HXXA 2G6PA 2GG5A 4FKCA 4ZWOA 4IU6A 4Z7MA 4KM3A 3IU8A 4IDYA 2BWVA 2GU6A 3O5VA 1C27A 1KP0A 3MX6A 1BN5A 2GG2A 1R5GA 2BN7A 2GG0A 3QOCA 3CB5A 4IF7A 4U71A 4U1BA 1WBQA 3FMQA 4U73A 1KQ0A 4FLKA 3IL0A 3PN9A 1A16A 1B6AA 5CIKA 1WY2A 3MATA 1O0XA 2MATA 1M35A 4S00A 1YW8A 3FMRA 5CDLA 2EVCA 2Q95A 1B59A 4U6ZA 1N51A 4IECA 4S2RP 1C21A 3D27A 3PKBA 2P9AA 2HOWA 3MR1A 5CDVA 1YVMA 4JUQA 4RZYA 1XGNA 5FCHA 2BWXA 3PKEA 4OOKA 4FO8A 4A6VA 2IW2A 5E5BA 1QXYA 4RGZ1 2BHDA 5CNXA 3TAVA 2ADUA 4IKTA 4S2TP 3IU7A 1C22A 4B28A 1QZYA 3TB5A 2DFIA 2B3KA 5CDEA 2B3LA 3CB6A 4U6JA 1WN1A 4QR8A 1R5HA 2GGBA 2GG7A 2V6CA 4U6EA 3RORA 1W2MA 3I7MA 2EVMA 2GGCA 4IKUA 1C24A 5CLSA 1CHMA 2ZSGA 3OOOA 1W7VA 4S01A 1R58A 4PNCA 2BHAA 2BWYA 1YW7A 4IPAA 3CTZA 1Y1NA 4IKRA 2BWTA 3OVKA 2P98A 2BH3A 4ZNGA 4FLJA 4FLIA 2BWSA 2GG3A 2GZ5A 2Q96A 2Q92A 2EA2A 3PKDA 5E2CA 2GA2A 2Q8KA 2GTXA 4A6WA 5JFRA 2BHBA 1XGMA 2Q93A 1YJ3A 4U6WA 5D6EA 1WLRA 5FCFA 1WL9A
chains in the Genus database with same CATH superfamily
3IU9A 3PKCA 1BOAA 3S6BA 2OKNA 3L24A 4FLLA 2NQ6A 5D6FA 2GU5A 5JHUA 3BIPA 1QXWA 2Q94A 4U76A 4U70A 4ZWUA 2P99A 2NQ7A 1YW9A 3PKAA 2GG8A 1XGSA 1MATA 2GG9A 4EGEA 2EVOA 2BHCA 1XGOA 2GU7A 3L7GA 2V3YA 4RZZA 3IG4A 4R60A 3BITA 2V3ZA 4FUKA 4U69A 5JI6A 3PEBA 4U75A 4IKSA 1WKMA 1QXZA 1C23A 2BWUA 4U6CA 2B3HA 1JAWA 4MATA 2BB7A 1PV9A 3FM3A 1WL6A 4PV4A 3BIQA 5CE6A 2GU4A 1KQ9A 4FO7A 2BWWA 1XNZA 2OAZA 3RVAA 2V3XA 4ZWPA 2EA4A 3Q6DA 4HXXA 2G6PA 2GG5A 4FKCA 4ZWOA 4IU6A 4Z7MA 4KM3A 3IU8A 4IDYA 2BWVA 2GU6A 3O5VA 1C27A 1KP0A 3MX6A 1BN5A 2GG2A 1R5GA 2BN7A 2GG0A 3QOCA 3CB5A 4IF7A 4U71A 4U1BA 1WBQA 3FMQA 4U73A 1KQ0A 4FLKA 3IL0A 3PN9A 1A16A 1B6AA 5CIKA 1WY2A 3MATA 1O0XA 2MATA 1M35A 4S00A 1YW8A 3FMRA 5CDLA 2EVCA 2Q95A 1B59A 4U6ZA 1N51A 4IECA 4S2RP 1C21A 3D27A 3PKBA 2P9AA 2HOWA 3MR1A 5CDVA 1YVMA 4JUQA 4RZYA 1XGNA 5FCHA 2BWXA 3PKEA 4OOKA 4FO8A 4A6VA 2IW2A 5E5BA 1QXYA 4RGZ1 2BHDA 5CNXA 3TAVA 2ADUA 4IKTA 4S2TP 3IU7A 1C22A 4B28A 1QZYA 3TB5A 2DFIA 2B3KA 5CDEA 2B3LA 3CB6A 4U6JA 1WN1A 4QR8A 1R5HA 2GGBA 2GG7A 2V6CA 4U6EA 3RORA 1W2MA 3I7MA 2EVMA 2GGCA 4IKUA 1C24A 5CLSA 1CHMA 2ZSGA 3OOOA 1W7VA 4S01A 1R58A 4PNCA 2BHAA 2BWYA 1YW7A 4IPAA 3CTZA 1Y1NA 4IKRA 2BWTA 3OVKA 2P98A 2BH3A 4ZNGA 4FLJA 4FLIA 2BWSA 2GG3A 2GZ5A 2Q96A 2Q92A 2EA2A 3PKDA 5E2CA 2GA2A 2Q8KA 2GTXA 4A6WA 5JFRA 2BHBA 1XGMA 2Q93A 1YJ3A 4U6WA 5D6EA 1WLRA 5FCFA 1WL9A
chains in the Genus database with same CATH topology
3IU9A 3PKCA 1BOAA 3S6BA 2OKNA 3L24A 4FLLA 2NQ6A 5D6FA 2GU5A 5JHUA 3BIPA 1QXWA 2Q94A 4U76A 4U70A 4ZWUA 2P99A 2NQ7A 1YW9A 3PKAA 2GG8A 1XGSA 1MATA 2GG9A 4EGEA 2EVOA 2BHCA 1XGOA 2GU7A 3L7GA 2V3YA 4RZZA 3IG4A 4R60A 3BITA 2V3ZA 4FUKA 4U69A 5JI6A 3PEBA 4U75A 4IKSA 1WKMA 1QXZA 1C23A 2BWUA 4U6CA 2B3HA 1JAWA 4MATA 2BB7A 1PV9A 3FM3A 1WL6A 4PV4A 3BIQA 5CE6A 2GU4A 1KQ9A 4FO7A 2BWWA 1XNZA 2OAZA 3RVAA 2V3XA 4ZWPA 2EA4A 3Q6DA 4HXXA 2G6PA 2GG5A 4FKCA 4ZWOA 4IU6A 4Z7MA 4KM3A 3IU8A 4IDYA 2BWVA 2GU6A 3O5VA 1C27A 1KP0A 3MX6A 1BN5A 2GG2A 1R5GA 2BN7A 2GG0A 3QOCA 3CB5A 4IF7A 4U71A 4U1BA 1WBQA 3FMQA 4U73A 1KQ0A 4FLKA 3IL0A 3PN9A 1A16A 1B6AA 5CIKA 1WY2A 3MATA 1O0XA 2MATA 1M35A 4S00A 1YW8A 3FMRA 5CDLA 2EVCA 2Q95A 1B59A 4U6ZA 1N51A 4IECA 4S2RP 1C21A 3D27A 3PKBA 2P9AA 2HOWA 3MR1A 5CDVA 1YVMA 4JUQA 4RZYA 1XGNA 5FCHA 2BWXA 3PKEA 4OOKA 4FO8A 4A6VA 2IW2A 5E5BA 1QXYA 4RGZ1 2BHDA 5CNXA 3TAVA 2ADUA 4IKTA 4S2TP 3IU7A 1C22A 4B28A 1QZYA 3TB5A 2DFIA 2B3KA 5CDEA 2B3LA 3CB6A 4U6JA 1WN1A 4QR8A 1R5HA 2GGBA 2GG7A 2V6CA 4U6EA 3RORA 1W2MA 3I7MA 2EVMA 2GGCA 4IKUA 1C24A 5CLSA 1CHMA 2ZSGA 3OOOA 1W7VA 4S01A 1R58A 4PNCA 2BHAA 2BWYA 1YW7A 4IPAA 3CTZA 1Y1NA 4IKRA 2BWTA 3OVKA 2P98A 2BH3A 4ZNGA 4FLJA 4FLIA 2BWSA 2GG3A 2GZ5A 2Q96A 2Q92A 2EA2A 3PKDA 5E2CA 2GA2A 2Q8KA 2GTXA 4A6WA 5JFRA 2BHBA 1XGMA 2Q93A 1YJ3A 4U6WA 5D6EA 1WLRA 5FCFA 1WL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IU9 A;  3PKC A;  1BOA A;  3S6B A;  2OKN A;  3L24 A;  4FLL A;  2NQ6 A;  5D6F A;  2GU5 A;  5JHU A;  3BIP A;  1QXW A;  2Q94 A;  4U76 A;  4U70 A;  4ZWU A;  2P99 A;  2NQ7 A;  1YW9 A;  3PKA A;  2GG8 A;  1XGS A;  1MAT A;  2GG9 A;  4EGE A;  2EVO A;  2BHC A;  1XGO A;  2GU7 A;  3L7G A;  2V3Y A;  4RZZ A;  3IG4 A;  4R60 A;  3BIT A;  2V3Z A;  4FUK A;  4U69 A;  5JI6 A;  3PEB A;  4U75 A;  4IKS A;  1WKM A;  1QXZ A;  1C23 A;  2BWU A;  4U6C A;  2B3H A;  1JAW A;  4MAT A;  2BB7 A;  1PV9 A;  3FM3 A;  1WL6 A;  4PV4 A;  3BIQ A;  5CE6 A;  2GU4 A;  1KQ9 A;  4FO7 A;  2BWW A;  1XNZ A;  2OAZ A;  3RVA A;  2V3X A;  4ZWP A;  2EA4 A;  3Q6D A;  4HXX A;  2G6P A;  2GG5 A;  4FKC A;  4ZWO A;  4IU6 A;  4Z7M A;  4KM3 A;  3IU8 A;  4IDY A;  2BWV A;  2GU6 A;  3O5V A;  1C27 A;  1KP0 A;  3MX6 A;  1BN5 A;  2GG2 A;  1R5G A;  2BN7 A;  2GG0 A;  3QOC A;  3CB5 A;  4IF7 A;  4U71 A;  4U1B A;  1WBQ A;  3FMQ A;  4U73 A;  1KQ0 A;  4FLK A;  3IL0 A;  3PN9 A;  1A16 A;  1B6A A;  5CIK A;  1WY2 A;  3MAT A;  1O0X A;  2MAT A;  1M35 A;  4S00 A;  1YW8 A;  3FMR A;  5CDL A;  2EVC A;  2Q95 A;  1B59 A;  4U6Z A;  1N51 A;  4IEC A;  4S2R P;  1C21 A;  3D27 A;  3PKB A;  2P9A A;  2HOW A;  3MR1 A;  5CDV A;  1YVM A;  4JUQ A;  4RZY A;  1XGN A;  5FCH A;  2BWX A;  3PKE A;  4OOK A;  4FO8 A;  4A6V A;  2IW2 A;  5E5B A;  1QXY A;  4RGZ 1;  2BHD A;  5CNX A;  3TAV A;  2ADU A;  4IKT A;  4S2T P;  3IU7 A;  1C22 A;  4B28 A;  1QZY A;  3TB5 A;  2DFI A;  2B3K A;  5CDE A;  2B3L A;  3CB6 A;  4U6J A;  1WN1 A;  4QR8 A;  1R5H A;  2GGB A;  2GG7 A;  2V6C A;  4U6E A;  3ROR A;  1W2M A;  3I7M A;  2EVM A;  2GGC A;  4IKU A;  1C24 A;  5CLS A;  1CHM A;  2ZSG A;  3OOO A;  1W7V A;  4S01 A;  1R58 A;  4PNC A;  2BHA A;  2BWY A;  1YW7 A;  4IPA A;  3CTZ A;  1Y1N A;  4IKR A;  2BWT A;  3OVK A;  2P98 A;  2BH3 A;  4ZNG A;  4FLJ A;  4FLI A;  2BWS A;  2GG3 A;  2GZ5 A;  2Q96 A;  2Q92 A;  2EA2 A;  3PKD A;  5E2C A;  2GA2 A;  2Q8K A;  2GTX A;  4A6W A;  5JFR A;  2BHB A;  1XGM A;  2Q93 A;  1YJ3 A;  4U6W A;  5D6E A;  1WLR A;  5FCF A;  1WL9 A; 
#chains in the Genus database with same CATH topology
 3IU9 A;  3PKC A;  1BOA A;  3S6B A;  2OKN A;  3L24 A;  4FLL A;  2NQ6 A;  5D6F A;  2GU5 A;  5JHU A;  3BIP A;  1QXW A;  2Q94 A;  4U76 A;  4U70 A;  4ZWU A;  2P99 A;  2NQ7 A;  1YW9 A;  3PKA A;  2GG8 A;  1XGS A;  1MAT A;  2GG9 A;  4EGE A;  2EVO A;  2BHC A;  1XGO A;  2GU7 A;  3L7G A;  2V3Y A;  4RZZ A;  3IG4 A;  4R60 A;  3BIT A;  2V3Z A;  4FUK A;  4U69 A;  5JI6 A;  3PEB A;  4U75 A;  4IKS A;  1WKM A;  1QXZ A;  1C23 A;  2BWU A;  4U6C A;  2B3H A;  1JAW A;  4MAT A;  2BB7 A;  1PV9 A;  3FM3 A;  1WL6 A;  4PV4 A;  3BIQ A;  5CE6 A;  2GU4 A;  1KQ9 A;  4FO7 A;  2BWW A;  1XNZ A;  2OAZ A;  3RVA A;  2V3X A;  4ZWP A;  2EA4 A;  3Q6D A;  4HXX A;  2G6P A;  2GG5 A;  4FKC A;  4ZWO A;  4IU6 A;  4Z7M A;  4KM3 A;  3IU8 A;  4IDY A;  2BWV A;  2GU6 A;  3O5V A;  1C27 A;  1KP0 A;  3MX6 A;  1BN5 A;  2GG2 A;  1R5G A;  2BN7 A;  2GG0 A;  3QOC A;  3CB5 A;  4IF7 A;  4U71 A;  4U1B A;  1WBQ A;  3FMQ A;  4U73 A;  1KQ0 A;  4FLK A;  3IL0 A;  3PN9 A;  1A16 A;  1B6A A;  5CIK A;  1WY2 A;  3MAT A;  1O0X A;  2MAT A;  1M35 A;  4S00 A;  1YW8 A;  3FMR A;  5CDL A;  2EVC A;  2Q95 A;  1B59 A;  4U6Z A;  1N51 A;  4IEC A;  4S2R P;  1C21 A;  3D27 A;  3PKB A;  2P9A A;  2HOW A;  3MR1 A;  5CDV A;  1YVM A;  4JUQ A;  4RZY A;  1XGN A;  5FCH A;  2BWX A;  3PKE A;  4OOK A;  4FO8 A;  4A6V A;  2IW2 A;  5E5B A;  1QXY A;  4RGZ 1;  2BHD A;  5CNX A;  3TAV A;  2ADU A;  4IKT A;  4S2T P;  3IU7 A;  1C22 A;  4B28 A;  1QZY A;  3TB5 A;  2DFI A;  2B3K A;  5CDE A;  2B3L A;  3CB6 A;  4U6J A;  1WN1 A;  4QR8 A;  1R5H A;  2GGB A;  2GG7 A;  2V6C A;  4U6E A;  3ROR A;  1W2M A;  3I7M A;  2EVM A;  2GGC A;  4IKU A;  1C24 A;  5CLS A;  1CHM A;  2ZSG A;  3OOO A;  1W7V A;  4S01 A;  1R58 A;  4PNC A;  2BHA A;  2BWY A;  1YW7 A;  4IPA A;  3CTZ A;  1Y1N A;  4IKR A;  2BWT A;  3OVK A;  2P98 A;  2BH3 A;  4ZNG A;  4FLJ A;  4FLI A;  2BWS A;  2GG3 A;  2GZ5 A;  2Q96 A;  2Q92 A;  2EA2 A;  3PKD A;  5E2C A;  2GA2 A;  2Q8K A;  2GTX A;  4A6W A;  5JFR A;  2BHB A;  1XGM A;  2Q93 A;  1YJ3 A;  4U6W A;  5D6E A;  1WLR A;  5FCF A;  1WL9 A; 
#chains in the Genus database with same CATH homology
 3IU9 A;  3PKC A;  1BOA A;  3S6B A;  2OKN A;  3L24 A;  4FLL A;  2NQ6 A;  5D6F A;  2GU5 A;  5JHU A;  3BIP A;  1QXW A;  2Q94 A;  4U76 A;  4U70 A;  4ZWU A;  2P99 A;  2NQ7 A;  1YW9 A;  3PKA A;  2GG8 A;  1XGS A;  1MAT A;  2GG9 A;  4EGE A;  2EVO A;  2BHC A;  1XGO A;  2GU7 A;  3L7G A;  2V3Y A;  4RZZ A;  3IG4 A;  4R60 A;  3BIT A;  2V3Z A;  4FUK A;  4U69 A;  5JI6 A;  3PEB A;  4U75 A;  4IKS A;  1WKM A;  1QXZ A;  1C23 A;  2BWU A;  4U6C A;  2B3H A;  1JAW A;  4MAT A;  2BB7 A;  1PV9 A;  3FM3 A;  1WL6 A;  4PV4 A;  3BIQ A;  5CE6 A;  2GU4 A;  1KQ9 A;  4FO7 A;  2BWW A;  1XNZ A;  2OAZ A;  3RVA A;  2V3X A;  4ZWP A;  2EA4 A;  3Q6D A;  4HXX A;  2G6P A;  2GG5 A;  4FKC A;  4ZWO A;  4IU6 A;  4Z7M A;  4KM3 A;  3IU8 A;  4IDY A;  2BWV A;  2GU6 A;  3O5V A;  1C27 A;  1KP0 A;  3MX6 A;  1BN5 A;  2GG2 A;  1R5G A;  2BN7 A;  2GG0 A;  3QOC A;  3CB5 A;  4IF7 A;  4U71 A;  4U1B A;  1WBQ A;  3FMQ A;  4U73 A;  1KQ0 A;  4FLK A;  3IL0 A;  3PN9 A;  1A16 A;  1B6A A;  5CIK A;  1WY2 A;  3MAT A;  1O0X A;  2MAT A;  1M35 A;  4S00 A;  1YW8 A;  3FMR A;  5CDL A;  2EVC A;  2Q95 A;  1B59 A;  4U6Z A;  1N51 A;  4IEC A;  4S2R P;  1C21 A;  3D27 A;  3PKB A;  2P9A A;  2HOW A;  3MR1 A;  5CDV A;  1YVM A;  4JUQ A;  4RZY A;  1XGN A;  5FCH A;  2BWX A;  3PKE A;  4OOK A;  4FO8 A;  4A6V A;  2IW2 A;  5E5B A;  1QXY A;  4RGZ 1;  2BHD A;  5CNX A;  3TAV A;  2ADU A;  4IKT A;  4S2T P;  3IU7 A;  1C22 A;  4B28 A;  1QZY A;  3TB5 A;  2DFI A;  2B3K A;  5CDE A;  2B3L A;  3CB6 A;  4U6J A;  1WN1 A;  4QR8 A;  1R5H A;  2GGB A;  2GG7 A;  2V6C A;  4U6E A;  3ROR A;  1W2M A;  3I7M A;  2EVM A;  2GGC A;  4IKU A;  1C24 A;  5CLS A;  1CHM A;  2ZSG A;  3OOO A;  1W7V A;  4S01 A;  1R58 A;  4PNC A;  2BHA A;  2BWY A;  1YW7 A;  4IPA A;  3CTZ A;  1Y1N A;  4IKR A;  2BWT A;  3OVK A;  2P98 A;  2BH3 A;  4ZNG A;  4FLJ A;  4FLI A;  2BWS A;  2GG3 A;  2GZ5 A;  2Q96 A;  2Q92 A;  2EA2 A;  3PKD A;  5E2C A;  2GA2 A;  2Q8K A;  2GTX A;  4A6W A;  5JFR A;  2BHB A;  1XGM A;  2Q93 A;  1YJ3 A;  4U6W A;  5D6E A;  1WLR A;  5FCF A;  1WL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...