2BWSA

His243ala escherichia coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILAYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwsA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwsA02
3OVKA 4IU6A 4IKUA 1BN5A 1QXWA 1C27A 2EA2A 1WBQA 1C22A 4U69A 2BWVA 4ZWOA 2G6PA 4S2RP 3IU8A 3L7GA 2Q94A 3O5VA 1KP0A 5D6FA 3RORA 2NQ7A 3D27A 2BWWA 1WL6A 3QOCA 2V3YA 1JAWA 1KQ9A 2BB7A 1XNZA 2P99A 1WL9A 2GG5A 5JHUA 4FLIA 5E2CA 2GG8A 1XGOA 2BHAA 3MR1A 4IPAA 4U1BA 1BOAA 2EVCA 3PKCA 1YVMA 2GG0A 2B3LA 2BWTA 4Z7MA 1O0XA 4U70A 1A16A 3IG4A 1B6AA 3MATA 2GTXA 4U76A 1QZYA 2IW2A 2BHDA 3Q6DA 2HOWA 2EVMA 3FMRA 3PKDA 3CTZA 3PEBA 2OAZA 3BIPA 3FMQA 4RZYA 4S00A 4FLJA 1WY2A 2EVOA 2BWUA 1YJ3A 2EA4A 1CHMA 1PV9A 4U6JA 2GU5A 4A6WA 2Q8KA 2GA2A 3PKBA 4FO8A 4PNCA 4A6VA 5CDLA 2MATA 1R58A 3TAVA 5FCHA 4S2TP 2Q92A 2BWSA 4FKCA 1QXZA 2GU7A 4ZWUA 5D6EA 4FUKA 1M35A 4IECA 1WN1A 2GGBA 2BHCA 2P98A 1XGNA 2GG2A 3PN9A 3S6BA 2ZSGA 2BH3A 4U6ZA 5CDEA 4U73A 4U6WA 2GU6A 1B59A 4QR8A 4ZWPA 2ADUA 2V6CA 3PKAA 2GGCA 1YW7A 2GU4A 5FCFA 2Q96A 2NQ6A 4RZZA 5CNXA 2B3HA 2P9AA 4MATA 4R60A 4PV4A 3BIQA 3OOOA 4FO7A 4OOKA 1W7VA 1WLRA 1WKMA 1MATA 2GG3A 4JUQA 4IF7A 1C21A 1XGSA 4HXXA 5JI6A 5CE6A 4U75A 3PKEA 3TB5A 1XGMA 2DFIA 5JFRA 2V3ZA 5CDVA 3BITA 2GG7A 2OKNA 4IKRA 5E5BA 1YW9A 4FLLA 5CIKA 4EGEA 4FLKA 5CLSA 2V3XA 2BWYA 1R5HA 3I7MA 3MX6A 2GG9A 3IU7A 4U6CA 2BN7A 1KQ0A 1QXYA 1Y1NA 3IL0A 3L24A 2Q95A 3IU9A 4KM3A 2BHBA 4U6EA 3RVAA 4U71A 1C24A 3CB5A 1C23A 4IKTA 1N51A 2BWXA 3CB6A 4B28A 2B3KA 3FM3A 4S01A 4IDYA 1YW8A 4RGZ1 2GZ5A 4ZNGA 4IKSA 1R5GA 2Q93A 1W2MA
chains in the Genus database with same CATH superfamily
3OVKA 4IU6A 4IKUA 1BN5A 1QXWA 1C27A 2EA2A 1WBQA 1C22A 4U69A 2BWVA 4ZWOA 2G6PA 4S2RP 3IU8A 3L7GA 2Q94A 3O5VA 1KP0A 5D6FA 3RORA 2NQ7A 3D27A 2BWWA 1WL6A 3QOCA 2V3YA 1JAWA 1KQ9A 2BB7A 1XNZA 2P99A 1WL9A 2GG5A 5JHUA 4FLIA 5E2CA 2GG8A 1XGOA 2BHAA 3MR1A 4IPAA 4U1BA 1BOAA 2EVCA 3PKCA 1YVMA 2GG0A 2B3LA 2BWTA 4Z7MA 1O0XA 4U70A 1A16A 3IG4A 1B6AA 3MATA 2GTXA 4U76A 1QZYA 2IW2A 2BHDA 3Q6DA 2HOWA 2EVMA 3FMRA 3PKDA 3CTZA 3PEBA 2OAZA 3BIPA 3FMQA 4RZYA 4S00A 4FLJA 1WY2A 2EVOA 2BWUA 1YJ3A 2EA4A 1CHMA 1PV9A 4U6JA 2GU5A 4A6WA 2Q8KA 2GA2A 3PKBA 4FO8A 4PNCA 4A6VA 5CDLA 2MATA 1R58A 3TAVA 5FCHA 4S2TP 2Q92A 2BWSA 4FKCA 1QXZA 2GU7A 4ZWUA 5D6EA 4FUKA 1M35A 4IECA 1WN1A 2GGBA 2BHCA 2P98A 1XGNA 2GG2A 3PN9A 3S6BA 2ZSGA 2BH3A 4U6ZA 5CDEA 4U73A 4U6WA 2GU6A 1B59A 4QR8A 4ZWPA 2ADUA 2V6CA 3PKAA 2GGCA 1YW7A 2GU4A 5FCFA 2Q96A 2NQ6A 4RZZA 5CNXA 2B3HA 2P9AA 4MATA 4R60A 4PV4A 3BIQA 3OOOA 4FO7A 4OOKA 1W7VA 1WLRA 1WKMA 1MATA 2GG3A 4JUQA 4IF7A 1C21A 1XGSA 4HXXA 5JI6A 5CE6A 4U75A 3PKEA 3TB5A 1XGMA 2DFIA 5JFRA 2V3ZA 5CDVA 3BITA 2GG7A 2OKNA 4IKRA 5E5BA 1YW9A 4FLLA 5CIKA 4EGEA 4FLKA 5CLSA 2V3XA 2BWYA 1R5HA 3I7MA 3MX6A 2GG9A 3IU7A 4U6CA 2BN7A 1KQ0A 1QXYA 1Y1NA 3IL0A 3L24A 2Q95A 3IU9A 4KM3A 2BHBA 4U6EA 3RVAA 4U71A 1C24A 3CB5A 1C23A 4IKTA 1N51A 2BWXA 3CB6A 4B28A 2B3KA 3FM3A 4S01A 4IDYA 1YW8A 4RGZ1 2GZ5A 4ZNGA 4IKSA 1R5GA 2Q93A 1W2MA
chains in the Genus database with same CATH topology
3OVKA 4IU6A 4IKUA 1BN5A 1QXWA 1C27A 2EA2A 1WBQA 1C22A 4U69A 2BWVA 4ZWOA 2G6PA 4S2RP 3IU8A 3L7GA 2Q94A 3O5VA 1KP0A 5D6FA 3RORA 2NQ7A 3D27A 2BWWA 1WL6A 3QOCA 2V3YA 1JAWA 1KQ9A 2BB7A 1XNZA 2P99A 1WL9A 2GG5A 5JHUA 4FLIA 5E2CA 2GG8A 1XGOA 2BHAA 3MR1A 4IPAA 4U1BA 1BOAA 2EVCA 3PKCA 1YVMA 2GG0A 2B3LA 2BWTA 4Z7MA 1O0XA 4U70A 1A16A 3IG4A 1B6AA 3MATA 2GTXA 4U76A 1QZYA 2IW2A 2BHDA 3Q6DA 2HOWA 2EVMA 3FMRA 3PKDA 3CTZA 3PEBA 2OAZA 3BIPA 3FMQA 4RZYA 4S00A 4FLJA 1WY2A 2EVOA 2BWUA 1YJ3A 2EA4A 1CHMA 1PV9A 4U6JA 2GU5A 4A6WA 2Q8KA 2GA2A 3PKBA 4FO8A 4PNCA 4A6VA 5CDLA 2MATA 1R58A 3TAVA 5FCHA 4S2TP 2Q92A 2BWSA 4FKCA 1QXZA 2GU7A 4ZWUA 5D6EA 4FUKA 1M35A 4IECA 1WN1A 2GGBA 2BHCA 2P98A 1XGNA 2GG2A 3PN9A 3S6BA 2ZSGA 2BH3A 4U6ZA 5CDEA 4U73A 4U6WA 2GU6A 1B59A 4QR8A 4ZWPA 2ADUA 2V6CA 3PKAA 2GGCA 1YW7A 2GU4A 5FCFA 2Q96A 2NQ6A 4RZZA 5CNXA 2B3HA 2P9AA 4MATA 4R60A 4PV4A 3BIQA 3OOOA 4FO7A 4OOKA 1W7VA 1WLRA 1WKMA 1MATA 2GG3A 4JUQA 4IF7A 1C21A 1XGSA 4HXXA 5JI6A 5CE6A 4U75A 3PKEA 3TB5A 1XGMA 2DFIA 5JFRA 2V3ZA 5CDVA 3BITA 2GG7A 2OKNA 4IKRA 5E5BA 1YW9A 4FLLA 5CIKA 4EGEA 4FLKA 5CLSA 2V3XA 2BWYA 1R5HA 3I7MA 3MX6A 2GG9A 3IU7A 4U6CA 2BN7A 1KQ0A 1QXYA 1Y1NA 3IL0A 3L24A 2Q95A 3IU9A 4KM3A 2BHBA 4U6EA 3RVAA 4U71A 1C24A 3CB5A 1C23A 4IKTA 1N51A 2BWXA 3CB6A 4B28A 2B3KA 3FM3A 4S01A 4IDYA 1YW8A 4RGZ1 2GZ5A 4ZNGA 4IKSA 1R5GA 2Q93A 1W2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OVK A;  4IU6 A;  4IKU A;  1BN5 A;  1QXW A;  1C27 A;  2EA2 A;  1WBQ A;  1C22 A;  4U69 A;  2BWV A;  4ZWO A;  2G6P A;  4S2R P;  3IU8 A;  3L7G A;  2Q94 A;  3O5V A;  1KP0 A;  5D6F A;  3ROR A;  2NQ7 A;  3D27 A;  2BWW A;  1WL6 A;  3QOC A;  2V3Y A;  1JAW A;  1KQ9 A;  2BB7 A;  1XNZ A;  2P99 A;  1WL9 A;  2GG5 A;  5JHU A;  4FLI A;  5E2C A;  2GG8 A;  1XGO A;  2BHA A;  3MR1 A;  4IPA A;  4U1B A;  1BOA A;  2EVC A;  3PKC A;  1YVM A;  2GG0 A;  2B3L A;  2BWT A;  4Z7M A;  1O0X A;  4U70 A;  1A16 A;  3IG4 A;  1B6A A;  3MAT A;  2GTX A;  4U76 A;  1QZY A;  2IW2 A;  2BHD A;  3Q6D A;  2HOW A;  2EVM A;  3FMR A;  3PKD A;  3CTZ A;  3PEB A;  2OAZ A;  3BIP A;  3FMQ A;  4RZY A;  4S00 A;  4FLJ A;  1WY2 A;  2EVO A;  2BWU A;  1YJ3 A;  2EA4 A;  1CHM A;  1PV9 A;  4U6J A;  2GU5 A;  4A6W A;  2Q8K A;  2GA2 A;  3PKB A;  4FO8 A;  4PNC A;  4A6V A;  5CDL A;  2MAT A;  1R58 A;  3TAV A;  5FCH A;  4S2T P;  2Q92 A;  2BWS A;  4FKC A;  1QXZ A;  2GU7 A;  4ZWU A;  5D6E A;  4FUK A;  1M35 A;  4IEC A;  1WN1 A;  2GGB A;  2BHC A;  2P98 A;  1XGN A;  2GG2 A;  3PN9 A;  3S6B A;  2ZSG A;  2BH3 A;  4U6Z A;  5CDE A;  4U73 A;  4U6W A;  2GU6 A;  1B59 A;  4QR8 A;  4ZWP A;  2ADU A;  2V6C A;  3PKA A;  2GGC A;  1YW7 A;  2GU4 A;  5FCF A;  2Q96 A;  2NQ6 A;  4RZZ A;  5CNX A;  2B3H A;  2P9A A;  4MAT A;  4R60 A;  4PV4 A;  3BIQ A;  3OOO A;  4FO7 A;  4OOK A;  1W7V A;  1WLR A;  1WKM A;  1MAT A;  2GG3 A;  4JUQ A;  4IF7 A;  1C21 A;  1XGS A;  4HXX A;  5JI6 A;  5CE6 A;  4U75 A;  3PKE A;  3TB5 A;  1XGM A;  2DFI A;  5JFR A;  2V3Z A;  5CDV A;  3BIT A;  2GG7 A;  2OKN A;  4IKR A;  5E5B A;  1YW9 A;  4FLL A;  5CIK A;  4EGE A;  4FLK A;  5CLS A;  2V3X A;  2BWY A;  1R5H A;  3I7M A;  3MX6 A;  2GG9 A;  3IU7 A;  4U6C A;  2BN7 A;  1KQ0 A;  1QXY A;  1Y1N A;  3IL0 A;  3L24 A;  2Q95 A;  3IU9 A;  4KM3 A;  2BHB A;  4U6E A;  3RVA A;  4U71 A;  1C24 A;  3CB5 A;  1C23 A;  4IKT A;  1N51 A;  2BWX A;  3CB6 A;  4B28 A;  2B3K A;  3FM3 A;  4S01 A;  4IDY A;  1YW8 A;  4RGZ 1;  2GZ5 A;  4ZNG A;  4IKS A;  1R5G A;  2Q93 A;  1W2M A; 
#chains in the Genus database with same CATH topology
 3OVK A;  4IU6 A;  4IKU A;  1BN5 A;  1QXW A;  1C27 A;  2EA2 A;  1WBQ A;  1C22 A;  4U69 A;  2BWV A;  4ZWO A;  2G6P A;  4S2R P;  3IU8 A;  3L7G A;  2Q94 A;  3O5V A;  1KP0 A;  5D6F A;  3ROR A;  2NQ7 A;  3D27 A;  2BWW A;  1WL6 A;  3QOC A;  2V3Y A;  1JAW A;  1KQ9 A;  2BB7 A;  1XNZ A;  2P99 A;  1WL9 A;  2GG5 A;  5JHU A;  4FLI A;  5E2C A;  2GG8 A;  1XGO A;  2BHA A;  3MR1 A;  4IPA A;  4U1B A;  1BOA A;  2EVC A;  3PKC A;  1YVM A;  2GG0 A;  2B3L A;  2BWT A;  4Z7M A;  1O0X A;  4U70 A;  1A16 A;  3IG4 A;  1B6A A;  3MAT A;  2GTX A;  4U76 A;  1QZY A;  2IW2 A;  2BHD A;  3Q6D A;  2HOW A;  2EVM A;  3FMR A;  3PKD A;  3CTZ A;  3PEB A;  2OAZ A;  3BIP A;  3FMQ A;  4RZY A;  4S00 A;  4FLJ A;  1WY2 A;  2EVO A;  2BWU A;  1YJ3 A;  2EA4 A;  1CHM A;  1PV9 A;  4U6J A;  2GU5 A;  4A6W A;  2Q8K A;  2GA2 A;  3PKB A;  4FO8 A;  4PNC A;  4A6V A;  5CDL A;  2MAT A;  1R58 A;  3TAV A;  5FCH A;  4S2T P;  2Q92 A;  2BWS A;  4FKC A;  1QXZ A;  2GU7 A;  4ZWU A;  5D6E A;  4FUK A;  1M35 A;  4IEC A;  1WN1 A;  2GGB A;  2BHC A;  2P98 A;  1XGN A;  2GG2 A;  3PN9 A;  3S6B A;  2ZSG A;  2BH3 A;  4U6Z A;  5CDE A;  4U73 A;  4U6W A;  2GU6 A;  1B59 A;  4QR8 A;  4ZWP A;  2ADU A;  2V6C A;  3PKA A;  2GGC A;  1YW7 A;  2GU4 A;  5FCF A;  2Q96 A;  2NQ6 A;  4RZZ A;  5CNX A;  2B3H A;  2P9A A;  4MAT A;  4R60 A;  4PV4 A;  3BIQ A;  3OOO A;  4FO7 A;  4OOK A;  1W7V A;  1WLR A;  1WKM A;  1MAT A;  2GG3 A;  4JUQ A;  4IF7 A;  1C21 A;  1XGS A;  4HXX A;  5JI6 A;  5CE6 A;  4U75 A;  3PKE A;  3TB5 A;  1XGM A;  2DFI A;  5JFR A;  2V3Z A;  5CDV A;  3BIT A;  2GG7 A;  2OKN A;  4IKR A;  5E5B A;  1YW9 A;  4FLL A;  5CIK A;  4EGE A;  4FLK A;  5CLS A;  2V3X A;  2BWY A;  1R5H A;  3I7M A;  3MX6 A;  2GG9 A;  3IU7 A;  4U6C A;  2BN7 A;  1KQ0 A;  1QXY A;  1Y1N A;  3IL0 A;  3L24 A;  2Q95 A;  3IU9 A;  4KM3 A;  2BHB A;  4U6E A;  3RVA A;  4U71 A;  1C24 A;  3CB5 A;  1C23 A;  4IKT A;  1N51 A;  2BWX A;  3CB6 A;  4B28 A;  2B3K A;  3FM3 A;  4S01 A;  4IDY A;  1YW8 A;  4RGZ 1;  2GZ5 A;  4ZNG A;  4IKS A;  1R5G A;  2Q93 A;  1W2M A; 
#chains in the Genus database with same CATH homology
 3OVK A;  4IU6 A;  4IKU A;  1BN5 A;  1QXW A;  1C27 A;  2EA2 A;  1WBQ A;  1C22 A;  4U69 A;  2BWV A;  4ZWO A;  2G6P A;  4S2R P;  3IU8 A;  3L7G A;  2Q94 A;  3O5V A;  1KP0 A;  5D6F A;  3ROR A;  2NQ7 A;  3D27 A;  2BWW A;  1WL6 A;  3QOC A;  2V3Y A;  1JAW A;  1KQ9 A;  2BB7 A;  1XNZ A;  2P99 A;  1WL9 A;  2GG5 A;  5JHU A;  4FLI A;  5E2C A;  2GG8 A;  1XGO A;  2BHA A;  3MR1 A;  4IPA A;  4U1B A;  1BOA A;  2EVC A;  3PKC A;  1YVM A;  2GG0 A;  2B3L A;  2BWT A;  4Z7M A;  1O0X A;  4U70 A;  1A16 A;  3IG4 A;  1B6A A;  3MAT A;  2GTX A;  4U76 A;  1QZY A;  2IW2 A;  2BHD A;  3Q6D A;  2HOW A;  2EVM A;  3FMR A;  3PKD A;  3CTZ A;  3PEB A;  2OAZ A;  3BIP A;  3FMQ A;  4RZY A;  4S00 A;  4FLJ A;  1WY2 A;  2EVO A;  2BWU A;  1YJ3 A;  2EA4 A;  1CHM A;  1PV9 A;  4U6J A;  2GU5 A;  4A6W A;  2Q8K A;  2GA2 A;  3PKB A;  4FO8 A;  4PNC A;  4A6V A;  5CDL A;  2MAT A;  1R58 A;  3TAV A;  5FCH A;  4S2T P;  2Q92 A;  2BWS A;  4FKC A;  1QXZ A;  2GU7 A;  4ZWU A;  5D6E A;  4FUK A;  1M35 A;  4IEC A;  1WN1 A;  2GGB A;  2BHC A;  2P98 A;  1XGN A;  2GG2 A;  3PN9 A;  3S6B A;  2ZSG A;  2BH3 A;  4U6Z A;  5CDE A;  4U73 A;  4U6W A;  2GU6 A;  1B59 A;  4QR8 A;  4ZWP A;  2ADU A;  2V6C A;  3PKA A;  2GGC A;  1YW7 A;  2GU4 A;  5FCF A;  2Q96 A;  2NQ6 A;  4RZZ A;  5CNX A;  2B3H A;  2P9A A;  4MAT A;  4R60 A;  4PV4 A;  3BIQ A;  3OOO A;  4FO7 A;  4OOK A;  1W7V A;  1WLR A;  1WKM A;  1MAT A;  2GG3 A;  4JUQ A;  4IF7 A;  1C21 A;  1XGS A;  4HXX A;  5JI6 A;  5CE6 A;  4U75 A;  3PKE A;  3TB5 A;  1XGM A;  2DFI A;  5JFR A;  2V3Z A;  5CDV A;  3BIT A;  2GG7 A;  2OKN A;  4IKR A;  5E5B A;  1YW9 A;  4FLL A;  5CIK A;  4EGE A;  4FLK A;  5CLS A;  2V3X A;  2BWY A;  1R5H A;  3I7M A;  3MX6 A;  2GG9 A;  3IU7 A;  4U6C A;  2BN7 A;  1KQ0 A;  1QXY A;  1Y1N A;  3IL0 A;  3L24 A;  2Q95 A;  3IU9 A;  4KM3 A;  2BHB A;  4U6E A;  3RVA A;  4U71 A;  1C24 A;  3CB5 A;  1C23 A;  4IKT A;  1N51 A;  2BWX A;  3CB6 A;  4B28 A;  2B3K A;  3FM3 A;  4S01 A;  4IDY A;  1YW8 A;  4RGZ 1;  2GZ5 A;  4ZNG A;  4IKS A;  1R5G A;  2Q93 A;  1W2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...