4ZNGA

X-ray crystallography of recombinant lactococcus lactis prolidase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
362
structure length
362
Chain Sequence
MSKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALEVEKAKEHTSGLDIFGYEDSQNPWEVVKNHVKSDVKSIAVEFSDIPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEIGFATAAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVIQEGMCFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTDHDLLIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolidase
publication title X-ray crystallography of recombinant Lactococcus lactis prolidase
rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
total genus 117
structure length 362
sequence length 362
chains with identical sequence B, C
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4zngA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4zngA02
3QOCA 3OVKA 4HXXA 4IPAA 2Q94A 1KP0A 4EGEA 2GG3A 5CDLA 5JHUA 2P9AA 2BHAA 1W2MA 4RGZ1 1XGOA 2ADUA 4U70A 5FCFA 1CHMA 2B3LA 2GGCA 4IU6A 1XGNA 2Q96A 2V3XA 4IKUA 2V3ZA 3MATA 3MX6A 4FKCA 1WKMA 4U6EA 2GU6A 1O0XA 1YW9A 3BITA 2OKNA 3PN9A 4IF7A 4U6JA 1C27A 1R58A 2OAZA 2BHBA 3CB6A 5CDVA 3L7GA 1WL9A 4S01A 2GZ5A 4IKRA 4FLLA 3FM3A 2GG7A 2V6CA 1KQ9A 2P99A 2IW2A 4JUQA 1M35A 5CDEA 4ZNGA 4FLIA 1R5HA 3O5VA 3PEBA 4ZWUA 1XGMA 2B3KA 4U73A 4U75A 5CIKA 5FCHA 2Q93A 4R60A 2EA2A 2GG9A 4S2TP 4S2RP 1C21A 1C24A 3S6BA 1JAWA 2B3HA 2BWSA 4IECA 1Y1NA 2BH3A 5E5BA 1W7VA 4FLJA 1QXWA 2GG5A 1QXYA 4A6VA 3BIPA 2Q92A 2BWUA 4U6CA 4MATA 3PKBA 2GU5A 2BN7A 3L24A 2GTXA 3MR1A 4U71A 3D27A 2GA2A 2DFIA 1QXZA 4IDYA 4FO7A 2ZSGA 5E2CA 2Q8KA 3CTZA 1PV9A 5JFRA 4B28A 2BWYA 4U76A 5D6EA 2BWTA 2GU4A 3PKEA 4RZZA 1B6AA 2BWWA 2Q95A 1WL6A 3RVAA 4U1BA 2BB7A 4Z7MA 3IU8A 1C23A 1WN1A 3I7MA 1BN5A 2HOWA 4ZWOA 2GGBA 1QZYA 4OOKA 3TAVA 2BHDA 1WLRA 2V3YA 5CE6A 4ZWPA 3IL0A 2GG2A 2EA4A 3PKDA 4A6WA 1KQ0A 4FLKA 1XGSA 2GG0A 3IU9A 5CLSA 2GG8A 1R5GA 3IG4A 4IKTA 2BHCA 2MATA 1N51A 2EVCA 2G6PA 4U6WA 4IKSA 1WBQA 1A16A 3Q6DA 3OOOA 1MATA 4QR8A 1WY2A 2BWVA 5JI6A 1YJ3A 2NQ6A 3IU7A 4S00A 1YVMA 4U69A 2P98A 2EVMA 1XNZA 2GU7A 4PNCA 1B59A 3RORA 3BIQA 1C22A 4U6ZA 4KM3A 1YW8A 3FMRA 3PKAA 4PV4A 5CNXA 3TB5A 4FUKA 2NQ7A 2BWXA 1YW7A 4RZYA 1BOAA 3FMQA 3CB5A 3PKCA 4FO8A 5D6FA 2EVOA
chains in the Genus database with same CATH superfamily
3QOCA 3OVKA 4HXXA 4IPAA 2Q94A 1KP0A 4EGEA 2GG3A 5CDLA 5JHUA 2P9AA 2BHAA 1W2MA 4RGZ1 1XGOA 2ADUA 4U70A 5FCFA 1CHMA 2B3LA 2GGCA 4IU6A 1XGNA 2Q96A 2V3XA 4IKUA 2V3ZA 3MATA 3MX6A 4FKCA 1WKMA 4U6EA 2GU6A 1O0XA 1YW9A 3BITA 2OKNA 3PN9A 4IF7A 4U6JA 1C27A 1R58A 2OAZA 2BHBA 3CB6A 5CDVA 3L7GA 1WL9A 4S01A 2GZ5A 4IKRA 4FLLA 3FM3A 2GG7A 2V6CA 1KQ9A 2P99A 2IW2A 4JUQA 1M35A 5CDEA 4ZNGA 4FLIA 1R5HA 3O5VA 3PEBA 4ZWUA 1XGMA 2B3KA 4U73A 4U75A 5CIKA 5FCHA 2Q93A 4R60A 2EA2A 2GG9A 4S2TP 4S2RP 1C21A 1C24A 3S6BA 1JAWA 2B3HA 2BWSA 4IECA 1Y1NA 2BH3A 5E5BA 1W7VA 4FLJA 1QXWA 2GG5A 1QXYA 4A6VA 3BIPA 2Q92A 2BWUA 4U6CA 4MATA 3PKBA 2GU5A 2BN7A 3L24A 2GTXA 3MR1A 4U71A 3D27A 2GA2A 2DFIA 1QXZA 4IDYA 4FO7A 2ZSGA 5E2CA 2Q8KA 3CTZA 1PV9A 5JFRA 4B28A 2BWYA 4U76A 5D6EA 2BWTA 2GU4A 3PKEA 4RZZA 1B6AA 2BWWA 2Q95A 1WL6A 3RVAA 4U1BA 2BB7A 4Z7MA 3IU8A 1C23A 1WN1A 3I7MA 1BN5A 2HOWA 4ZWOA 2GGBA 1QZYA 4OOKA 3TAVA 2BHDA 1WLRA 2V3YA 5CE6A 4ZWPA 3IL0A 2GG2A 2EA4A 3PKDA 4A6WA 1KQ0A 4FLKA 1XGSA 2GG0A 3IU9A 5CLSA 2GG8A 1R5GA 3IG4A 4IKTA 2BHCA 2MATA 1N51A 2EVCA 2G6PA 4U6WA 4IKSA 1WBQA 1A16A 3Q6DA 3OOOA 1MATA 4QR8A 1WY2A 2BWVA 5JI6A 1YJ3A 2NQ6A 3IU7A 4S00A 1YVMA 4U69A 2P98A 2EVMA 1XNZA 2GU7A 4PNCA 1B59A 3RORA 3BIQA 1C22A 4U6ZA 4KM3A 1YW8A 3FMRA 3PKAA 4PV4A 5CNXA 3TB5A 4FUKA 2NQ7A 2BWXA 1YW7A 4RZYA 1BOAA 3FMQA 3CB5A 3PKCA 4FO8A 5D6FA 2EVOA
chains in the Genus database with same CATH topology
3QOCA 3OVKA 4HXXA 4IPAA 2Q94A 1KP0A 4EGEA 2GG3A 5CDLA 5JHUA 2P9AA 2BHAA 1W2MA 4RGZ1 1XGOA 2ADUA 4U70A 5FCFA 1CHMA 2B3LA 2GGCA 4IU6A 1XGNA 2Q96A 2V3XA 4IKUA 2V3ZA 3MATA 3MX6A 4FKCA 1WKMA 4U6EA 2GU6A 1O0XA 1YW9A 3BITA 2OKNA 3PN9A 4IF7A 4U6JA 1C27A 1R58A 2OAZA 2BHBA 3CB6A 5CDVA 3L7GA 1WL9A 4S01A 2GZ5A 4IKRA 4FLLA 3FM3A 2GG7A 2V6CA 1KQ9A 2P99A 2IW2A 4JUQA 1M35A 5CDEA 4ZNGA 4FLIA 1R5HA 3O5VA 3PEBA 4ZWUA 1XGMA 2B3KA 4U73A 4U75A 5CIKA 5FCHA 2Q93A 4R60A 2EA2A 2GG9A 4S2TP 4S2RP 1C21A 1C24A 3S6BA 1JAWA 2B3HA 2BWSA 4IECA 1Y1NA 2BH3A 5E5BA 1W7VA 4FLJA 1QXWA 2GG5A 1QXYA 4A6VA 3BIPA 2Q92A 2BWUA 4U6CA 4MATA 3PKBA 2GU5A 2BN7A 3L24A 2GTXA 3MR1A 4U71A 3D27A 2GA2A 2DFIA 1QXZA 4IDYA 4FO7A 2ZSGA 5E2CA 2Q8KA 3CTZA 1PV9A 5JFRA 4B28A 2BWYA 4U76A 5D6EA 2BWTA 2GU4A 3PKEA 4RZZA 1B6AA 2BWWA 2Q95A 1WL6A 3RVAA 4U1BA 2BB7A 4Z7MA 3IU8A 1C23A 1WN1A 3I7MA 1BN5A 2HOWA 4ZWOA 2GGBA 1QZYA 4OOKA 3TAVA 2BHDA 1WLRA 2V3YA 5CE6A 4ZWPA 3IL0A 2GG2A 2EA4A 3PKDA 4A6WA 1KQ0A 4FLKA 1XGSA 2GG0A 3IU9A 5CLSA 2GG8A 1R5GA 3IG4A 4IKTA 2BHCA 2MATA 1N51A 2EVCA 2G6PA 4U6WA 4IKSA 1WBQA 1A16A 3Q6DA 3OOOA 1MATA 4QR8A 1WY2A 2BWVA 5JI6A 1YJ3A 2NQ6A 3IU7A 4S00A 1YVMA 4U69A 2P98A 2EVMA 1XNZA 2GU7A 4PNCA 1B59A 3RORA 3BIQA 1C22A 4U6ZA 4KM3A 1YW8A 3FMRA 3PKAA 4PV4A 5CNXA 3TB5A 4FUKA 2NQ7A 2BWXA 1YW7A 4RZYA 1BOAA 3FMQA 3CB5A 3PKCA 4FO8A 5D6FA 2EVOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QOC A;  3OVK A;  4HXX A;  4IPA A;  2Q94 A;  1KP0 A;  4EGE A;  2GG3 A;  5CDL A;  5JHU A;  2P9A A;  2BHA A;  1W2M A;  4RGZ 1;  1XGO A;  2ADU A;  4U70 A;  5FCF A;  1CHM A;  2B3L A;  2GGC A;  4IU6 A;  1XGN A;  2Q96 A;  2V3X A;  4IKU A;  2V3Z A;  3MAT A;  3MX6 A;  4FKC A;  1WKM A;  4U6E A;  2GU6 A;  1O0X A;  1YW9 A;  3BIT A;  2OKN A;  3PN9 A;  4IF7 A;  4U6J A;  1C27 A;  1R58 A;  2OAZ A;  2BHB A;  3CB6 A;  5CDV A;  3L7G A;  1WL9 A;  4S01 A;  2GZ5 A;  4IKR A;  4FLL A;  3FM3 A;  2GG7 A;  2V6C A;  1KQ9 A;  2P99 A;  2IW2 A;  4JUQ A;  1M35 A;  5CDE A;  4ZNG A;  4FLI A;  1R5H A;  3O5V A;  3PEB A;  4ZWU A;  1XGM A;  2B3K A;  4U73 A;  4U75 A;  5CIK A;  5FCH A;  2Q93 A;  4R60 A;  2EA2 A;  2GG9 A;  4S2T P;  4S2R P;  1C21 A;  1C24 A;  3S6B A;  1JAW A;  2B3H A;  2BWS A;  4IEC A;  1Y1N A;  2BH3 A;  5E5B A;  1W7V A;  4FLJ A;  1QXW A;  2GG5 A;  1QXY A;  4A6V A;  3BIP A;  2Q92 A;  2BWU A;  4U6C A;  4MAT A;  3PKB A;  2GU5 A;  2BN7 A;  3L24 A;  2GTX A;  3MR1 A;  4U71 A;  3D27 A;  2GA2 A;  2DFI A;  1QXZ A;  4IDY A;  4FO7 A;  2ZSG A;  5E2C A;  2Q8K A;  3CTZ A;  1PV9 A;  5JFR A;  4B28 A;  2BWY A;  4U76 A;  5D6E A;  2BWT A;  2GU4 A;  3PKE A;  4RZZ A;  1B6A A;  2BWW A;  2Q95 A;  1WL6 A;  3RVA A;  4U1B A;  2BB7 A;  4Z7M A;  3IU8 A;  1C23 A;  1WN1 A;  3I7M A;  1BN5 A;  2HOW A;  4ZWO A;  2GGB A;  1QZY A;  4OOK A;  3TAV A;  2BHD A;  1WLR A;  2V3Y A;  5CE6 A;  4ZWP A;  3IL0 A;  2GG2 A;  2EA4 A;  3PKD A;  4A6W A;  1KQ0 A;  4FLK A;  1XGS A;  2GG0 A;  3IU9 A;  5CLS A;  2GG8 A;  1R5G A;  3IG4 A;  4IKT A;  2BHC A;  2MAT A;  1N51 A;  2EVC A;  2G6P A;  4U6W A;  4IKS A;  1WBQ A;  1A16 A;  3Q6D A;  3OOO A;  1MAT A;  4QR8 A;  1WY2 A;  2BWV A;  5JI6 A;  1YJ3 A;  2NQ6 A;  3IU7 A;  4S00 A;  1YVM A;  4U69 A;  2P98 A;  2EVM A;  1XNZ A;  2GU7 A;  4PNC A;  1B59 A;  3ROR A;  3BIQ A;  1C22 A;  4U6Z A;  4KM3 A;  1YW8 A;  3FMR A;  3PKA A;  4PV4 A;  5CNX A;  3TB5 A;  4FUK A;  2NQ7 A;  2BWX A;  1YW7 A;  4RZY A;  1BOA A;  3FMQ A;  3CB5 A;  3PKC A;  4FO8 A;  5D6F A;  2EVO A; 
#chains in the Genus database with same CATH topology
 3QOC A;  3OVK A;  4HXX A;  4IPA A;  2Q94 A;  1KP0 A;  4EGE A;  2GG3 A;  5CDL A;  5JHU A;  2P9A A;  2BHA A;  1W2M A;  4RGZ 1;  1XGO A;  2ADU A;  4U70 A;  5FCF A;  1CHM A;  2B3L A;  2GGC A;  4IU6 A;  1XGN A;  2Q96 A;  2V3X A;  4IKU A;  2V3Z A;  3MAT A;  3MX6 A;  4FKC A;  1WKM A;  4U6E A;  2GU6 A;  1O0X A;  1YW9 A;  3BIT A;  2OKN A;  3PN9 A;  4IF7 A;  4U6J A;  1C27 A;  1R58 A;  2OAZ A;  2BHB A;  3CB6 A;  5CDV A;  3L7G A;  1WL9 A;  4S01 A;  2GZ5 A;  4IKR A;  4FLL A;  3FM3 A;  2GG7 A;  2V6C A;  1KQ9 A;  2P99 A;  2IW2 A;  4JUQ A;  1M35 A;  5CDE A;  4ZNG A;  4FLI A;  1R5H A;  3O5V A;  3PEB A;  4ZWU A;  1XGM A;  2B3K A;  4U73 A;  4U75 A;  5CIK A;  5FCH A;  2Q93 A;  4R60 A;  2EA2 A;  2GG9 A;  4S2T P;  4S2R P;  1C21 A;  1C24 A;  3S6B A;  1JAW A;  2B3H A;  2BWS A;  4IEC A;  1Y1N A;  2BH3 A;  5E5B A;  1W7V A;  4FLJ A;  1QXW A;  2GG5 A;  1QXY A;  4A6V A;  3BIP A;  2Q92 A;  2BWU A;  4U6C A;  4MAT A;  3PKB A;  2GU5 A;  2BN7 A;  3L24 A;  2GTX A;  3MR1 A;  4U71 A;  3D27 A;  2GA2 A;  2DFI A;  1QXZ A;  4IDY A;  4FO7 A;  2ZSG A;  5E2C A;  2Q8K A;  3CTZ A;  1PV9 A;  5JFR A;  4B28 A;  2BWY A;  4U76 A;  5D6E A;  2BWT A;  2GU4 A;  3PKE A;  4RZZ A;  1B6A A;  2BWW A;  2Q95 A;  1WL6 A;  3RVA A;  4U1B A;  2BB7 A;  4Z7M A;  3IU8 A;  1C23 A;  1WN1 A;  3I7M A;  1BN5 A;  2HOW A;  4ZWO A;  2GGB A;  1QZY A;  4OOK A;  3TAV A;  2BHD A;  1WLR A;  2V3Y A;  5CE6 A;  4ZWP A;  3IL0 A;  2GG2 A;  2EA4 A;  3PKD A;  4A6W A;  1KQ0 A;  4FLK A;  1XGS A;  2GG0 A;  3IU9 A;  5CLS A;  2GG8 A;  1R5G A;  3IG4 A;  4IKT A;  2BHC A;  2MAT A;  1N51 A;  2EVC A;  2G6P A;  4U6W A;  4IKS A;  1WBQ A;  1A16 A;  3Q6D A;  3OOO A;  1MAT A;  4QR8 A;  1WY2 A;  2BWV A;  5JI6 A;  1YJ3 A;  2NQ6 A;  3IU7 A;  4S00 A;  1YVM A;  4U69 A;  2P98 A;  2EVM A;  1XNZ A;  2GU7 A;  4PNC A;  1B59 A;  3ROR A;  3BIQ A;  1C22 A;  4U6Z A;  4KM3 A;  1YW8 A;  3FMR A;  3PKA A;  4PV4 A;  5CNX A;  3TB5 A;  4FUK A;  2NQ7 A;  2BWX A;  1YW7 A;  4RZY A;  1BOA A;  3FMQ A;  3CB5 A;  3PKC A;  4FO8 A;  5D6F A;  2EVO A; 
#chains in the Genus database with same CATH homology
 3QOC A;  3OVK A;  4HXX A;  4IPA A;  2Q94 A;  1KP0 A;  4EGE A;  2GG3 A;  5CDL A;  5JHU A;  2P9A A;  2BHA A;  1W2M A;  4RGZ 1;  1XGO A;  2ADU A;  4U70 A;  5FCF A;  1CHM A;  2B3L A;  2GGC A;  4IU6 A;  1XGN A;  2Q96 A;  2V3X A;  4IKU A;  2V3Z A;  3MAT A;  3MX6 A;  4FKC A;  1WKM A;  4U6E A;  2GU6 A;  1O0X A;  1YW9 A;  3BIT A;  2OKN A;  3PN9 A;  4IF7 A;  4U6J A;  1C27 A;  1R58 A;  2OAZ A;  2BHB A;  3CB6 A;  5CDV A;  3L7G A;  1WL9 A;  4S01 A;  2GZ5 A;  4IKR A;  4FLL A;  3FM3 A;  2GG7 A;  2V6C A;  1KQ9 A;  2P99 A;  2IW2 A;  4JUQ A;  1M35 A;  5CDE A;  4ZNG A;  4FLI A;  1R5H A;  3O5V A;  3PEB A;  4ZWU A;  1XGM A;  2B3K A;  4U73 A;  4U75 A;  5CIK A;  5FCH A;  2Q93 A;  4R60 A;  2EA2 A;  2GG9 A;  4S2T P;  4S2R P;  1C21 A;  1C24 A;  3S6B A;  1JAW A;  2B3H A;  2BWS A;  4IEC A;  1Y1N A;  2BH3 A;  5E5B A;  1W7V A;  4FLJ A;  1QXW A;  2GG5 A;  1QXY A;  4A6V A;  3BIP A;  2Q92 A;  2BWU A;  4U6C A;  4MAT A;  3PKB A;  2GU5 A;  2BN7 A;  3L24 A;  2GTX A;  3MR1 A;  4U71 A;  3D27 A;  2GA2 A;  2DFI A;  1QXZ A;  4IDY A;  4FO7 A;  2ZSG A;  5E2C A;  2Q8K A;  3CTZ A;  1PV9 A;  5JFR A;  4B28 A;  2BWY A;  4U76 A;  5D6E A;  2BWT A;  2GU4 A;  3PKE A;  4RZZ A;  1B6A A;  2BWW A;  2Q95 A;  1WL6 A;  3RVA A;  4U1B A;  2BB7 A;  4Z7M A;  3IU8 A;  1C23 A;  1WN1 A;  3I7M A;  1BN5 A;  2HOW A;  4ZWO A;  2GGB A;  1QZY A;  4OOK A;  3TAV A;  2BHD A;  1WLR A;  2V3Y A;  5CE6 A;  4ZWP A;  3IL0 A;  2GG2 A;  2EA4 A;  3PKD A;  4A6W A;  1KQ0 A;  4FLK A;  1XGS A;  2GG0 A;  3IU9 A;  5CLS A;  2GG8 A;  1R5G A;  3IG4 A;  4IKT A;  2BHC A;  2MAT A;  1N51 A;  2EVC A;  2G6P A;  4U6W A;  4IKS A;  1WBQ A;  1A16 A;  3Q6D A;  3OOO A;  1MAT A;  4QR8 A;  1WY2 A;  2BWV A;  5JI6 A;  1YJ3 A;  2NQ6 A;  3IU7 A;  4S00 A;  1YVM A;  4U69 A;  2P98 A;  2EVM A;  1XNZ A;  2GU7 A;  4PNC A;  1B59 A;  3ROR A;  3BIQ A;  1C22 A;  4U6Z A;  4KM3 A;  1YW8 A;  3FMR A;  3PKA A;  4PV4 A;  5CNX A;  3TB5 A;  4FUK A;  2NQ7 A;  2BWX A;  1YW7 A;  4RZY A;  1BOA A;  3FMQ A;  3CB5 A;  3PKC A;  4FO8 A;  5D6F A;  2EVO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...