2BWSA

His243ala escherichia coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILAYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwsA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwsA02
2GA2A 1M35A 4RZZA 5E2CA 4U1BA 3PKAA 1C27A 2GG0A 1Y1NA 2Q96A 4U6JA 3MX6A 4U6CA 2GG3A 1QXZA 1XGNA 4U69A 4U70A 3RORA 1WN1A 1C21A 3TAVA 1PV9A 3MR1A 1MATA 1BN5A 2B3HA 5D6EA 4U6ZA 4S01A 1BOAA 1C22A 2BHBA 1WBQA 5E5BA 4IDYA 1JAWA 1N51A 5CLSA 1QXYA 4R60A 4S00A 2B3KA 2EVOA 4FO7A 1WY2A 4FKCA 3CB6A 2IW2A 5FCHA 3IU7A 4KM3A 5CE6A 3IL0A 1B6AA 5JHUA 2G6PA 2EA4A 2P98A 3PKBA 2V3YA 5CIKA 1XGOA 1B59A 3L7GA 1W2MA 3OVKA 2ADUA 1YJ3A 2BB7A 4U6EA 2GU4A 3RVAA 1CHMA 1C23A 2GG8A 3O5VA 2NQ6A 4OOKA 4PV4A 1WKMA 3PKEA 2BWYA 4FLIA 2GGCA 3PEBA 3FMQA 1XGMA 2BHCA 4QR8A 1W7VA 2BWTA 3L24A 3QOCA 4ZWUA 1QZYA 4IKSA 4IKUA 2EVMA 1KQ9A 5CDEA 1A16A 2BWUA 4Z7MA 2BWWA 4ZWPA 2Q92A 4JUQA 4U76A 4RGZ1 4ZWOA 1WLRA 1WL9A 3MATA 2GU6A 2OAZA 1XGSA 4IKTA 3FMRA 2EVCA 3TB5A 1R5GA 2BWVA 4IPAA 2P99A 1C24A 4FO8A 4U71A 3PN9A 4FLKA 4PNCA 4IKRA 2MATA 1O0XA 2EA2A 4IECA 3Q6DA 1YW7A 2DFIA 5D6FA 3CB5A 3CTZA 4FLJA 3PKDA 3BIPA 5JFRA 3I7MA 2V3ZA 2V6CA 2GTXA 2Q94A 4S2RP 2GG5A 1WL6A 2HOWA 3BITA 3S6BA 2B3LA 2Q93A 2GG7A 5FCFA 5JI6A 2OKNA 3BIQA 2BHDA 2GZ5A 2BN7A 4MATA 2Q95A 2NQ7A 2BHAA 3OOOA 2BWSA 2ZSGA 3FM3A 1R5HA 4FUKA 4EGEA 4ZNGA 4U6WA 1KP0A 2GGBA 1XNZA 4FLLA 4HXXA 4A6VA 2BWXA 5CDLA 2Q8KA 5CDVA 2GG9A 1KQ0A 4RZYA 1YVMA 2GU5A 3IG4A 4U73A 1YW9A 3PKCA 2GU7A 2GG2A 3D27A 4S2TP 2BH3A 1R58A 4IU6A 2V3XA 1YW8A 2P9AA 3IU8A 1QXWA 4IF7A 4A6WA 4U75A 3IU9A 5CNXA 4B28A
chains in the Genus database with same CATH superfamily
2GA2A 1M35A 4RZZA 5E2CA 4U1BA 3PKAA 1C27A 2GG0A 1Y1NA 2Q96A 4U6JA 3MX6A 4U6CA 2GG3A 1QXZA 1XGNA 4U69A 4U70A 3RORA 1WN1A 1C21A 3TAVA 1PV9A 3MR1A 1MATA 1BN5A 2B3HA 5D6EA 4U6ZA 4S01A 1BOAA 1C22A 2BHBA 1WBQA 5E5BA 4IDYA 1JAWA 1N51A 5CLSA 1QXYA 4R60A 4S00A 2B3KA 2EVOA 4FO7A 1WY2A 4FKCA 3CB6A 2IW2A 5FCHA 3IU7A 4KM3A 5CE6A 3IL0A 1B6AA 5JHUA 2G6PA 2EA4A 2P98A 3PKBA 2V3YA 5CIKA 1XGOA 1B59A 3L7GA 1W2MA 3OVKA 2ADUA 1YJ3A 2BB7A 4U6EA 2GU4A 3RVAA 1CHMA 1C23A 2GG8A 3O5VA 2NQ6A 4OOKA 4PV4A 1WKMA 3PKEA 2BWYA 4FLIA 2GGCA 3PEBA 3FMQA 1XGMA 2BHCA 4QR8A 1W7VA 2BWTA 3L24A 3QOCA 4ZWUA 1QZYA 4IKSA 4IKUA 2EVMA 1KQ9A 5CDEA 1A16A 2BWUA 4Z7MA 2BWWA 4ZWPA 2Q92A 4JUQA 4U76A 4RGZ1 4ZWOA 1WLRA 1WL9A 3MATA 2GU6A 2OAZA 1XGSA 4IKTA 3FMRA 2EVCA 3TB5A 1R5GA 2BWVA 4IPAA 2P99A 1C24A 4FO8A 4U71A 3PN9A 4FLKA 4PNCA 4IKRA 2MATA 1O0XA 2EA2A 4IECA 3Q6DA 1YW7A 2DFIA 5D6FA 3CB5A 3CTZA 4FLJA 3PKDA 3BIPA 5JFRA 3I7MA 2V3ZA 2V6CA 2GTXA 2Q94A 4S2RP 2GG5A 1WL6A 2HOWA 3BITA 3S6BA 2B3LA 2Q93A 2GG7A 5FCFA 5JI6A 2OKNA 3BIQA 2BHDA 2GZ5A 2BN7A 4MATA 2Q95A 2NQ7A 2BHAA 3OOOA 2BWSA 2ZSGA 3FM3A 1R5HA 4FUKA 4EGEA 4ZNGA 4U6WA 1KP0A 2GGBA 1XNZA 4FLLA 4HXXA 4A6VA 2BWXA 5CDLA 2Q8KA 5CDVA 2GG9A 1KQ0A 4RZYA 1YVMA 2GU5A 3IG4A 4U73A 1YW9A 3PKCA 2GU7A 2GG2A 3D27A 4S2TP 2BH3A 1R58A 4IU6A 2V3XA 1YW8A 2P9AA 3IU8A 1QXWA 4IF7A 4A6WA 4U75A 3IU9A 5CNXA 4B28A
chains in the Genus database with same CATH topology
2GA2A 1M35A 4RZZA 5E2CA 4U1BA 3PKAA 1C27A 2GG0A 1Y1NA 2Q96A 4U6JA 3MX6A 4U6CA 2GG3A 1QXZA 1XGNA 4U69A 4U70A 3RORA 1WN1A 1C21A 3TAVA 1PV9A 3MR1A 1MATA 1BN5A 2B3HA 5D6EA 4U6ZA 4S01A 1BOAA 1C22A 2BHBA 1WBQA 5E5BA 4IDYA 1JAWA 1N51A 5CLSA 1QXYA 4R60A 4S00A 2B3KA 2EVOA 4FO7A 1WY2A 4FKCA 3CB6A 2IW2A 5FCHA 3IU7A 4KM3A 5CE6A 3IL0A 1B6AA 5JHUA 2G6PA 2EA4A 2P98A 3PKBA 2V3YA 5CIKA 1XGOA 1B59A 3L7GA 1W2MA 3OVKA 2ADUA 1YJ3A 2BB7A 4U6EA 2GU4A 3RVAA 1CHMA 1C23A 2GG8A 3O5VA 2NQ6A 4OOKA 4PV4A 1WKMA 3PKEA 2BWYA 4FLIA 2GGCA 3PEBA 3FMQA 1XGMA 2BHCA 4QR8A 1W7VA 2BWTA 3L24A 3QOCA 4ZWUA 1QZYA 4IKSA 4IKUA 2EVMA 1KQ9A 5CDEA 1A16A 2BWUA 4Z7MA 2BWWA 4ZWPA 2Q92A 4JUQA 4U76A 4RGZ1 4ZWOA 1WLRA 1WL9A 3MATA 2GU6A 2OAZA 1XGSA 4IKTA 3FMRA 2EVCA 3TB5A 1R5GA 2BWVA 4IPAA 2P99A 1C24A 4FO8A 4U71A 3PN9A 4FLKA 4PNCA 4IKRA 2MATA 1O0XA 2EA2A 4IECA 3Q6DA 1YW7A 2DFIA 5D6FA 3CB5A 3CTZA 4FLJA 3PKDA 3BIPA 5JFRA 3I7MA 2V3ZA 2V6CA 2GTXA 2Q94A 4S2RP 2GG5A 1WL6A 2HOWA 3BITA 3S6BA 2B3LA 2Q93A 2GG7A 5FCFA 5JI6A 2OKNA 3BIQA 2BHDA 2GZ5A 2BN7A 4MATA 2Q95A 2NQ7A 2BHAA 3OOOA 2BWSA 2ZSGA 3FM3A 1R5HA 4FUKA 4EGEA 4ZNGA 4U6WA 1KP0A 2GGBA 1XNZA 4FLLA 4HXXA 4A6VA 2BWXA 5CDLA 2Q8KA 5CDVA 2GG9A 1KQ0A 4RZYA 1YVMA 2GU5A 3IG4A 4U73A 1YW9A 3PKCA 2GU7A 2GG2A 3D27A 4S2TP 2BH3A 1R58A 4IU6A 2V3XA 1YW8A 2P9AA 3IU8A 1QXWA 4IF7A 4A6WA 4U75A 3IU9A 5CNXA 4B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA2 A;  1M35 A;  4RZZ A;  5E2C A;  4U1B A;  3PKA A;  1C27 A;  2GG0 A;  1Y1N A;  2Q96 A;  4U6J A;  3MX6 A;  4U6C A;  2GG3 A;  1QXZ A;  1XGN A;  4U69 A;  4U70 A;  3ROR A;  1WN1 A;  1C21 A;  3TAV A;  1PV9 A;  3MR1 A;  1MAT A;  1BN5 A;  2B3H A;  5D6E A;  4U6Z A;  4S01 A;  1BOA A;  1C22 A;  2BHB A;  1WBQ A;  5E5B A;  4IDY A;  1JAW A;  1N51 A;  5CLS A;  1QXY A;  4R60 A;  4S00 A;  2B3K A;  2EVO A;  4FO7 A;  1WY2 A;  4FKC A;  3CB6 A;  2IW2 A;  5FCH A;  3IU7 A;  4KM3 A;  5CE6 A;  3IL0 A;  1B6A A;  5JHU A;  2G6P A;  2EA4 A;  2P98 A;  3PKB A;  2V3Y A;  5CIK A;  1XGO A;  1B59 A;  3L7G A;  1W2M A;  3OVK A;  2ADU A;  1YJ3 A;  2BB7 A;  4U6E A;  2GU4 A;  3RVA A;  1CHM A;  1C23 A;  2GG8 A;  3O5V A;  2NQ6 A;  4OOK A;  4PV4 A;  1WKM A;  3PKE A;  2BWY A;  4FLI A;  2GGC A;  3PEB A;  3FMQ A;  1XGM A;  2BHC A;  4QR8 A;  1W7V A;  2BWT A;  3L24 A;  3QOC A;  4ZWU A;  1QZY A;  4IKS A;  4IKU A;  2EVM A;  1KQ9 A;  5CDE A;  1A16 A;  2BWU A;  4Z7M A;  2BWW A;  4ZWP A;  2Q92 A;  4JUQ A;  4U76 A;  4RGZ 1;  4ZWO A;  1WLR A;  1WL9 A;  3MAT A;  2GU6 A;  2OAZ A;  1XGS A;  4IKT A;  3FMR A;  2EVC A;  3TB5 A;  1R5G A;  2BWV A;  4IPA A;  2P99 A;  1C24 A;  4FO8 A;  4U71 A;  3PN9 A;  4FLK A;  4PNC A;  4IKR A;  2MAT A;  1O0X A;  2EA2 A;  4IEC A;  3Q6D A;  1YW7 A;  2DFI A;  5D6F A;  3CB5 A;  3CTZ A;  4FLJ A;  3PKD A;  3BIP A;  5JFR A;  3I7M A;  2V3Z A;  2V6C A;  2GTX A;  2Q94 A;  4S2R P;  2GG5 A;  1WL6 A;  2HOW A;  3BIT A;  3S6B A;  2B3L A;  2Q93 A;  2GG7 A;  5FCF A;  5JI6 A;  2OKN A;  3BIQ A;  2BHD A;  2GZ5 A;  2BN7 A;  4MAT A;  2Q95 A;  2NQ7 A;  2BHA A;  3OOO A;  2BWS A;  2ZSG A;  3FM3 A;  1R5H A;  4FUK A;  4EGE A;  4ZNG A;  4U6W A;  1KP0 A;  2GGB A;  1XNZ A;  4FLL A;  4HXX A;  4A6V A;  2BWX A;  5CDL A;  2Q8K A;  5CDV A;  2GG9 A;  1KQ0 A;  4RZY A;  1YVM A;  2GU5 A;  3IG4 A;  4U73 A;  1YW9 A;  3PKC A;  2GU7 A;  2GG2 A;  3D27 A;  4S2T P;  2BH3 A;  1R58 A;  4IU6 A;  2V3X A;  1YW8 A;  2P9A A;  3IU8 A;  1QXW A;  4IF7 A;  4A6W A;  4U75 A;  3IU9 A;  5CNX A;  4B28 A; 
#chains in the Genus database with same CATH topology
 2GA2 A;  1M35 A;  4RZZ A;  5E2C A;  4U1B A;  3PKA A;  1C27 A;  2GG0 A;  1Y1N A;  2Q96 A;  4U6J A;  3MX6 A;  4U6C A;  2GG3 A;  1QXZ A;  1XGN A;  4U69 A;  4U70 A;  3ROR A;  1WN1 A;  1C21 A;  3TAV A;  1PV9 A;  3MR1 A;  1MAT A;  1BN5 A;  2B3H A;  5D6E A;  4U6Z A;  4S01 A;  1BOA A;  1C22 A;  2BHB A;  1WBQ A;  5E5B A;  4IDY A;  1JAW A;  1N51 A;  5CLS A;  1QXY A;  4R60 A;  4S00 A;  2B3K A;  2EVO A;  4FO7 A;  1WY2 A;  4FKC A;  3CB6 A;  2IW2 A;  5FCH A;  3IU7 A;  4KM3 A;  5CE6 A;  3IL0 A;  1B6A A;  5JHU A;  2G6P A;  2EA4 A;  2P98 A;  3PKB A;  2V3Y A;  5CIK A;  1XGO A;  1B59 A;  3L7G A;  1W2M A;  3OVK A;  2ADU A;  1YJ3 A;  2BB7 A;  4U6E A;  2GU4 A;  3RVA A;  1CHM A;  1C23 A;  2GG8 A;  3O5V A;  2NQ6 A;  4OOK A;  4PV4 A;  1WKM A;  3PKE A;  2BWY A;  4FLI A;  2GGC A;  3PEB A;  3FMQ A;  1XGM A;  2BHC A;  4QR8 A;  1W7V A;  2BWT A;  3L24 A;  3QOC A;  4ZWU A;  1QZY A;  4IKS A;  4IKU A;  2EVM A;  1KQ9 A;  5CDE A;  1A16 A;  2BWU A;  4Z7M A;  2BWW A;  4ZWP A;  2Q92 A;  4JUQ A;  4U76 A;  4RGZ 1;  4ZWO A;  1WLR A;  1WL9 A;  3MAT A;  2GU6 A;  2OAZ A;  1XGS A;  4IKT A;  3FMR A;  2EVC A;  3TB5 A;  1R5G A;  2BWV A;  4IPA A;  2P99 A;  1C24 A;  4FO8 A;  4U71 A;  3PN9 A;  4FLK A;  4PNC A;  4IKR A;  2MAT A;  1O0X A;  2EA2 A;  4IEC A;  3Q6D A;  1YW7 A;  2DFI A;  5D6F A;  3CB5 A;  3CTZ A;  4FLJ A;  3PKD A;  3BIP A;  5JFR A;  3I7M A;  2V3Z A;  2V6C A;  2GTX A;  2Q94 A;  4S2R P;  2GG5 A;  1WL6 A;  2HOW A;  3BIT A;  3S6B A;  2B3L A;  2Q93 A;  2GG7 A;  5FCF A;  5JI6 A;  2OKN A;  3BIQ A;  2BHD A;  2GZ5 A;  2BN7 A;  4MAT A;  2Q95 A;  2NQ7 A;  2BHA A;  3OOO A;  2BWS A;  2ZSG A;  3FM3 A;  1R5H A;  4FUK A;  4EGE A;  4ZNG A;  4U6W A;  1KP0 A;  2GGB A;  1XNZ A;  4FLL A;  4HXX A;  4A6V A;  2BWX A;  5CDL A;  2Q8K A;  5CDV A;  2GG9 A;  1KQ0 A;  4RZY A;  1YVM A;  2GU5 A;  3IG4 A;  4U73 A;  1YW9 A;  3PKC A;  2GU7 A;  2GG2 A;  3D27 A;  4S2T P;  2BH3 A;  1R58 A;  4IU6 A;  2V3X A;  1YW8 A;  2P9A A;  3IU8 A;  1QXW A;  4IF7 A;  4A6W A;  4U75 A;  3IU9 A;  5CNX A;  4B28 A; 
#chains in the Genus database with same CATH homology
 2GA2 A;  1M35 A;  4RZZ A;  5E2C A;  4U1B A;  3PKA A;  1C27 A;  2GG0 A;  1Y1N A;  2Q96 A;  4U6J A;  3MX6 A;  4U6C A;  2GG3 A;  1QXZ A;  1XGN A;  4U69 A;  4U70 A;  3ROR A;  1WN1 A;  1C21 A;  3TAV A;  1PV9 A;  3MR1 A;  1MAT A;  1BN5 A;  2B3H A;  5D6E A;  4U6Z A;  4S01 A;  1BOA A;  1C22 A;  2BHB A;  1WBQ A;  5E5B A;  4IDY A;  1JAW A;  1N51 A;  5CLS A;  1QXY A;  4R60 A;  4S00 A;  2B3K A;  2EVO A;  4FO7 A;  1WY2 A;  4FKC A;  3CB6 A;  2IW2 A;  5FCH A;  3IU7 A;  4KM3 A;  5CE6 A;  3IL0 A;  1B6A A;  5JHU A;  2G6P A;  2EA4 A;  2P98 A;  3PKB A;  2V3Y A;  5CIK A;  1XGO A;  1B59 A;  3L7G A;  1W2M A;  3OVK A;  2ADU A;  1YJ3 A;  2BB7 A;  4U6E A;  2GU4 A;  3RVA A;  1CHM A;  1C23 A;  2GG8 A;  3O5V A;  2NQ6 A;  4OOK A;  4PV4 A;  1WKM A;  3PKE A;  2BWY A;  4FLI A;  2GGC A;  3PEB A;  3FMQ A;  1XGM A;  2BHC A;  4QR8 A;  1W7V A;  2BWT A;  3L24 A;  3QOC A;  4ZWU A;  1QZY A;  4IKS A;  4IKU A;  2EVM A;  1KQ9 A;  5CDE A;  1A16 A;  2BWU A;  4Z7M A;  2BWW A;  4ZWP A;  2Q92 A;  4JUQ A;  4U76 A;  4RGZ 1;  4ZWO A;  1WLR A;  1WL9 A;  3MAT A;  2GU6 A;  2OAZ A;  1XGS A;  4IKT A;  3FMR A;  2EVC A;  3TB5 A;  1R5G A;  2BWV A;  4IPA A;  2P99 A;  1C24 A;  4FO8 A;  4U71 A;  3PN9 A;  4FLK A;  4PNC A;  4IKR A;  2MAT A;  1O0X A;  2EA2 A;  4IEC A;  3Q6D A;  1YW7 A;  2DFI A;  5D6F A;  3CB5 A;  3CTZ A;  4FLJ A;  3PKD A;  3BIP A;  5JFR A;  3I7M A;  2V3Z A;  2V6C A;  2GTX A;  2Q94 A;  4S2R P;  2GG5 A;  1WL6 A;  2HOW A;  3BIT A;  3S6B A;  2B3L A;  2Q93 A;  2GG7 A;  5FCF A;  5JI6 A;  2OKN A;  3BIQ A;  2BHD A;  2GZ5 A;  2BN7 A;  4MAT A;  2Q95 A;  2NQ7 A;  2BHA A;  3OOO A;  2BWS A;  2ZSG A;  3FM3 A;  1R5H A;  4FUK A;  4EGE A;  4ZNG A;  4U6W A;  1KP0 A;  2GGB A;  1XNZ A;  4FLL A;  4HXX A;  4A6V A;  2BWX A;  5CDL A;  2Q8K A;  5CDV A;  2GG9 A;  1KQ0 A;  4RZY A;  1YVM A;  2GU5 A;  3IG4 A;  4U73 A;  1YW9 A;  3PKC A;  2GU7 A;  2GG2 A;  3D27 A;  4S2T P;  2BH3 A;  1R58 A;  4IU6 A;  2V3X A;  1YW8 A;  2P9A A;  3IU8 A;  1QXW A;  4IF7 A;  4A6W A;  4U75 A;  3IU9 A;  5CNX A;  4B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...