4ZNGA

X-ray crystallography of recombinant lactococcus lactis prolidase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
362
structure length
362
Chain Sequence
MSKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALEVEKAKEHTSGLDIFGYEDSQNPWEVVKNHVKSDVKSIAVEFSDIPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEIGFATAAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVIQEGMCFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTDHDLLIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolidase
publication title X-ray crystallography of recombinant Lactococcus lactis prolidase
rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
total genus 117
structure length 362
sequence length 362
chains with identical sequence B, C
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4zngA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4zngA02
4IKRA 4IF7A 4FLIA 4FLKA 4B28A 3IU9A 3CTZA 4PV4A 2GU7A 2DFIA 2Q8KA 1A16A 1BN5A 2BN7A 1O0XA 4ZWOA 3FM3A 5E5BA 4U75A 1PV9A 3PKBA 1C22A 2HOWA 3MX6A 5E2CA 3RORA 3FMRA 3BIQA 4S00A 1QXZA 2B3KA 3BIPA 4U6WA 4FLJA 1WY2A 1C21A 1YW9A 2BWXA 4U70A 1R5GA 1C23A 1C27A 1R58A 2Q95A 2GG5A 1R5HA 2GA2A 2GG7A 3PKDA 4U1BA 1WN1A 3MATA 1JAWA 3S6BA 1KP0A 3OVKA 2MATA 2EA2A 3FMQA 4KM3A 3Q6DA 5D6FA 1WL6A 4A6VA 3IU7A 2GZ5A 2IW2A 2GG8A 3IU8A 1W7VA 3O5VA 1C24A 5FCHA 3CB5A 2Q96A 4U6EA 4RZYA 2GU4A 4PNCA 3RVAA 4IKUA 5CLSA 2BH3A 1QXYA 1MATA 1XGMA 1WLRA 2GGBA 4A6WA 5CNXA 3IL0A 2B3LA 2BHBA 2P9AA 5JHUA 2BB7A 4FLLA 3IG4A 1WKMA 2EVOA 3PKCA 1YW7A 2Q93A 1N51A 1Y1NA 1XNZA 4IKSA 2V3ZA 1WBQA 2BHCA 3L24A 2BWTA 3BITA 2GU5A 2GGCA 3OOOA 4S2TP 4ZWPA 4IKTA 2GTXA 1XGOA 4RGZ1 1M35A 1YVMA 5CDLA 2GG2A 4FO8A 4U69A 3QOCA 2Q94A 3TB5A 1KQ0A 2P99A 2NQ7A 5FCFA 2BWWA 2V3YA 4OOKA 4U71A 4EGEA 4R60A 4U6JA 1B59A 2GG3A 4U6ZA 3PKAA 4U73A 2G6PA 4MATA 4RZZA 4IPAA 1XGNA 4U6CA 1YJ3A 2ADUA 4FUKA 2EA4A 4IECA 3L7GA 5CIKA 4S01A 5CDEA 2BHAA 2BWVA 4ZNGA 5D6EA 2Q92A 2BWUA 1QZYA 4QR8A 2B3HA 4ZWUA 1B6AA 2OAZA 4HXXA 4IDYA 4IU6A 3D27A 5JFRA 2V6CA 2BWYA 1XGSA 1YW8A 1WL9A 2P98A 1W2MA 5JI6A 2EVCA 4FKCA 1KQ9A 1QXWA 3MR1A 2NQ6A 3CB6A 2ZSGA 3PN9A 5CE6A 3TAVA 2GG0A 1BOAA 2OKNA 4FO7A 1CHMA 5CDVA 2GG9A 2V3XA 3PEBA 3I7MA 4S2RP 4Z7MA 2GU6A 2BHDA 3PKEA 4JUQA 2EVMA 2BWSA 4U76A
chains in the Genus database with same CATH superfamily
4IKRA 4IF7A 4FLIA 4FLKA 4B28A 3IU9A 3CTZA 4PV4A 2GU7A 2DFIA 2Q8KA 1A16A 1BN5A 2BN7A 1O0XA 4ZWOA 3FM3A 5E5BA 4U75A 1PV9A 3PKBA 1C22A 2HOWA 3MX6A 5E2CA 3RORA 3FMRA 3BIQA 4S00A 1QXZA 2B3KA 3BIPA 4U6WA 4FLJA 1WY2A 1C21A 1YW9A 2BWXA 4U70A 1R5GA 1C23A 1C27A 1R58A 2Q95A 2GG5A 1R5HA 2GA2A 2GG7A 3PKDA 4U1BA 1WN1A 3MATA 1JAWA 3S6BA 1KP0A 3OVKA 2MATA 2EA2A 3FMQA 4KM3A 3Q6DA 5D6FA 1WL6A 4A6VA 3IU7A 2GZ5A 2IW2A 2GG8A 3IU8A 1W7VA 3O5VA 1C24A 5FCHA 3CB5A 2Q96A 4U6EA 4RZYA 2GU4A 4PNCA 3RVAA 4IKUA 5CLSA 2BH3A 1QXYA 1MATA 1XGMA 1WLRA 2GGBA 4A6WA 5CNXA 3IL0A 2B3LA 2BHBA 2P9AA 5JHUA 2BB7A 4FLLA 3IG4A 1WKMA 2EVOA 3PKCA 1YW7A 2Q93A 1N51A 1Y1NA 1XNZA 4IKSA 2V3ZA 1WBQA 2BHCA 3L24A 2BWTA 3BITA 2GU5A 2GGCA 3OOOA 4S2TP 4ZWPA 4IKTA 2GTXA 1XGOA 4RGZ1 1M35A 1YVMA 5CDLA 2GG2A 4FO8A 4U69A 3QOCA 2Q94A 3TB5A 1KQ0A 2P99A 2NQ7A 5FCFA 2BWWA 2V3YA 4OOKA 4U71A 4EGEA 4R60A 4U6JA 1B59A 2GG3A 4U6ZA 3PKAA 4U73A 2G6PA 4MATA 4RZZA 4IPAA 1XGNA 4U6CA 1YJ3A 2ADUA 4FUKA 2EA4A 4IECA 3L7GA 5CIKA 4S01A 5CDEA 2BHAA 2BWVA 4ZNGA 5D6EA 2Q92A 2BWUA 1QZYA 4QR8A 2B3HA 4ZWUA 1B6AA 2OAZA 4HXXA 4IDYA 4IU6A 3D27A 5JFRA 2V6CA 2BWYA 1XGSA 1YW8A 1WL9A 2P98A 1W2MA 5JI6A 2EVCA 4FKCA 1KQ9A 1QXWA 3MR1A 2NQ6A 3CB6A 2ZSGA 3PN9A 5CE6A 3TAVA 2GG0A 1BOAA 2OKNA 4FO7A 1CHMA 5CDVA 2GG9A 2V3XA 3PEBA 3I7MA 4S2RP 4Z7MA 2GU6A 2BHDA 3PKEA 4JUQA 2EVMA 2BWSA 4U76A
chains in the Genus database with same CATH topology
4IKRA 4IF7A 4FLIA 4FLKA 4B28A 3IU9A 3CTZA 4PV4A 2GU7A 2DFIA 2Q8KA 1A16A 1BN5A 2BN7A 1O0XA 4ZWOA 3FM3A 5E5BA 4U75A 1PV9A 3PKBA 1C22A 2HOWA 3MX6A 5E2CA 3RORA 3FMRA 3BIQA 4S00A 1QXZA 2B3KA 3BIPA 4U6WA 4FLJA 1WY2A 1C21A 1YW9A 2BWXA 4U70A 1R5GA 1C23A 1C27A 1R58A 2Q95A 2GG5A 1R5HA 2GA2A 2GG7A 3PKDA 4U1BA 1WN1A 3MATA 1JAWA 3S6BA 1KP0A 3OVKA 2MATA 2EA2A 3FMQA 4KM3A 3Q6DA 5D6FA 1WL6A 4A6VA 3IU7A 2GZ5A 2IW2A 2GG8A 3IU8A 1W7VA 3O5VA 1C24A 5FCHA 3CB5A 2Q96A 4U6EA 4RZYA 2GU4A 4PNCA 3RVAA 4IKUA 5CLSA 2BH3A 1QXYA 1MATA 1XGMA 1WLRA 2GGBA 4A6WA 5CNXA 3IL0A 2B3LA 2BHBA 2P9AA 5JHUA 2BB7A 4FLLA 3IG4A 1WKMA 2EVOA 3PKCA 1YW7A 2Q93A 1N51A 1Y1NA 1XNZA 4IKSA 2V3ZA 1WBQA 2BHCA 3L24A 2BWTA 3BITA 2GU5A 2GGCA 3OOOA 4S2TP 4ZWPA 4IKTA 2GTXA 1XGOA 4RGZ1 1M35A 1YVMA 5CDLA 2GG2A 4FO8A 4U69A 3QOCA 2Q94A 3TB5A 1KQ0A 2P99A 2NQ7A 5FCFA 2BWWA 2V3YA 4OOKA 4U71A 4EGEA 4R60A 4U6JA 1B59A 2GG3A 4U6ZA 3PKAA 4U73A 2G6PA 4MATA 4RZZA 4IPAA 1XGNA 4U6CA 1YJ3A 2ADUA 4FUKA 2EA4A 4IECA 3L7GA 5CIKA 4S01A 5CDEA 2BHAA 2BWVA 4ZNGA 5D6EA 2Q92A 2BWUA 1QZYA 4QR8A 2B3HA 4ZWUA 1B6AA 2OAZA 4HXXA 4IDYA 4IU6A 3D27A 5JFRA 2V6CA 2BWYA 1XGSA 1YW8A 1WL9A 2P98A 1W2MA 5JI6A 2EVCA 4FKCA 1KQ9A 1QXWA 3MR1A 2NQ6A 3CB6A 2ZSGA 3PN9A 5CE6A 3TAVA 2GG0A 1BOAA 2OKNA 4FO7A 1CHMA 5CDVA 2GG9A 2V3XA 3PEBA 3I7MA 4S2RP 4Z7MA 2GU6A 2BHDA 3PKEA 4JUQA 2EVMA 2BWSA 4U76A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IKR A;  4IF7 A;  4FLI A;  4FLK A;  4B28 A;  3IU9 A;  3CTZ A;  4PV4 A;  2GU7 A;  2DFI A;  2Q8K A;  1A16 A;  1BN5 A;  2BN7 A;  1O0X A;  4ZWO A;  3FM3 A;  5E5B A;  4U75 A;  1PV9 A;  3PKB A;  1C22 A;  2HOW A;  3MX6 A;  5E2C A;  3ROR A;  3FMR A;  3BIQ A;  4S00 A;  1QXZ A;  2B3K A;  3BIP A;  4U6W A;  4FLJ A;  1WY2 A;  1C21 A;  1YW9 A;  2BWX A;  4U70 A;  1R5G A;  1C23 A;  1C27 A;  1R58 A;  2Q95 A;  2GG5 A;  1R5H A;  2GA2 A;  2GG7 A;  3PKD A;  4U1B A;  1WN1 A;  3MAT A;  1JAW A;  3S6B A;  1KP0 A;  3OVK A;  2MAT A;  2EA2 A;  3FMQ A;  4KM3 A;  3Q6D A;  5D6F A;  1WL6 A;  4A6V A;  3IU7 A;  2GZ5 A;  2IW2 A;  2GG8 A;  3IU8 A;  1W7V A;  3O5V A;  1C24 A;  5FCH A;  3CB5 A;  2Q96 A;  4U6E A;  4RZY A;  2GU4 A;  4PNC A;  3RVA A;  4IKU A;  5CLS A;  2BH3 A;  1QXY A;  1MAT A;  1XGM A;  1WLR A;  2GGB A;  4A6W A;  5CNX A;  3IL0 A;  2B3L A;  2BHB A;  2P9A A;  5JHU A;  2BB7 A;  4FLL A;  3IG4 A;  1WKM A;  2EVO A;  3PKC A;  1YW7 A;  2Q93 A;  1N51 A;  1Y1N A;  1XNZ A;  4IKS A;  2V3Z A;  1WBQ A;  2BHC A;  3L24 A;  2BWT A;  3BIT A;  2GU5 A;  2GGC A;  3OOO A;  4S2T P;  4ZWP A;  4IKT A;  2GTX A;  1XGO A;  4RGZ 1;  1M35 A;  1YVM A;  5CDL A;  2GG2 A;  4FO8 A;  4U69 A;  3QOC A;  2Q94 A;  3TB5 A;  1KQ0 A;  2P99 A;  2NQ7 A;  5FCF A;  2BWW A;  2V3Y A;  4OOK A;  4U71 A;  4EGE A;  4R60 A;  4U6J A;  1B59 A;  2GG3 A;  4U6Z A;  3PKA A;  4U73 A;  2G6P A;  4MAT A;  4RZZ A;  4IPA A;  1XGN A;  4U6C A;  1YJ3 A;  2ADU A;  4FUK A;  2EA4 A;  4IEC A;  3L7G A;  5CIK A;  4S01 A;  5CDE A;  2BHA A;  2BWV A;  4ZNG A;  5D6E A;  2Q92 A;  2BWU A;  1QZY A;  4QR8 A;  2B3H A;  4ZWU A;  1B6A A;  2OAZ A;  4HXX A;  4IDY A;  4IU6 A;  3D27 A;  5JFR A;  2V6C A;  2BWY A;  1XGS A;  1YW8 A;  1WL9 A;  2P98 A;  1W2M A;  5JI6 A;  2EVC A;  4FKC A;  1KQ9 A;  1QXW A;  3MR1 A;  2NQ6 A;  3CB6 A;  2ZSG A;  3PN9 A;  5CE6 A;  3TAV A;  2GG0 A;  1BOA A;  2OKN A;  4FO7 A;  1CHM A;  5CDV A;  2GG9 A;  2V3X A;  3PEB A;  3I7M A;  4S2R P;  4Z7M A;  2GU6 A;  2BHD A;  3PKE A;  4JUQ A;  2EVM A;  2BWS A;  4U76 A; 
#chains in the Genus database with same CATH topology
 4IKR A;  4IF7 A;  4FLI A;  4FLK A;  4B28 A;  3IU9 A;  3CTZ A;  4PV4 A;  2GU7 A;  2DFI A;  2Q8K A;  1A16 A;  1BN5 A;  2BN7 A;  1O0X A;  4ZWO A;  3FM3 A;  5E5B A;  4U75 A;  1PV9 A;  3PKB A;  1C22 A;  2HOW A;  3MX6 A;  5E2C A;  3ROR A;  3FMR A;  3BIQ A;  4S00 A;  1QXZ A;  2B3K A;  3BIP A;  4U6W A;  4FLJ A;  1WY2 A;  1C21 A;  1YW9 A;  2BWX A;  4U70 A;  1R5G A;  1C23 A;  1C27 A;  1R58 A;  2Q95 A;  2GG5 A;  1R5H A;  2GA2 A;  2GG7 A;  3PKD A;  4U1B A;  1WN1 A;  3MAT A;  1JAW A;  3S6B A;  1KP0 A;  3OVK A;  2MAT A;  2EA2 A;  3FMQ A;  4KM3 A;  3Q6D A;  5D6F A;  1WL6 A;  4A6V A;  3IU7 A;  2GZ5 A;  2IW2 A;  2GG8 A;  3IU8 A;  1W7V A;  3O5V A;  1C24 A;  5FCH A;  3CB5 A;  2Q96 A;  4U6E A;  4RZY A;  2GU4 A;  4PNC A;  3RVA A;  4IKU A;  5CLS A;  2BH3 A;  1QXY A;  1MAT A;  1XGM A;  1WLR A;  2GGB A;  4A6W A;  5CNX A;  3IL0 A;  2B3L A;  2BHB A;  2P9A A;  5JHU A;  2BB7 A;  4FLL A;  3IG4 A;  1WKM A;  2EVO A;  3PKC A;  1YW7 A;  2Q93 A;  1N51 A;  1Y1N A;  1XNZ A;  4IKS A;  2V3Z A;  1WBQ A;  2BHC A;  3L24 A;  2BWT A;  3BIT A;  2GU5 A;  2GGC A;  3OOO A;  4S2T P;  4ZWP A;  4IKT A;  2GTX A;  1XGO A;  4RGZ 1;  1M35 A;  1YVM A;  5CDL A;  2GG2 A;  4FO8 A;  4U69 A;  3QOC A;  2Q94 A;  3TB5 A;  1KQ0 A;  2P99 A;  2NQ7 A;  5FCF A;  2BWW A;  2V3Y A;  4OOK A;  4U71 A;  4EGE A;  4R60 A;  4U6J A;  1B59 A;  2GG3 A;  4U6Z A;  3PKA A;  4U73 A;  2G6P A;  4MAT A;  4RZZ A;  4IPA A;  1XGN A;  4U6C A;  1YJ3 A;  2ADU A;  4FUK A;  2EA4 A;  4IEC A;  3L7G A;  5CIK A;  4S01 A;  5CDE A;  2BHA A;  2BWV A;  4ZNG A;  5D6E A;  2Q92 A;  2BWU A;  1QZY A;  4QR8 A;  2B3H A;  4ZWU A;  1B6A A;  2OAZ A;  4HXX A;  4IDY A;  4IU6 A;  3D27 A;  5JFR A;  2V6C A;  2BWY A;  1XGS A;  1YW8 A;  1WL9 A;  2P98 A;  1W2M A;  5JI6 A;  2EVC A;  4FKC A;  1KQ9 A;  1QXW A;  3MR1 A;  2NQ6 A;  3CB6 A;  2ZSG A;  3PN9 A;  5CE6 A;  3TAV A;  2GG0 A;  1BOA A;  2OKN A;  4FO7 A;  1CHM A;  5CDV A;  2GG9 A;  2V3X A;  3PEB A;  3I7M A;  4S2R P;  4Z7M A;  2GU6 A;  2BHD A;  3PKE A;  4JUQ A;  2EVM A;  2BWS A;  4U76 A; 
#chains in the Genus database with same CATH homology
 4IKR A;  4IF7 A;  4FLI A;  4FLK A;  4B28 A;  3IU9 A;  3CTZ A;  4PV4 A;  2GU7 A;  2DFI A;  2Q8K A;  1A16 A;  1BN5 A;  2BN7 A;  1O0X A;  4ZWO A;  3FM3 A;  5E5B A;  4U75 A;  1PV9 A;  3PKB A;  1C22 A;  2HOW A;  3MX6 A;  5E2C A;  3ROR A;  3FMR A;  3BIQ A;  4S00 A;  1QXZ A;  2B3K A;  3BIP A;  4U6W A;  4FLJ A;  1WY2 A;  1C21 A;  1YW9 A;  2BWX A;  4U70 A;  1R5G A;  1C23 A;  1C27 A;  1R58 A;  2Q95 A;  2GG5 A;  1R5H A;  2GA2 A;  2GG7 A;  3PKD A;  4U1B A;  1WN1 A;  3MAT A;  1JAW A;  3S6B A;  1KP0 A;  3OVK A;  2MAT A;  2EA2 A;  3FMQ A;  4KM3 A;  3Q6D A;  5D6F A;  1WL6 A;  4A6V A;  3IU7 A;  2GZ5 A;  2IW2 A;  2GG8 A;  3IU8 A;  1W7V A;  3O5V A;  1C24 A;  5FCH A;  3CB5 A;  2Q96 A;  4U6E A;  4RZY A;  2GU4 A;  4PNC A;  3RVA A;  4IKU A;  5CLS A;  2BH3 A;  1QXY A;  1MAT A;  1XGM A;  1WLR A;  2GGB A;  4A6W A;  5CNX A;  3IL0 A;  2B3L A;  2BHB A;  2P9A A;  5JHU A;  2BB7 A;  4FLL A;  3IG4 A;  1WKM A;  2EVO A;  3PKC A;  1YW7 A;  2Q93 A;  1N51 A;  1Y1N A;  1XNZ A;  4IKS A;  2V3Z A;  1WBQ A;  2BHC A;  3L24 A;  2BWT A;  3BIT A;  2GU5 A;  2GGC A;  3OOO A;  4S2T P;  4ZWP A;  4IKT A;  2GTX A;  1XGO A;  4RGZ 1;  1M35 A;  1YVM A;  5CDL A;  2GG2 A;  4FO8 A;  4U69 A;  3QOC A;  2Q94 A;  3TB5 A;  1KQ0 A;  2P99 A;  2NQ7 A;  5FCF A;  2BWW A;  2V3Y A;  4OOK A;  4U71 A;  4EGE A;  4R60 A;  4U6J A;  1B59 A;  2GG3 A;  4U6Z A;  3PKA A;  4U73 A;  2G6P A;  4MAT A;  4RZZ A;  4IPA A;  1XGN A;  4U6C A;  1YJ3 A;  2ADU A;  4FUK A;  2EA4 A;  4IEC A;  3L7G A;  5CIK A;  4S01 A;  5CDE A;  2BHA A;  2BWV A;  4ZNG A;  5D6E A;  2Q92 A;  2BWU A;  1QZY A;  4QR8 A;  2B3H A;  4ZWU A;  1B6A A;  2OAZ A;  4HXX A;  4IDY A;  4IU6 A;  3D27 A;  5JFR A;  2V6C A;  2BWY A;  1XGS A;  1YW8 A;  1WL9 A;  2P98 A;  1W2M A;  5JI6 A;  2EVC A;  4FKC A;  1KQ9 A;  1QXW A;  3MR1 A;  2NQ6 A;  3CB6 A;  2ZSG A;  3PN9 A;  5CE6 A;  3TAV A;  2GG0 A;  1BOA A;  2OKN A;  4FO7 A;  1CHM A;  5CDV A;  2GG9 A;  2V3X A;  3PEB A;  3I7M A;  4S2R P;  4Z7M A;  2GU6 A;  2BHD A;  3PKE A;  4JUQ A;  2EVM A;  2BWS A;  4U76 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...