4ZNGA

X-ray crystallography of recombinant lactococcus lactis prolidase
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
362
structure length
362
Chain Sequence
MSKIERISAFLNDKEVDMTFITNPTTLNYLTGLAIDPHERIAGLMIFRDSTPMLFTPALEVEKAKEHTSGLDIFGYEDSQNPWEVVKNHVKSDVKSIAVEFSDIPLAKTEGLKAQFGDINFVNLTPLIERMRLIKSADEIEKMKVAGDFADKCFEIGFATAAERNGVTESDIVAKIEYEMKRMGVPQMSFDTLVLSGARAANPHGAPENVEIQENKLLLFDLGVMSGGYASDATRTIAIGQPNDFDAEIHKIVKEAQQAAMDFIKPGVTAHEVDAVARDLITKAGYGEYFNHRLGHGIGMDVHEYPSIVAGNDLVIQEGMCFSNEPGIYIPGKVGVRIEDCLYVTENGCESFTHTDHDLLIF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystallography of recombinant Lactococcus lactis prolidase
rcsb
source organism Lactococcus lactis
molecule tags Hydrolase
molecule keywords Prolidase
total genus 117
structure length 362
sequence length 362
chains with identical sequence B, C
ec nomenclature ec 3.4.13.9: Xaa-Pro dipeptidase.
pdb deposition date 2015-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 4zngA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 4zngA02
3L7GA 1XNZA 2Q8KA 4U1BA 2NQ7A 4IF7A 2BHBA 2V3YA 4U73A 1KQ0A 2HOWA 4U6CA 4FLKA 4IKSA 1XGNA 2EA4A 1WBQA 3OOOA 3PKCA 4QR8A 2BWUA 2BHAA 1W2MA 3PKBA 2OKNA 2V3ZA 4IKTA 5D6FA 3PKEA 2ADUA 4PNCA 2ZSGA 3RVAA 2B3LA 4U75A 2EA2A 5JI6A 2Q94A 2GGCA 2P98A 4RZZA 1YW8A 3PEBA 2GTXA 2Q95A 3IG4A 3PN9A 1C23A 2GU7A 4U6JA 1B6AA 2Q93A 2GA2A 4A6VA 2BHCA 1WLRA 4ZNGA 2GG5A 2GU6A 3IU8A 4RZYA 1N51A 2EVCA 1WL6A 2GU4A 4FLLA 4R60A 2B3HA 5FCFA 3CB6A 2Q96A 3RORA 3FMQA 5CNXA 2B3KA 2P9AA 2GG7A 1QXWA 4IECA 1YJ3A 4EGEA 1Y1NA 2GU5A 4U6EA 1C27A 1PV9A 3L24A 2OAZA 4IDYA 1JAWA 4PV4A 4S00A 2BN7A 2DFIA 4ZWOA 5CDEA 2V3XA 4IKRA 4B28A 5D6EA 3IL0A 4ZWPA 5CDVA 4Z7MA 2GG8A 5CE6A 2MATA 4MATA 1BOAA 1WY2A 2BWTA 3MATA 1KQ9A 3FM3A 3I7MA 4FLJA 4S01A 1C21A 4FKCA 4HXXA 1YW9A 4S2RP 1XGSA 1WL9A 2GG9A 4U70A 4U71A 2BWWA 1QXZA 3CB5A 1CHMA 2GG0A 3D27A 2BH3A 2IW2A 4RGZ1 3PKAA 4JUQA 3TB5A 1YW7A 3MR1A 5E5BA 1QXYA 3O5VA 1R5HA 2EVOA 2BWYA 4U6ZA 5CIKA 2GGBA 4FO7A 3OVKA 1B59A 4ZWUA 2V6CA 3BIPA 4KM3A 5CLSA 2GZ5A 4S2TP 1R5GA 1R58A 1WN1A 1YVMA 1O0XA 2Q92A 3BITA 2BWSA 1XGOA 2EVMA 3FMRA 2NQ6A 2BWXA 3IU7A 2G6PA 4U6WA 4A6WA 2BB7A 3CTZA 3PKDA 2P99A 3MX6A 2BHDA 4FUKA 4IU6A 3IU9A 4U69A 4U76A 3QOCA 5CDLA 1XGMA 1BN5A 2GG3A 1W7VA 5JHUA 4IKUA 1WKMA 4IPAA 1QZYA 3BIQA 1MATA 2GG2A 4FLIA 4FO8A 5E2CA 3TAVA 2BWVA 4OOKA 1C22A 1C24A 3S6BA 5FCHA 5JFRA 3Q6DA 1M35A 1A16A 1KP0A
chains in the Genus database with same CATH superfamily
3L7GA 1XNZA 2Q8KA 4U1BA 2NQ7A 4IF7A 2BHBA 2V3YA 4U73A 1KQ0A 2HOWA 4U6CA 4FLKA 4IKSA 1XGNA 2EA4A 1WBQA 3OOOA 3PKCA 4QR8A 2BWUA 2BHAA 1W2MA 3PKBA 2OKNA 2V3ZA 4IKTA 5D6FA 3PKEA 2ADUA 4PNCA 2ZSGA 3RVAA 2B3LA 4U75A 2EA2A 5JI6A 2Q94A 2GGCA 2P98A 4RZZA 1YW8A 3PEBA 2GTXA 2Q95A 3IG4A 3PN9A 1C23A 2GU7A 4U6JA 1B6AA 2Q93A 2GA2A 4A6VA 2BHCA 1WLRA 4ZNGA 2GG5A 2GU6A 3IU8A 4RZYA 1N51A 2EVCA 1WL6A 2GU4A 4FLLA 4R60A 2B3HA 5FCFA 3CB6A 2Q96A 3RORA 3FMQA 5CNXA 2B3KA 2P9AA 2GG7A 1QXWA 4IECA 1YJ3A 4EGEA 1Y1NA 2GU5A 4U6EA 1C27A 1PV9A 3L24A 2OAZA 4IDYA 1JAWA 4PV4A 4S00A 2BN7A 2DFIA 4ZWOA 5CDEA 2V3XA 4IKRA 4B28A 5D6EA 3IL0A 4ZWPA 5CDVA 4Z7MA 2GG8A 5CE6A 2MATA 4MATA 1BOAA 1WY2A 2BWTA 3MATA 1KQ9A 3FM3A 3I7MA 4FLJA 4S01A 1C21A 4FKCA 4HXXA 1YW9A 4S2RP 1XGSA 1WL9A 2GG9A 4U70A 4U71A 2BWWA 1QXZA 3CB5A 1CHMA 2GG0A 3D27A 2BH3A 2IW2A 4RGZ1 3PKAA 4JUQA 3TB5A 1YW7A 3MR1A 5E5BA 1QXYA 3O5VA 1R5HA 2EVOA 2BWYA 4U6ZA 5CIKA 2GGBA 4FO7A 3OVKA 1B59A 4ZWUA 2V6CA 3BIPA 4KM3A 5CLSA 2GZ5A 4S2TP 1R5GA 1R58A 1WN1A 1YVMA 1O0XA 2Q92A 3BITA 2BWSA 1XGOA 2EVMA 3FMRA 2NQ6A 2BWXA 3IU7A 2G6PA 4U6WA 4A6WA 2BB7A 3CTZA 3PKDA 2P99A 3MX6A 2BHDA 4FUKA 4IU6A 3IU9A 4U69A 4U76A 3QOCA 5CDLA 1XGMA 1BN5A 2GG3A 1W7VA 5JHUA 4IKUA 1WKMA 4IPAA 1QZYA 3BIQA 1MATA 2GG2A 4FLIA 4FO8A 5E2CA 3TAVA 2BWVA 4OOKA 1C22A 1C24A 3S6BA 5FCHA 5JFRA 3Q6DA 1M35A 1A16A 1KP0A
chains in the Genus database with same CATH topology
3L7GA 1XNZA 2Q8KA 4U1BA 2NQ7A 4IF7A 2BHBA 2V3YA 4U73A 1KQ0A 2HOWA 4U6CA 4FLKA 4IKSA 1XGNA 2EA4A 1WBQA 3OOOA 3PKCA 4QR8A 2BWUA 2BHAA 1W2MA 3PKBA 2OKNA 2V3ZA 4IKTA 5D6FA 3PKEA 2ADUA 4PNCA 2ZSGA 3RVAA 2B3LA 4U75A 2EA2A 5JI6A 2Q94A 2GGCA 2P98A 4RZZA 1YW8A 3PEBA 2GTXA 2Q95A 3IG4A 3PN9A 1C23A 2GU7A 4U6JA 1B6AA 2Q93A 2GA2A 4A6VA 2BHCA 1WLRA 4ZNGA 2GG5A 2GU6A 3IU8A 4RZYA 1N51A 2EVCA 1WL6A 2GU4A 4FLLA 4R60A 2B3HA 5FCFA 3CB6A 2Q96A 3RORA 3FMQA 5CNXA 2B3KA 2P9AA 2GG7A 1QXWA 4IECA 1YJ3A 4EGEA 1Y1NA 2GU5A 4U6EA 1C27A 1PV9A 3L24A 2OAZA 4IDYA 1JAWA 4PV4A 4S00A 2BN7A 2DFIA 4ZWOA 5CDEA 2V3XA 4IKRA 4B28A 5D6EA 3IL0A 4ZWPA 5CDVA 4Z7MA 2GG8A 5CE6A 2MATA 4MATA 1BOAA 1WY2A 2BWTA 3MATA 1KQ9A 3FM3A 3I7MA 4FLJA 4S01A 1C21A 4FKCA 4HXXA 1YW9A 4S2RP 1XGSA 1WL9A 2GG9A 4U70A 4U71A 2BWWA 1QXZA 3CB5A 1CHMA 2GG0A 3D27A 2BH3A 2IW2A 4RGZ1 3PKAA 4JUQA 3TB5A 1YW7A 3MR1A 5E5BA 1QXYA 3O5VA 1R5HA 2EVOA 2BWYA 4U6ZA 5CIKA 2GGBA 4FO7A 3OVKA 1B59A 4ZWUA 2V6CA 3BIPA 4KM3A 5CLSA 2GZ5A 4S2TP 1R5GA 1R58A 1WN1A 1YVMA 1O0XA 2Q92A 3BITA 2BWSA 1XGOA 2EVMA 3FMRA 2NQ6A 2BWXA 3IU7A 2G6PA 4U6WA 4A6WA 2BB7A 3CTZA 3PKDA 2P99A 3MX6A 2BHDA 4FUKA 4IU6A 3IU9A 4U69A 4U76A 3QOCA 5CDLA 1XGMA 1BN5A 2GG3A 1W7VA 5JHUA 4IKUA 1WKMA 4IPAA 1QZYA 3BIQA 1MATA 2GG2A 4FLIA 4FO8A 5E2CA 3TAVA 2BWVA 4OOKA 1C22A 1C24A 3S6BA 5FCHA 5JFRA 3Q6DA 1M35A 1A16A 1KP0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L7G A;  1XNZ A;  2Q8K A;  4U1B A;  2NQ7 A;  4IF7 A;  2BHB A;  2V3Y A;  4U73 A;  1KQ0 A;  2HOW A;  4U6C A;  4FLK A;  4IKS A;  1XGN A;  2EA4 A;  1WBQ A;  3OOO A;  3PKC A;  4QR8 A;  2BWU A;  2BHA A;  1W2M A;  3PKB A;  2OKN A;  2V3Z A;  4IKT A;  5D6F A;  3PKE A;  2ADU A;  4PNC A;  2ZSG A;  3RVA A;  2B3L A;  4U75 A;  2EA2 A;  5JI6 A;  2Q94 A;  2GGC A;  2P98 A;  4RZZ A;  1YW8 A;  3PEB A;  2GTX A;  2Q95 A;  3IG4 A;  3PN9 A;  1C23 A;  2GU7 A;  4U6J A;  1B6A A;  2Q93 A;  2GA2 A;  4A6V A;  2BHC A;  1WLR A;  4ZNG A;  2GG5 A;  2GU6 A;  3IU8 A;  4RZY A;  1N51 A;  2EVC A;  1WL6 A;  2GU4 A;  4FLL A;  4R60 A;  2B3H A;  5FCF A;  3CB6 A;  2Q96 A;  3ROR A;  3FMQ A;  5CNX A;  2B3K A;  2P9A A;  2GG7 A;  1QXW A;  4IEC A;  1YJ3 A;  4EGE A;  1Y1N A;  2GU5 A;  4U6E A;  1C27 A;  1PV9 A;  3L24 A;  2OAZ A;  4IDY A;  1JAW A;  4PV4 A;  4S00 A;  2BN7 A;  2DFI A;  4ZWO A;  5CDE A;  2V3X A;  4IKR A;  4B28 A;  5D6E A;  3IL0 A;  4ZWP A;  5CDV A;  4Z7M A;  2GG8 A;  5CE6 A;  2MAT A;  4MAT A;  1BOA A;  1WY2 A;  2BWT A;  3MAT A;  1KQ9 A;  3FM3 A;  3I7M A;  4FLJ A;  4S01 A;  1C21 A;  4FKC A;  4HXX A;  1YW9 A;  4S2R P;  1XGS A;  1WL9 A;  2GG9 A;  4U70 A;  4U71 A;  2BWW A;  1QXZ A;  3CB5 A;  1CHM A;  2GG0 A;  3D27 A;  2BH3 A;  2IW2 A;  4RGZ 1;  3PKA A;  4JUQ A;  3TB5 A;  1YW7 A;  3MR1 A;  5E5B A;  1QXY A;  3O5V A;  1R5H A;  2EVO A;  2BWY A;  4U6Z A;  5CIK A;  2GGB A;  4FO7 A;  3OVK A;  1B59 A;  4ZWU A;  2V6C A;  3BIP A;  4KM3 A;  5CLS A;  2GZ5 A;  4S2T P;  1R5G A;  1R58 A;  1WN1 A;  1YVM A;  1O0X A;  2Q92 A;  3BIT A;  2BWS A;  1XGO A;  2EVM A;  3FMR A;  2NQ6 A;  2BWX A;  3IU7 A;  2G6P A;  4U6W A;  4A6W A;  2BB7 A;  3CTZ A;  3PKD A;  2P99 A;  3MX6 A;  2BHD A;  4FUK A;  4IU6 A;  3IU9 A;  4U69 A;  4U76 A;  3QOC A;  5CDL A;  1XGM A;  1BN5 A;  2GG3 A;  1W7V A;  5JHU A;  4IKU A;  1WKM A;  4IPA A;  1QZY A;  3BIQ A;  1MAT A;  2GG2 A;  4FLI A;  4FO8 A;  5E2C A;  3TAV A;  2BWV A;  4OOK A;  1C22 A;  1C24 A;  3S6B A;  5FCH A;  5JFR A;  3Q6D A;  1M35 A;  1A16 A;  1KP0 A; 
#chains in the Genus database with same CATH topology
 3L7G A;  1XNZ A;  2Q8K A;  4U1B A;  2NQ7 A;  4IF7 A;  2BHB A;  2V3Y A;  4U73 A;  1KQ0 A;  2HOW A;  4U6C A;  4FLK A;  4IKS A;  1XGN A;  2EA4 A;  1WBQ A;  3OOO A;  3PKC A;  4QR8 A;  2BWU A;  2BHA A;  1W2M A;  3PKB A;  2OKN A;  2V3Z A;  4IKT A;  5D6F A;  3PKE A;  2ADU A;  4PNC A;  2ZSG A;  3RVA A;  2B3L A;  4U75 A;  2EA2 A;  5JI6 A;  2Q94 A;  2GGC A;  2P98 A;  4RZZ A;  1YW8 A;  3PEB A;  2GTX A;  2Q95 A;  3IG4 A;  3PN9 A;  1C23 A;  2GU7 A;  4U6J A;  1B6A A;  2Q93 A;  2GA2 A;  4A6V A;  2BHC A;  1WLR A;  4ZNG A;  2GG5 A;  2GU6 A;  3IU8 A;  4RZY A;  1N51 A;  2EVC A;  1WL6 A;  2GU4 A;  4FLL A;  4R60 A;  2B3H A;  5FCF A;  3CB6 A;  2Q96 A;  3ROR A;  3FMQ A;  5CNX A;  2B3K A;  2P9A A;  2GG7 A;  1QXW A;  4IEC A;  1YJ3 A;  4EGE A;  1Y1N A;  2GU5 A;  4U6E A;  1C27 A;  1PV9 A;  3L24 A;  2OAZ A;  4IDY A;  1JAW A;  4PV4 A;  4S00 A;  2BN7 A;  2DFI A;  4ZWO A;  5CDE A;  2V3X A;  4IKR A;  4B28 A;  5D6E A;  3IL0 A;  4ZWP A;  5CDV A;  4Z7M A;  2GG8 A;  5CE6 A;  2MAT A;  4MAT A;  1BOA A;  1WY2 A;  2BWT A;  3MAT A;  1KQ9 A;  3FM3 A;  3I7M A;  4FLJ A;  4S01 A;  1C21 A;  4FKC A;  4HXX A;  1YW9 A;  4S2R P;  1XGS A;  1WL9 A;  2GG9 A;  4U70 A;  4U71 A;  2BWW A;  1QXZ A;  3CB5 A;  1CHM A;  2GG0 A;  3D27 A;  2BH3 A;  2IW2 A;  4RGZ 1;  3PKA A;  4JUQ A;  3TB5 A;  1YW7 A;  3MR1 A;  5E5B A;  1QXY A;  3O5V A;  1R5H A;  2EVO A;  2BWY A;  4U6Z A;  5CIK A;  2GGB A;  4FO7 A;  3OVK A;  1B59 A;  4ZWU A;  2V6C A;  3BIP A;  4KM3 A;  5CLS A;  2GZ5 A;  4S2T P;  1R5G A;  1R58 A;  1WN1 A;  1YVM A;  1O0X A;  2Q92 A;  3BIT A;  2BWS A;  1XGO A;  2EVM A;  3FMR A;  2NQ6 A;  2BWX A;  3IU7 A;  2G6P A;  4U6W A;  4A6W A;  2BB7 A;  3CTZ A;  3PKD A;  2P99 A;  3MX6 A;  2BHD A;  4FUK A;  4IU6 A;  3IU9 A;  4U69 A;  4U76 A;  3QOC A;  5CDL A;  1XGM A;  1BN5 A;  2GG3 A;  1W7V A;  5JHU A;  4IKU A;  1WKM A;  4IPA A;  1QZY A;  3BIQ A;  1MAT A;  2GG2 A;  4FLI A;  4FO8 A;  5E2C A;  3TAV A;  2BWV A;  4OOK A;  1C22 A;  1C24 A;  3S6B A;  5FCH A;  5JFR A;  3Q6D A;  1M35 A;  1A16 A;  1KP0 A; 
#chains in the Genus database with same CATH homology
 3L7G A;  1XNZ A;  2Q8K A;  4U1B A;  2NQ7 A;  4IF7 A;  2BHB A;  2V3Y A;  4U73 A;  1KQ0 A;  2HOW A;  4U6C A;  4FLK A;  4IKS A;  1XGN A;  2EA4 A;  1WBQ A;  3OOO A;  3PKC A;  4QR8 A;  2BWU A;  2BHA A;  1W2M A;  3PKB A;  2OKN A;  2V3Z A;  4IKT A;  5D6F A;  3PKE A;  2ADU A;  4PNC A;  2ZSG A;  3RVA A;  2B3L A;  4U75 A;  2EA2 A;  5JI6 A;  2Q94 A;  2GGC A;  2P98 A;  4RZZ A;  1YW8 A;  3PEB A;  2GTX A;  2Q95 A;  3IG4 A;  3PN9 A;  1C23 A;  2GU7 A;  4U6J A;  1B6A A;  2Q93 A;  2GA2 A;  4A6V A;  2BHC A;  1WLR A;  4ZNG A;  2GG5 A;  2GU6 A;  3IU8 A;  4RZY A;  1N51 A;  2EVC A;  1WL6 A;  2GU4 A;  4FLL A;  4R60 A;  2B3H A;  5FCF A;  3CB6 A;  2Q96 A;  3ROR A;  3FMQ A;  5CNX A;  2B3K A;  2P9A A;  2GG7 A;  1QXW A;  4IEC A;  1YJ3 A;  4EGE A;  1Y1N A;  2GU5 A;  4U6E A;  1C27 A;  1PV9 A;  3L24 A;  2OAZ A;  4IDY A;  1JAW A;  4PV4 A;  4S00 A;  2BN7 A;  2DFI A;  4ZWO A;  5CDE A;  2V3X A;  4IKR A;  4B28 A;  5D6E A;  3IL0 A;  4ZWP A;  5CDV A;  4Z7M A;  2GG8 A;  5CE6 A;  2MAT A;  4MAT A;  1BOA A;  1WY2 A;  2BWT A;  3MAT A;  1KQ9 A;  3FM3 A;  3I7M A;  4FLJ A;  4S01 A;  1C21 A;  4FKC A;  4HXX A;  1YW9 A;  4S2R P;  1XGS A;  1WL9 A;  2GG9 A;  4U70 A;  4U71 A;  2BWW A;  1QXZ A;  3CB5 A;  1CHM A;  2GG0 A;  3D27 A;  2BH3 A;  2IW2 A;  4RGZ 1;  3PKA A;  4JUQ A;  3TB5 A;  1YW7 A;  3MR1 A;  5E5B A;  1QXY A;  3O5V A;  1R5H A;  2EVO A;  2BWY A;  4U6Z A;  5CIK A;  2GGB A;  4FO7 A;  3OVK A;  1B59 A;  4ZWU A;  2V6C A;  3BIP A;  4KM3 A;  5CLS A;  2GZ5 A;  4S2T P;  1R5G A;  1R58 A;  1WN1 A;  1YVM A;  1O0X A;  2Q92 A;  3BIT A;  2BWS A;  1XGO A;  2EVM A;  3FMR A;  2NQ6 A;  2BWX A;  3IU7 A;  2G6P A;  4U6W A;  4A6W A;  2BB7 A;  3CTZ A;  3PKD A;  2P99 A;  3MX6 A;  2BHD A;  4FUK A;  4IU6 A;  3IU9 A;  4U69 A;  4U76 A;  3QOC A;  5CDL A;  1XGM A;  1BN5 A;  2GG3 A;  1W7V A;  5JHU A;  4IKU A;  1WKM A;  4IPA A;  1QZY A;  3BIQ A;  1MAT A;  2GG2 A;  4FLI A;  4FO8 A;  5E2C A;  3TAV A;  2BWV A;  4OOK A;  1C22 A;  1C24 A;  3S6B A;  5FCH A;  5JFR A;  3Q6D A;  1M35 A;  1A16 A;  1KP0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...