4ZNGA

X-ray crystallography of recombinant lactococcus lactis prolidase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
362
structure length
362
Chain Sequence
b'MSKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALEVEKAKEHTSGLDIFGYEDSQNPWEVVKNHVKSDVKSIAVEFSDIPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEIGFATAAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVIQEGMCFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTDHDLLIF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolidase
publication title X-ray crystallography of recombinant Lactococcus lactis prolidase
rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
total genus 117
structure length 362
sequence length 362
chains with identical sequence B, C
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4zngA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4zngA02
2GU5A 2B3KA 2NQ6A 4MATA 1XGMA 5JHUA 1R5HA 4U6ZA 4FLIA 3RVAA 3CB6A 3CB5A 1C27A 2BHAA 1C23A 1YW7A 2IW2A 4FLLA 1W2MA 2BHBA 1XGSA 3Q6DA 1YW9A 3FM3A 2BWYA 5CIKA 4U6JA 1QZYA 5CLSA 4R60A 2OAZA 2B3LA 3TB5A 4RZZA 1QXWA 2V3XA 1WBQA 1R5GA 1XNZA 2EVMA 3QOCA 4FKCA 4ZWPA 2GG9A 2GG0A 4IU6A 1WLRA 2GZ5A 1WKMA 2B3HA 3D27A 1MATA 2P99A 3PEBA 2P9AA 4IF7A 4JUQA 3OVKA 2BHCA 1QXYA 3MATA 4U6WA 1QXZA 2NQ7A 2EVCA 2BWVA 4IKUA 4ZNGA 4U1BA 1YJ3A 2Q95A 4FLJA 2GTXA 4S2TP 4ZWOA 2BWSA 2ADUA 4IPAA 1A16A 5E5BA 4EGEA 4U76A 4IECA 2G6PA 2BWTA 4U6EA 4A6WA 3MR1A 2EA4A 4HXXA 3IU7A 4PNCA 2BB7A 3RORA 1KQ9A 1XGOA 4FLKA 4S2RP 4A6VA 2GGCA 1YVMA 1B59A 3S6BA 4QR8A 4ZWUA 1WL6A 4FO8A 1WN1A 4RZYA 2GU4A 2Q93A 3IG4A 2EA2A 2HOWA 2Q94A 5JFRA 2Q92A 5CNXA 4Z7MA 4U71A 1W7VA 1O0XA 2EVOA 5FCFA 1YW8A 2GU7A 1M35A 2GG5A 2BWXA 4RGZ1 1KP0A 3BIQA 2GG3A 3FMQA 2V6CA 3PKEA 4IKRA 1B6AA 3PKAA 5D6EA 3FMRA 3PKCA 2GA2A 3BIPA 4S00A 2P98A 1C22A 2Q8KA 3BITA 4KM3A 4B28A 5CDEA 1JAWA 4U6CA 3O5VA 1C24A 3PKBA 2BN7A 1R58A 4FO7A 2GGBA 3L7GA 1XGNA 1BOAA 1WL9A 4IKSA 5D6FA 3PKDA 2BHDA 2DFIA 5CE6A 3MX6A 1WY2A 1C21A 2BWWA 5FCHA 3L24A 2OKNA 2V3YA 3CTZA 4U69A 5JI6A 3PN9A 4FUKA 2BWUA 3I7MA 3TAVA 1N51A 5E2CA 3IU9A 2V3ZA 2GU6A 4PV4A 4OOKA 1Y1NA 2GG7A 4IDYA 5CDLA 4U73A 4U70A 1KQ0A 1CHMA 2BH3A 3IU8A 2GG8A 5CDVA 4S01A 2GG2A 2MATA 4U75A 3OOOA 1PV9A 4IKTA 2ZSGA 1BN5A 2Q96A 3IL0A
chains in the Genus database with same CATH superfamily
2GU5A 2B3KA 2NQ6A 4MATA 1XGMA 5JHUA 1R5HA 4U6ZA 4FLIA 3RVAA 3CB6A 3CB5A 1C27A 2BHAA 1C23A 1YW7A 2IW2A 4FLLA 1W2MA 2BHBA 1XGSA 3Q6DA 1YW9A 3FM3A 2BWYA 5CIKA 4U6JA 1QZYA 5CLSA 4R60A 2OAZA 2B3LA 3TB5A 4RZZA 1QXWA 2V3XA 1WBQA 1R5GA 1XNZA 2EVMA 3QOCA 4FKCA 4ZWPA 2GG9A 2GG0A 4IU6A 1WLRA 2GZ5A 1WKMA 2B3HA 3D27A 1MATA 2P99A 3PEBA 2P9AA 4IF7A 4JUQA 3OVKA 2BHCA 1QXYA 3MATA 4U6WA 1QXZA 2NQ7A 2EVCA 2BWVA 4IKUA 4ZNGA 4U1BA 1YJ3A 2Q95A 4FLJA 2GTXA 4S2TP 4ZWOA 2BWSA 2ADUA 4IPAA 1A16A 5E5BA 4EGEA 4U76A 4IECA 2G6PA 2BWTA 4U6EA 4A6WA 3MR1A 2EA4A 4HXXA 3IU7A 4PNCA 2BB7A 3RORA 1KQ9A 1XGOA 4FLKA 4S2RP 4A6VA 2GGCA 1YVMA 1B59A 3S6BA 4QR8A 4ZWUA 1WL6A 4FO8A 1WN1A 4RZYA 2GU4A 2Q93A 3IG4A 2EA2A 2HOWA 2Q94A 5JFRA 2Q92A 5CNXA 4Z7MA 4U71A 1W7VA 1O0XA 2EVOA 5FCFA 1YW8A 2GU7A 1M35A 2GG5A 2BWXA 4RGZ1 1KP0A 3BIQA 2GG3A 3FMQA 2V6CA 3PKEA 4IKRA 1B6AA 3PKAA 5D6EA 3FMRA 3PKCA 2GA2A 3BIPA 4S00A 2P98A 1C22A 2Q8KA 3BITA 4KM3A 4B28A 5CDEA 1JAWA 4U6CA 3O5VA 1C24A 3PKBA 2BN7A 1R58A 4FO7A 2GGBA 3L7GA 1XGNA 1BOAA 1WL9A 4IKSA 5D6FA 3PKDA 2BHDA 2DFIA 5CE6A 3MX6A 1WY2A 1C21A 2BWWA 5FCHA 3L24A 2OKNA 2V3YA 3CTZA 4U69A 5JI6A 3PN9A 4FUKA 2BWUA 3I7MA 3TAVA 1N51A 5E2CA 3IU9A 2V3ZA 2GU6A 4PV4A 4OOKA 1Y1NA 2GG7A 4IDYA 5CDLA 4U73A 4U70A 1KQ0A 1CHMA 2BH3A 3IU8A 2GG8A 5CDVA 4S01A 2GG2A 2MATA 4U75A 3OOOA 1PV9A 4IKTA 2ZSGA 1BN5A 2Q96A 3IL0A
chains in the Genus database with same CATH topology
2GU5A 2B3KA 2NQ6A 4MATA 1XGMA 5JHUA 1R5HA 4U6ZA 4FLIA 3RVAA 3CB6A 3CB5A 1C27A 2BHAA 1C23A 1YW7A 2IW2A 4FLLA 1W2MA 2BHBA 1XGSA 3Q6DA 1YW9A 3FM3A 2BWYA 5CIKA 4U6JA 1QZYA 5CLSA 4R60A 2OAZA 2B3LA 3TB5A 4RZZA 1QXWA 2V3XA 1WBQA 1R5GA 1XNZA 2EVMA 3QOCA 4FKCA 4ZWPA 2GG9A 2GG0A 4IU6A 1WLRA 2GZ5A 1WKMA 2B3HA 3D27A 1MATA 2P99A 3PEBA 2P9AA 4IF7A 4JUQA 3OVKA 2BHCA 1QXYA 3MATA 4U6WA 1QXZA 2NQ7A 2EVCA 2BWVA 4IKUA 4ZNGA 4U1BA 1YJ3A 2Q95A 4FLJA 2GTXA 4S2TP 4ZWOA 2BWSA 2ADUA 4IPAA 1A16A 5E5BA 4EGEA 4U76A 4IECA 2G6PA 2BWTA 4U6EA 4A6WA 3MR1A 2EA4A 4HXXA 3IU7A 4PNCA 2BB7A 3RORA 1KQ9A 1XGOA 4FLKA 4S2RP 4A6VA 2GGCA 1YVMA 1B59A 3S6BA 4QR8A 4ZWUA 1WL6A 4FO8A 1WN1A 4RZYA 2GU4A 2Q93A 3IG4A 2EA2A 2HOWA 2Q94A 5JFRA 2Q92A 5CNXA 4Z7MA 4U71A 1W7VA 1O0XA 2EVOA 5FCFA 1YW8A 2GU7A 1M35A 2GG5A 2BWXA 4RGZ1 1KP0A 3BIQA 2GG3A 3FMQA 2V6CA 3PKEA 4IKRA 1B6AA 3PKAA 5D6EA 3FMRA 3PKCA 2GA2A 3BIPA 4S00A 2P98A 1C22A 2Q8KA 3BITA 4KM3A 4B28A 5CDEA 1JAWA 4U6CA 3O5VA 1C24A 3PKBA 2BN7A 1R58A 4FO7A 2GGBA 3L7GA 1XGNA 1BOAA 1WL9A 4IKSA 5D6FA 3PKDA 2BHDA 2DFIA 5CE6A 3MX6A 1WY2A 1C21A 2BWWA 5FCHA 3L24A 2OKNA 2V3YA 3CTZA 4U69A 5JI6A 3PN9A 4FUKA 2BWUA 3I7MA 3TAVA 1N51A 5E2CA 3IU9A 2V3ZA 2GU6A 4PV4A 4OOKA 1Y1NA 2GG7A 4IDYA 5CDLA 4U73A 4U70A 1KQ0A 1CHMA 2BH3A 3IU8A 2GG8A 5CDVA 4S01A 2GG2A 2MATA 4U75A 3OOOA 1PV9A 4IKTA 2ZSGA 1BN5A 2Q96A 3IL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GU5 A;  2B3K A;  2NQ6 A;  4MAT A;  1XGM A;  5JHU A;  1R5H A;  4U6Z A;  4FLI A;  3RVA A;  3CB6 A;  3CB5 A;  1C27 A;  2BHA A;  1C23 A;  1YW7 A;  2IW2 A;  4FLL A;  1W2M A;  2BHB A;  1XGS A;  3Q6D A;  1YW9 A;  3FM3 A;  2BWY A;  5CIK A;  4U6J A;  1QZY A;  5CLS A;  4R60 A;  2OAZ A;  2B3L A;  3TB5 A;  4RZZ A;  1QXW A;  2V3X A;  1WBQ A;  1R5G A;  1XNZ A;  2EVM A;  3QOC A;  4FKC A;  4ZWP A;  2GG9 A;  2GG0 A;  4IU6 A;  1WLR A;  2GZ5 A;  1WKM A;  2B3H A;  3D27 A;  1MAT A;  2P99 A;  3PEB A;  2P9A A;  4IF7 A;  4JUQ A;  3OVK A;  2BHC A;  1QXY A;  3MAT A;  4U6W A;  1QXZ A;  2NQ7 A;  2EVC A;  2BWV A;  4IKU A;  4ZNG A;  4U1B A;  1YJ3 A;  2Q95 A;  4FLJ A;  2GTX A;  4S2T P;  4ZWO A;  2BWS A;  2ADU A;  4IPA A;  1A16 A;  5E5B A;  4EGE A;  4U76 A;  4IEC A;  2G6P A;  2BWT A;  4U6E A;  4A6W A;  3MR1 A;  2EA4 A;  4HXX A;  3IU7 A;  4PNC A;  2BB7 A;  3ROR A;  1KQ9 A;  1XGO A;  4FLK A;  4S2R P;  4A6V A;  2GGC A;  1YVM A;  1B59 A;  3S6B A;  4QR8 A;  4ZWU A;  1WL6 A;  4FO8 A;  1WN1 A;  4RZY A;  2GU4 A;  2Q93 A;  3IG4 A;  2EA2 A;  2HOW A;  2Q94 A;  5JFR A;  2Q92 A;  5CNX A;  4Z7M A;  4U71 A;  1W7V A;  1O0X A;  2EVO A;  5FCF A;  1YW8 A;  2GU7 A;  1M35 A;  2GG5 A;  2BWX A;  4RGZ 1;  1KP0 A;  3BIQ A;  2GG3 A;  3FMQ A;  2V6C A;  3PKE A;  4IKR A;  1B6A A;  3PKA A;  5D6E A;  3FMR A;  3PKC A;  2GA2 A;  3BIP A;  4S00 A;  2P98 A;  1C22 A;  2Q8K A;  3BIT A;  4KM3 A;  4B28 A;  5CDE A;  1JAW A;  4U6C A;  3O5V A;  1C24 A;  3PKB A;  2BN7 A;  1R58 A;  4FO7 A;  2GGB A;  3L7G A;  1XGN A;  1BOA A;  1WL9 A;  4IKS A;  5D6F A;  3PKD A;  2BHD A;  2DFI A;  5CE6 A;  3MX6 A;  1WY2 A;  1C21 A;  2BWW A;  5FCH A;  3L24 A;  2OKN A;  2V3Y A;  3CTZ A;  4U69 A;  5JI6 A;  3PN9 A;  4FUK A;  2BWU A;  3I7M A;  3TAV A;  1N51 A;  5E2C A;  3IU9 A;  2V3Z A;  2GU6 A;  4PV4 A;  4OOK A;  1Y1N A;  2GG7 A;  4IDY A;  5CDL A;  4U73 A;  4U70 A;  1KQ0 A;  1CHM A;  2BH3 A;  3IU8 A;  2GG8 A;  5CDV A;  4S01 A;  2GG2 A;  2MAT A;  4U75 A;  3OOO A;  1PV9 A;  4IKT A;  2ZSG A;  1BN5 A;  2Q96 A;  3IL0 A; 
#chains in the Genus database with same CATH topology
 2GU5 A;  2B3K A;  2NQ6 A;  4MAT A;  1XGM A;  5JHU A;  1R5H A;  4U6Z A;  4FLI A;  3RVA A;  3CB6 A;  3CB5 A;  1C27 A;  2BHA A;  1C23 A;  1YW7 A;  2IW2 A;  4FLL A;  1W2M A;  2BHB A;  1XGS A;  3Q6D A;  1YW9 A;  3FM3 A;  2BWY A;  5CIK A;  4U6J A;  1QZY A;  5CLS A;  4R60 A;  2OAZ A;  2B3L A;  3TB5 A;  4RZZ A;  1QXW A;  2V3X A;  1WBQ A;  1R5G A;  1XNZ A;  2EVM A;  3QOC A;  4FKC A;  4ZWP A;  2GG9 A;  2GG0 A;  4IU6 A;  1WLR A;  2GZ5 A;  1WKM A;  2B3H A;  3D27 A;  1MAT A;  2P99 A;  3PEB A;  2P9A A;  4IF7 A;  4JUQ A;  3OVK A;  2BHC A;  1QXY A;  3MAT A;  4U6W A;  1QXZ A;  2NQ7 A;  2EVC A;  2BWV A;  4IKU A;  4ZNG A;  4U1B A;  1YJ3 A;  2Q95 A;  4FLJ A;  2GTX A;  4S2T P;  4ZWO A;  2BWS A;  2ADU A;  4IPA A;  1A16 A;  5E5B A;  4EGE A;  4U76 A;  4IEC A;  2G6P A;  2BWT A;  4U6E A;  4A6W A;  3MR1 A;  2EA4 A;  4HXX A;  3IU7 A;  4PNC A;  2BB7 A;  3ROR A;  1KQ9 A;  1XGO A;  4FLK A;  4S2R P;  4A6V A;  2GGC A;  1YVM A;  1B59 A;  3S6B A;  4QR8 A;  4ZWU A;  1WL6 A;  4FO8 A;  1WN1 A;  4RZY A;  2GU4 A;  2Q93 A;  3IG4 A;  2EA2 A;  2HOW A;  2Q94 A;  5JFR A;  2Q92 A;  5CNX A;  4Z7M A;  4U71 A;  1W7V A;  1O0X A;  2EVO A;  5FCF A;  1YW8 A;  2GU7 A;  1M35 A;  2GG5 A;  2BWX A;  4RGZ 1;  1KP0 A;  3BIQ A;  2GG3 A;  3FMQ A;  2V6C A;  3PKE A;  4IKR A;  1B6A A;  3PKA A;  5D6E A;  3FMR A;  3PKC A;  2GA2 A;  3BIP A;  4S00 A;  2P98 A;  1C22 A;  2Q8K A;  3BIT A;  4KM3 A;  4B28 A;  5CDE A;  1JAW A;  4U6C A;  3O5V A;  1C24 A;  3PKB A;  2BN7 A;  1R58 A;  4FO7 A;  2GGB A;  3L7G A;  1XGN A;  1BOA A;  1WL9 A;  4IKS A;  5D6F A;  3PKD A;  2BHD A;  2DFI A;  5CE6 A;  3MX6 A;  1WY2 A;  1C21 A;  2BWW A;  5FCH A;  3L24 A;  2OKN A;  2V3Y A;  3CTZ A;  4U69 A;  5JI6 A;  3PN9 A;  4FUK A;  2BWU A;  3I7M A;  3TAV A;  1N51 A;  5E2C A;  3IU9 A;  2V3Z A;  2GU6 A;  4PV4 A;  4OOK A;  1Y1N A;  2GG7 A;  4IDY A;  5CDL A;  4U73 A;  4U70 A;  1KQ0 A;  1CHM A;  2BH3 A;  3IU8 A;  2GG8 A;  5CDV A;  4S01 A;  2GG2 A;  2MAT A;  4U75 A;  3OOO A;  1PV9 A;  4IKT A;  2ZSG A;  1BN5 A;  2Q96 A;  3IL0 A; 
#chains in the Genus database with same CATH homology
 2GU5 A;  2B3K A;  2NQ6 A;  4MAT A;  1XGM A;  5JHU A;  1R5H A;  4U6Z A;  4FLI A;  3RVA A;  3CB6 A;  3CB5 A;  1C27 A;  2BHA A;  1C23 A;  1YW7 A;  2IW2 A;  4FLL A;  1W2M A;  2BHB A;  1XGS A;  3Q6D A;  1YW9 A;  3FM3 A;  2BWY A;  5CIK A;  4U6J A;  1QZY A;  5CLS A;  4R60 A;  2OAZ A;  2B3L A;  3TB5 A;  4RZZ A;  1QXW A;  2V3X A;  1WBQ A;  1R5G A;  1XNZ A;  2EVM A;  3QOC A;  4FKC A;  4ZWP A;  2GG9 A;  2GG0 A;  4IU6 A;  1WLR A;  2GZ5 A;  1WKM A;  2B3H A;  3D27 A;  1MAT A;  2P99 A;  3PEB A;  2P9A A;  4IF7 A;  4JUQ A;  3OVK A;  2BHC A;  1QXY A;  3MAT A;  4U6W A;  1QXZ A;  2NQ7 A;  2EVC A;  2BWV A;  4IKU A;  4ZNG A;  4U1B A;  1YJ3 A;  2Q95 A;  4FLJ A;  2GTX A;  4S2T P;  4ZWO A;  2BWS A;  2ADU A;  4IPA A;  1A16 A;  5E5B A;  4EGE A;  4U76 A;  4IEC A;  2G6P A;  2BWT A;  4U6E A;  4A6W A;  3MR1 A;  2EA4 A;  4HXX A;  3IU7 A;  4PNC A;  2BB7 A;  3ROR A;  1KQ9 A;  1XGO A;  4FLK A;  4S2R P;  4A6V A;  2GGC A;  1YVM A;  1B59 A;  3S6B A;  4QR8 A;  4ZWU A;  1WL6 A;  4FO8 A;  1WN1 A;  4RZY A;  2GU4 A;  2Q93 A;  3IG4 A;  2EA2 A;  2HOW A;  2Q94 A;  5JFR A;  2Q92 A;  5CNX A;  4Z7M A;  4U71 A;  1W7V A;  1O0X A;  2EVO A;  5FCF A;  1YW8 A;  2GU7 A;  1M35 A;  2GG5 A;  2BWX A;  4RGZ 1;  1KP0 A;  3BIQ A;  2GG3 A;  3FMQ A;  2V6C A;  3PKE A;  4IKR A;  1B6A A;  3PKA A;  5D6E A;  3FMR A;  3PKC A;  2GA2 A;  3BIP A;  4S00 A;  2P98 A;  1C22 A;  2Q8K A;  3BIT A;  4KM3 A;  4B28 A;  5CDE A;  1JAW A;  4U6C A;  3O5V A;  1C24 A;  3PKB A;  2BN7 A;  1R58 A;  4FO7 A;  2GGB A;  3L7G A;  1XGN A;  1BOA A;  1WL9 A;  4IKS A;  5D6F A;  3PKD A;  2BHD A;  2DFI A;  5CE6 A;  3MX6 A;  1WY2 A;  1C21 A;  2BWW A;  5FCH A;  3L24 A;  2OKN A;  2V3Y A;  3CTZ A;  4U69 A;  5JI6 A;  3PN9 A;  4FUK A;  2BWU A;  3I7M A;  3TAV A;  1N51 A;  5E2C A;  3IU9 A;  2V3Z A;  2GU6 A;  4PV4 A;  4OOK A;  1Y1N A;  2GG7 A;  4IDY A;  5CDL A;  4U73 A;  4U70 A;  1KQ0 A;  1CHM A;  2BH3 A;  3IU8 A;  2GG8 A;  5CDV A;  4S01 A;  2GG2 A;  2MAT A;  4U75 A;  3OOO A;  1PV9 A;  4IKT A;  2ZSG A;  1BN5 A;  2Q96 A;  3IL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...