4ZNGA

X-ray crystallography of recombinant lactococcus lactis prolidase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
362
structure length
362
Chain Sequence
MSKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALEVEKAKEHTSGLDIFGYEDSQNPWEVVKNHVKSDVKSIAVEFSDIPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEIGFATAAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVIQEGMCFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTDHDLLIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Prolidase
publication title X-ray crystallography of recombinant Lactococcus lactis prolidase
rcsb
source organism Lactococcus lactis
total genus 117
structure length 362
sequence length 362
chains with identical sequence B, C
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4zngA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4zngA02
4IPAA 1A16A 2BHAA 3BIPA 3MATA 2BHCA 2V3XA 3PEBA 1WN1A 4S2RP 2BWWA 4ZWUA 5CDEA 1QXZA 1BOAA 2GG5A 2Q95A 4R60A 2GG8A 4U6WA 2GG7A 3OVKA 1YJ3A 2OAZA 3MR1A 2EA2A 2Q8KA 4S01A 1YVMA 3BITA 3MX6A 4U69A 2BHBA 4IF7A 2DFIA 2B3KA 4ZWOA 1C21A 2NQ7A 4U1BA 1QZYA 2B3LA 1M35A 2V6CA 3PN9A 2BB7A 2GG9A 2P99A 4FLIA 3D27A 4PV4A 3PKBA 5CNXA 2BWUA 3L24A 3FM3A 2EVMA 1XGSA 2GGBA 4S2TP 5JHUA 2V3YA 2EVOA 4FKCA 5JI6A 2NQ6A 1QXWA 2V3ZA 4FLKA 2P9AA 2GU7A 2Q92A 1Y1NA 3L7GA 4S00A 4IKRA 2OKNA 2EVCA 1WLRA 3Q6DA 4JUQA 4FLJA 2ADUA 1C27A 4U6CA 3O5VA 1YW8A 1BN5A 1WBQA 2ZSGA 3IU9A 4ZNGA 1W7VA 4MATA 3FMRA 4Z7MA 2GA2A 1N51A 4ZWPA 4U70A 1C22A 3TB5A 2GU4A 5CIKA 4PNCA 4IDYA 3IU7A 4U76A 1WL6A 1PV9A 3PKEA 1KP0A 2IW2A 2GGCA 1XGOA 4U6EA 4A6WA 3I7MA 1MATA 1JAWA 3TAVA 2BWTA 3IG4A 2GZ5A 5CDLA 4U6JA 2G6PA 4OOKA 2BWSA 2Q96A 5JFRA 4EGEA 2BWVA 2GG2A 4IU6A 3PKDA 1XGNA 2GU6A 2BWXA 4U75A 5D6EA 4RZYA 1O0XA 4U6ZA 3OOOA 1C23A 4RZZA 1R5HA 4U71A 4FUKA 3CB6A 1CHMA 1WL9A 5CLSA 5FCHA 2GU5A 1WY2A 3IL0A 3S6BA 4IKSA 2BH3A 4B28A 1KQ9A 2Q93A 4IECA 4U73A 2GTXA 3IU8A 4FLLA 1KQ0A 3QOCA 4IKTA 2GG0A 4QR8A 3PKCA 3FMQA 3CB5A 3RVAA 3PKAA 2MATA 3CTZA 2BN7A 1W2MA 5CE6A 5E2CA 4IKUA 1WKMA 3BIQA 1B59A 1R5GA 1YW9A 4HXXA 2BWYA 4A6VA 4RGZ1 3RORA 1R58A 5E5BA 5CDVA 2EA4A 4KM3A 1C24A 5D6FA 4FO8A 1QXYA 2HOWA 2GG3A 2P98A 2BHDA 5FCFA 2Q94A 1XNZA 1YW7A 2B3HA 1XGMA 4FO7A 1B6AA
chains in the Genus database with same CATH superfamily
4IPAA 1A16A 2BHAA 3BIPA 3MATA 2BHCA 2V3XA 3PEBA 1WN1A 4S2RP 2BWWA 4ZWUA 5CDEA 1QXZA 1BOAA 2GG5A 2Q95A 4R60A 2GG8A 4U6WA 2GG7A 3OVKA 1YJ3A 2OAZA 3MR1A 2EA2A 2Q8KA 4S01A 1YVMA 3BITA 3MX6A 4U69A 2BHBA 4IF7A 2DFIA 2B3KA 4ZWOA 1C21A 2NQ7A 4U1BA 1QZYA 2B3LA 1M35A 2V6CA 3PN9A 2BB7A 2GG9A 2P99A 4FLIA 3D27A 4PV4A 3PKBA 5CNXA 2BWUA 3L24A 3FM3A 2EVMA 1XGSA 2GGBA 4S2TP 5JHUA 2V3YA 2EVOA 4FKCA 5JI6A 2NQ6A 1QXWA 2V3ZA 4FLKA 2P9AA 2GU7A 2Q92A 1Y1NA 3L7GA 4S00A 4IKRA 2OKNA 2EVCA 1WLRA 3Q6DA 4JUQA 4FLJA 2ADUA 1C27A 4U6CA 3O5VA 1YW8A 1BN5A 1WBQA 2ZSGA 3IU9A 4ZNGA 1W7VA 4MATA 3FMRA 4Z7MA 2GA2A 1N51A 4ZWPA 4U70A 1C22A 3TB5A 2GU4A 5CIKA 4PNCA 4IDYA 3IU7A 4U76A 1WL6A 1PV9A 3PKEA 1KP0A 2IW2A 2GGCA 1XGOA 4U6EA 4A6WA 3I7MA 1MATA 1JAWA 3TAVA 2BWTA 3IG4A 2GZ5A 5CDLA 4U6JA 2G6PA 4OOKA 2BWSA 2Q96A 5JFRA 4EGEA 2BWVA 2GG2A 4IU6A 3PKDA 1XGNA 2GU6A 2BWXA 4U75A 5D6EA 4RZYA 1O0XA 4U6ZA 3OOOA 1C23A 4RZZA 1R5HA 4U71A 4FUKA 3CB6A 1CHMA 1WL9A 5CLSA 5FCHA 2GU5A 1WY2A 3IL0A 3S6BA 4IKSA 2BH3A 4B28A 1KQ9A 2Q93A 4IECA 4U73A 2GTXA 3IU8A 4FLLA 1KQ0A 3QOCA 4IKTA 2GG0A 4QR8A 3PKCA 3FMQA 3CB5A 3RVAA 3PKAA 2MATA 3CTZA 2BN7A 1W2MA 5CE6A 5E2CA 4IKUA 1WKMA 3BIQA 1B59A 1R5GA 1YW9A 4HXXA 2BWYA 4A6VA 4RGZ1 3RORA 1R58A 5E5BA 5CDVA 2EA4A 4KM3A 1C24A 5D6FA 4FO8A 1QXYA 2HOWA 2GG3A 2P98A 2BHDA 5FCFA 2Q94A 1XNZA 1YW7A 2B3HA 1XGMA 4FO7A 1B6AA
chains in the Genus database with same CATH topology
4IPAA 1A16A 2BHAA 3BIPA 3MATA 2BHCA 2V3XA 3PEBA 1WN1A 4S2RP 2BWWA 4ZWUA 5CDEA 1QXZA 1BOAA 2GG5A 2Q95A 4R60A 2GG8A 4U6WA 2GG7A 3OVKA 1YJ3A 2OAZA 3MR1A 2EA2A 2Q8KA 4S01A 1YVMA 3BITA 3MX6A 4U69A 2BHBA 4IF7A 2DFIA 2B3KA 4ZWOA 1C21A 2NQ7A 4U1BA 1QZYA 2B3LA 1M35A 2V6CA 3PN9A 2BB7A 2GG9A 2P99A 4FLIA 3D27A 4PV4A 3PKBA 5CNXA 2BWUA 3L24A 3FM3A 2EVMA 1XGSA 2GGBA 4S2TP 5JHUA 2V3YA 2EVOA 4FKCA 5JI6A 2NQ6A 1QXWA 2V3ZA 4FLKA 2P9AA 2GU7A 2Q92A 1Y1NA 3L7GA 4S00A 4IKRA 2OKNA 2EVCA 1WLRA 3Q6DA 4JUQA 4FLJA 2ADUA 1C27A 4U6CA 3O5VA 1YW8A 1BN5A 1WBQA 2ZSGA 3IU9A 4ZNGA 1W7VA 4MATA 3FMRA 4Z7MA 2GA2A 1N51A 4ZWPA 4U70A 1C22A 3TB5A 2GU4A 5CIKA 4PNCA 4IDYA 3IU7A 4U76A 1WL6A 1PV9A 3PKEA 1KP0A 2IW2A 2GGCA 1XGOA 4U6EA 4A6WA 3I7MA 1MATA 1JAWA 3TAVA 2BWTA 3IG4A 2GZ5A 5CDLA 4U6JA 2G6PA 4OOKA 2BWSA 2Q96A 5JFRA 4EGEA 2BWVA 2GG2A 4IU6A 3PKDA 1XGNA 2GU6A 2BWXA 4U75A 5D6EA 4RZYA 1O0XA 4U6ZA 3OOOA 1C23A 4RZZA 1R5HA 4U71A 4FUKA 3CB6A 1CHMA 1WL9A 5CLSA 5FCHA 2GU5A 1WY2A 3IL0A 3S6BA 4IKSA 2BH3A 4B28A 1KQ9A 2Q93A 4IECA 4U73A 2GTXA 3IU8A 4FLLA 1KQ0A 3QOCA 4IKTA 2GG0A 4QR8A 3PKCA 3FMQA 3CB5A 3RVAA 3PKAA 2MATA 3CTZA 2BN7A 1W2MA 5CE6A 5E2CA 4IKUA 1WKMA 3BIQA 1B59A 1R5GA 1YW9A 4HXXA 2BWYA 4A6VA 4RGZ1 3RORA 1R58A 5E5BA 5CDVA 2EA4A 4KM3A 1C24A 5D6FA 4FO8A 1QXYA 2HOWA 2GG3A 2P98A 2BHDA 5FCFA 2Q94A 1XNZA 1YW7A 2B3HA 1XGMA 4FO7A 1B6AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IPA A;  1A16 A;  2BHA A;  3BIP A;  3MAT A;  2BHC A;  2V3X A;  3PEB A;  1WN1 A;  4S2R P;  2BWW A;  4ZWU A;  5CDE A;  1QXZ A;  1BOA A;  2GG5 A;  2Q95 A;  4R60 A;  2GG8 A;  4U6W A;  2GG7 A;  3OVK A;  1YJ3 A;  2OAZ A;  3MR1 A;  2EA2 A;  2Q8K A;  4S01 A;  1YVM A;  3BIT A;  3MX6 A;  4U69 A;  2BHB A;  4IF7 A;  2DFI A;  2B3K A;  4ZWO A;  1C21 A;  2NQ7 A;  4U1B A;  1QZY A;  2B3L A;  1M35 A;  2V6C A;  3PN9 A;  2BB7 A;  2GG9 A;  2P99 A;  4FLI A;  3D27 A;  4PV4 A;  3PKB A;  5CNX A;  2BWU A;  3L24 A;  3FM3 A;  2EVM A;  1XGS A;  2GGB A;  4S2T P;  5JHU A;  2V3Y A;  2EVO A;  4FKC A;  5JI6 A;  2NQ6 A;  1QXW A;  2V3Z A;  4FLK A;  2P9A A;  2GU7 A;  2Q92 A;  1Y1N A;  3L7G A;  4S00 A;  4IKR A;  2OKN A;  2EVC A;  1WLR A;  3Q6D A;  4JUQ A;  4FLJ A;  2ADU A;  1C27 A;  4U6C A;  3O5V A;  1YW8 A;  1BN5 A;  1WBQ A;  2ZSG A;  3IU9 A;  4ZNG A;  1W7V A;  4MAT A;  3FMR A;  4Z7M A;  2GA2 A;  1N51 A;  4ZWP A;  4U70 A;  1C22 A;  3TB5 A;  2GU4 A;  5CIK A;  4PNC A;  4IDY A;  3IU7 A;  4U76 A;  1WL6 A;  1PV9 A;  3PKE A;  1KP0 A;  2IW2 A;  2GGC A;  1XGO A;  4U6E A;  4A6W A;  3I7M A;  1MAT A;  1JAW A;  3TAV A;  2BWT A;  3IG4 A;  2GZ5 A;  5CDL A;  4U6J A;  2G6P A;  4OOK A;  2BWS A;  2Q96 A;  5JFR A;  4EGE A;  2BWV A;  2GG2 A;  4IU6 A;  3PKD A;  1XGN A;  2GU6 A;  2BWX A;  4U75 A;  5D6E A;  4RZY A;  1O0X A;  4U6Z A;  3OOO A;  1C23 A;  4RZZ A;  1R5H A;  4U71 A;  4FUK A;  3CB6 A;  1CHM A;  1WL9 A;  5CLS A;  5FCH A;  2GU5 A;  1WY2 A;  3IL0 A;  3S6B A;  4IKS A;  2BH3 A;  4B28 A;  1KQ9 A;  2Q93 A;  4IEC A;  4U73 A;  2GTX A;  3IU8 A;  4FLL A;  1KQ0 A;  3QOC A;  4IKT A;  2GG0 A;  4QR8 A;  3PKC A;  3FMQ A;  3CB5 A;  3RVA A;  3PKA A;  2MAT A;  3CTZ A;  2BN7 A;  1W2M A;  5CE6 A;  5E2C A;  4IKU A;  1WKM A;  3BIQ A;  1B59 A;  1R5G A;  1YW9 A;  4HXX A;  2BWY A;  4A6V A;  4RGZ 1;  3ROR A;  1R58 A;  5E5B A;  5CDV A;  2EA4 A;  4KM3 A;  1C24 A;  5D6F A;  4FO8 A;  1QXY A;  2HOW A;  2GG3 A;  2P98 A;  2BHD A;  5FCF A;  2Q94 A;  1XNZ A;  1YW7 A;  2B3H A;  1XGM A;  4FO7 A;  1B6A A; 
#chains in the Genus database with same CATH topology
 4IPA A;  1A16 A;  2BHA A;  3BIP A;  3MAT A;  2BHC A;  2V3X A;  3PEB A;  1WN1 A;  4S2R P;  2BWW A;  4ZWU A;  5CDE A;  1QXZ A;  1BOA A;  2GG5 A;  2Q95 A;  4R60 A;  2GG8 A;  4U6W A;  2GG7 A;  3OVK A;  1YJ3 A;  2OAZ A;  3MR1 A;  2EA2 A;  2Q8K A;  4S01 A;  1YVM A;  3BIT A;  3MX6 A;  4U69 A;  2BHB A;  4IF7 A;  2DFI A;  2B3K A;  4ZWO A;  1C21 A;  2NQ7 A;  4U1B A;  1QZY A;  2B3L A;  1M35 A;  2V6C A;  3PN9 A;  2BB7 A;  2GG9 A;  2P99 A;  4FLI A;  3D27 A;  4PV4 A;  3PKB A;  5CNX A;  2BWU A;  3L24 A;  3FM3 A;  2EVM A;  1XGS A;  2GGB A;  4S2T P;  5JHU A;  2V3Y A;  2EVO A;  4FKC A;  5JI6 A;  2NQ6 A;  1QXW A;  2V3Z A;  4FLK A;  2P9A A;  2GU7 A;  2Q92 A;  1Y1N A;  3L7G A;  4S00 A;  4IKR A;  2OKN A;  2EVC A;  1WLR A;  3Q6D A;  4JUQ A;  4FLJ A;  2ADU A;  1C27 A;  4U6C A;  3O5V A;  1YW8 A;  1BN5 A;  1WBQ A;  2ZSG A;  3IU9 A;  4ZNG A;  1W7V A;  4MAT A;  3FMR A;  4Z7M A;  2GA2 A;  1N51 A;  4ZWP A;  4U70 A;  1C22 A;  3TB5 A;  2GU4 A;  5CIK A;  4PNC A;  4IDY A;  3IU7 A;  4U76 A;  1WL6 A;  1PV9 A;  3PKE A;  1KP0 A;  2IW2 A;  2GGC A;  1XGO A;  4U6E A;  4A6W A;  3I7M A;  1MAT A;  1JAW A;  3TAV A;  2BWT A;  3IG4 A;  2GZ5 A;  5CDL A;  4U6J A;  2G6P A;  4OOK A;  2BWS A;  2Q96 A;  5JFR A;  4EGE A;  2BWV A;  2GG2 A;  4IU6 A;  3PKD A;  1XGN A;  2GU6 A;  2BWX A;  4U75 A;  5D6E A;  4RZY A;  1O0X A;  4U6Z A;  3OOO A;  1C23 A;  4RZZ A;  1R5H A;  4U71 A;  4FUK A;  3CB6 A;  1CHM A;  1WL9 A;  5CLS A;  5FCH A;  2GU5 A;  1WY2 A;  3IL0 A;  3S6B A;  4IKS A;  2BH3 A;  4B28 A;  1KQ9 A;  2Q93 A;  4IEC A;  4U73 A;  2GTX A;  3IU8 A;  4FLL A;  1KQ0 A;  3QOC A;  4IKT A;  2GG0 A;  4QR8 A;  3PKC A;  3FMQ A;  3CB5 A;  3RVA A;  3PKA A;  2MAT A;  3CTZ A;  2BN7 A;  1W2M A;  5CE6 A;  5E2C A;  4IKU A;  1WKM A;  3BIQ A;  1B59 A;  1R5G A;  1YW9 A;  4HXX A;  2BWY A;  4A6V A;  4RGZ 1;  3ROR A;  1R58 A;  5E5B A;  5CDV A;  2EA4 A;  4KM3 A;  1C24 A;  5D6F A;  4FO8 A;  1QXY A;  2HOW A;  2GG3 A;  2P98 A;  2BHD A;  5FCF A;  2Q94 A;  1XNZ A;  1YW7 A;  2B3H A;  1XGM A;  4FO7 A;  1B6A A; 
#chains in the Genus database with same CATH homology
 4IPA A;  1A16 A;  2BHA A;  3BIP A;  3MAT A;  2BHC A;  2V3X A;  3PEB A;  1WN1 A;  4S2R P;  2BWW A;  4ZWU A;  5CDE A;  1QXZ A;  1BOA A;  2GG5 A;  2Q95 A;  4R60 A;  2GG8 A;  4U6W A;  2GG7 A;  3OVK A;  1YJ3 A;  2OAZ A;  3MR1 A;  2EA2 A;  2Q8K A;  4S01 A;  1YVM A;  3BIT A;  3MX6 A;  4U69 A;  2BHB A;  4IF7 A;  2DFI A;  2B3K A;  4ZWO A;  1C21 A;  2NQ7 A;  4U1B A;  1QZY A;  2B3L A;  1M35 A;  2V6C A;  3PN9 A;  2BB7 A;  2GG9 A;  2P99 A;  4FLI A;  3D27 A;  4PV4 A;  3PKB A;  5CNX A;  2BWU A;  3L24 A;  3FM3 A;  2EVM A;  1XGS A;  2GGB A;  4S2T P;  5JHU A;  2V3Y A;  2EVO A;  4FKC A;  5JI6 A;  2NQ6 A;  1QXW A;  2V3Z A;  4FLK A;  2P9A A;  2GU7 A;  2Q92 A;  1Y1N A;  3L7G A;  4S00 A;  4IKR A;  2OKN A;  2EVC A;  1WLR A;  3Q6D A;  4JUQ A;  4FLJ A;  2ADU A;  1C27 A;  4U6C A;  3O5V A;  1YW8 A;  1BN5 A;  1WBQ A;  2ZSG A;  3IU9 A;  4ZNG A;  1W7V A;  4MAT A;  3FMR A;  4Z7M A;  2GA2 A;  1N51 A;  4ZWP A;  4U70 A;  1C22 A;  3TB5 A;  2GU4 A;  5CIK A;  4PNC A;  4IDY A;  3IU7 A;  4U76 A;  1WL6 A;  1PV9 A;  3PKE A;  1KP0 A;  2IW2 A;  2GGC A;  1XGO A;  4U6E A;  4A6W A;  3I7M A;  1MAT A;  1JAW A;  3TAV A;  2BWT A;  3IG4 A;  2GZ5 A;  5CDL A;  4U6J A;  2G6P A;  4OOK A;  2BWS A;  2Q96 A;  5JFR A;  4EGE A;  2BWV A;  2GG2 A;  4IU6 A;  3PKD A;  1XGN A;  2GU6 A;  2BWX A;  4U75 A;  5D6E A;  4RZY A;  1O0X A;  4U6Z A;  3OOO A;  1C23 A;  4RZZ A;  1R5H A;  4U71 A;  4FUK A;  3CB6 A;  1CHM A;  1WL9 A;  5CLS A;  5FCH A;  2GU5 A;  1WY2 A;  3IL0 A;  3S6B A;  4IKS A;  2BH3 A;  4B28 A;  1KQ9 A;  2Q93 A;  4IEC A;  4U73 A;  2GTX A;  3IU8 A;  4FLL A;  1KQ0 A;  3QOC A;  4IKT A;  2GG0 A;  4QR8 A;  3PKC A;  3FMQ A;  3CB5 A;  3RVA A;  3PKA A;  2MAT A;  3CTZ A;  2BN7 A;  1W2M A;  5CE6 A;  5E2C A;  4IKU A;  1WKM A;  3BIQ A;  1B59 A;  1R5G A;  1YW9 A;  4HXX A;  2BWY A;  4A6V A;  4RGZ 1;  3ROR A;  1R58 A;  5E5B A;  5CDV A;  2EA4 A;  4KM3 A;  1C24 A;  5D6F A;  4FO8 A;  1QXY A;  2HOW A;  2GG3 A;  2P98 A;  2BHD A;  5FCF A;  2Q94 A;  1XNZ A;  1YW7 A;  2B3H A;  1XGM A;  4FO7 A;  1B6A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...