2BWSA

His243ala escherichia coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILAYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE P
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwsA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwsA02
2GGBA 4U73A 4MATA 5CIKA 2HOWA 1WN1A 2GTXA 1WBQA 3FM3A 4ZWUA 5CDLA 2B3LA 3L7GA 4RZYA 2GG2A 2IW2A 1JAWA 2MATA 1YVMA 2EA4A 2NQ6A 2GG5A 4ZWOA 3IG4A 4U76A 4IDYA 1BOAA 2OAZA 3IU8A 3D27A 2G6PA 2BWWA 2GA2A 4PV4A 2GZ5A 1B6AA 2GU5A 2V6CA 2BN7A 5E5BA 1N51A 3FMRA 4IPAA 3RORA 2BWXA 3S6BA 4Z7MA 2NQ7A 2P98A 3BIQA 4JUQA 4U71A 2P9AA 2OKNA 4HXXA 2P99A 1WLRA 3OOOA 2GU7A 2EA2A 1C22A 1WL6A 5JFRA 2V3XA 5CDVA 3PKDA 3TB5A 4QR8A 3FMQA 2BH3A 5FCHA 1YW7A 2BHBA 3OVKA 4S01A 1XGSA 2BHCA 2EVMA 3PKAA 5CE6A 2GG7A 4IU6A 4U6EA 3RVAA 4FLIA 4RGZ1 2V3ZA 4U6CA 2BWUA 1O0XA 3PKEA 5D6FA 2BWYA 4IKUA 1C21A 1W2MA 1W7VA 1A16A 2BHDA 4U6WA 2DFIA 4KM3A 1R5HA 2GU6A 1PV9A 5CNXA 3IL0A 2EVOA 2V3YA 3O5VA 2B3KA 4U69A 2Q94A 4EGEA 4IECA 3QOCA 4U6ZA 2GGCA 1C24A 4FLJA 2Q93A 1M35A 3L24A 1CHMA 4ZNGA 2Q92A 1YJ3A 3CB6A 5D6EA 4RZZA 5CDEA 3MX6A 2Q96A 4PNCA 4S00A 2BWVA 2Q95A 2BHAA 4U70A 1YW8A 4U75A 5CLSA 1QXYA 1XNZA 2GG3A 2Q8KA 3IU7A 3BIPA 4B28A 3IU9A 2GG0A 4U1BA 4FKCA 4U6JA 1QZYA 1BN5A 2GU4A 1QXZA 2BWSA 1KQ0A 4IKRA 4A6WA 3CB5A 2ZSGA 1MATA 4FLLA 4OOKA 3PN9A 3CTZA 4FLKA 4S2TP 4IKTA 1QXWA 2B3HA 3I7MA 4FO8A 1KQ9A 4ZWPA 5E2CA 5FCFA 2BWTA 3TAVA 2ADUA 4A6VA 3PKCA 1WKMA 4R60A 4IKSA 1WL9A 1WY2A 3Q6DA 2GG9A 4FUKA 1YW9A 1C27A 5JI6A 1KP0A 2BB7A 3MATA 3BITA 3MR1A 5JHUA 4S2RP 1XGMA 2GG8A 2EVCA 1R5GA 1Y1NA 1B59A 4FO7A 1R58A 3PEBA 3PKBA 1C23A 4IF7A 1XGOA 1XGNA
chains in the Genus database with same CATH superfamily
2GGBA 4U73A 4MATA 5CIKA 2HOWA 1WN1A 2GTXA 1WBQA 3FM3A 4ZWUA 5CDLA 2B3LA 3L7GA 4RZYA 2GG2A 2IW2A 1JAWA 2MATA 1YVMA 2EA4A 2NQ6A 2GG5A 4ZWOA 3IG4A 4U76A 4IDYA 1BOAA 2OAZA 3IU8A 3D27A 2G6PA 2BWWA 2GA2A 4PV4A 2GZ5A 1B6AA 2GU5A 2V6CA 2BN7A 5E5BA 1N51A 3FMRA 4IPAA 3RORA 2BWXA 3S6BA 4Z7MA 2NQ7A 2P98A 3BIQA 4JUQA 4U71A 2P9AA 2OKNA 4HXXA 2P99A 1WLRA 3OOOA 2GU7A 2EA2A 1C22A 1WL6A 5JFRA 2V3XA 5CDVA 3PKDA 3TB5A 4QR8A 3FMQA 2BH3A 5FCHA 1YW7A 2BHBA 3OVKA 4S01A 1XGSA 2BHCA 2EVMA 3PKAA 5CE6A 2GG7A 4IU6A 4U6EA 3RVAA 4FLIA 4RGZ1 2V3ZA 4U6CA 2BWUA 1O0XA 3PKEA 5D6FA 2BWYA 4IKUA 1C21A 1W2MA 1W7VA 1A16A 2BHDA 4U6WA 2DFIA 4KM3A 1R5HA 2GU6A 1PV9A 5CNXA 3IL0A 2EVOA 2V3YA 3O5VA 2B3KA 4U69A 2Q94A 4EGEA 4IECA 3QOCA 4U6ZA 2GGCA 1C24A 4FLJA 2Q93A 1M35A 3L24A 1CHMA 4ZNGA 2Q92A 1YJ3A 3CB6A 5D6EA 4RZZA 5CDEA 3MX6A 2Q96A 4PNCA 4S00A 2BWVA 2Q95A 2BHAA 4U70A 1YW8A 4U75A 5CLSA 1QXYA 1XNZA 2GG3A 2Q8KA 3IU7A 3BIPA 4B28A 3IU9A 2GG0A 4U1BA 4FKCA 4U6JA 1QZYA 1BN5A 2GU4A 1QXZA 2BWSA 1KQ0A 4IKRA 4A6WA 3CB5A 2ZSGA 1MATA 4FLLA 4OOKA 3PN9A 3CTZA 4FLKA 4S2TP 4IKTA 1QXWA 2B3HA 3I7MA 4FO8A 1KQ9A 4ZWPA 5E2CA 5FCFA 2BWTA 3TAVA 2ADUA 4A6VA 3PKCA 1WKMA 4R60A 4IKSA 1WL9A 1WY2A 3Q6DA 2GG9A 4FUKA 1YW9A 1C27A 5JI6A 1KP0A 2BB7A 3MATA 3BITA 3MR1A 5JHUA 4S2RP 1XGMA 2GG8A 2EVCA 1R5GA 1Y1NA 1B59A 4FO7A 1R58A 3PEBA 3PKBA 1C23A 4IF7A 1XGOA 1XGNA
chains in the Genus database with same CATH topology
2GGBA 4U73A 4MATA 5CIKA 2HOWA 1WN1A 2GTXA 1WBQA 3FM3A 4ZWUA 5CDLA 2B3LA 3L7GA 4RZYA 2GG2A 2IW2A 1JAWA 2MATA 1YVMA 2EA4A 2NQ6A 2GG5A 4ZWOA 3IG4A 4U76A 4IDYA 1BOAA 2OAZA 3IU8A 3D27A 2G6PA 2BWWA 2GA2A 4PV4A 2GZ5A 1B6AA 2GU5A 2V6CA 2BN7A 5E5BA 1N51A 3FMRA 4IPAA 3RORA 2BWXA 3S6BA 4Z7MA 2NQ7A 2P98A 3BIQA 4JUQA 4U71A 2P9AA 2OKNA 4HXXA 2P99A 1WLRA 3OOOA 2GU7A 2EA2A 1C22A 1WL6A 5JFRA 2V3XA 5CDVA 3PKDA 3TB5A 4QR8A 3FMQA 2BH3A 5FCHA 1YW7A 2BHBA 3OVKA 4S01A 1XGSA 2BHCA 2EVMA 3PKAA 5CE6A 2GG7A 4IU6A 4U6EA 3RVAA 4FLIA 4RGZ1 2V3ZA 4U6CA 2BWUA 1O0XA 3PKEA 5D6FA 2BWYA 4IKUA 1C21A 1W2MA 1W7VA 1A16A 2BHDA 4U6WA 2DFIA 4KM3A 1R5HA 2GU6A 1PV9A 5CNXA 3IL0A 2EVOA 2V3YA 3O5VA 2B3KA 4U69A 2Q94A 4EGEA 4IECA 3QOCA 4U6ZA 2GGCA 1C24A 4FLJA 2Q93A 1M35A 3L24A 1CHMA 4ZNGA 2Q92A 1YJ3A 3CB6A 5D6EA 4RZZA 5CDEA 3MX6A 2Q96A 4PNCA 4S00A 2BWVA 2Q95A 2BHAA 4U70A 1YW8A 4U75A 5CLSA 1QXYA 1XNZA 2GG3A 2Q8KA 3IU7A 3BIPA 4B28A 3IU9A 2GG0A 4U1BA 4FKCA 4U6JA 1QZYA 1BN5A 2GU4A 1QXZA 2BWSA 1KQ0A 4IKRA 4A6WA 3CB5A 2ZSGA 1MATA 4FLLA 4OOKA 3PN9A 3CTZA 4FLKA 4S2TP 4IKTA 1QXWA 2B3HA 3I7MA 4FO8A 1KQ9A 4ZWPA 5E2CA 5FCFA 2BWTA 3TAVA 2ADUA 4A6VA 3PKCA 1WKMA 4R60A 4IKSA 1WL9A 1WY2A 3Q6DA 2GG9A 4FUKA 1YW9A 1C27A 5JI6A 1KP0A 2BB7A 3MATA 3BITA 3MR1A 5JHUA 4S2RP 1XGMA 2GG8A 2EVCA 1R5GA 1Y1NA 1B59A 4FO7A 1R58A 3PEBA 3PKBA 1C23A 4IF7A 1XGOA 1XGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GGB A;  4U73 A;  4MAT A;  5CIK A;  2HOW A;  1WN1 A;  2GTX A;  1WBQ A;  3FM3 A;  4ZWU A;  5CDL A;  2B3L A;  3L7G A;  4RZY A;  2GG2 A;  2IW2 A;  1JAW A;  2MAT A;  1YVM A;  2EA4 A;  2NQ6 A;  2GG5 A;  4ZWO A;  3IG4 A;  4U76 A;  4IDY A;  1BOA A;  2OAZ A;  3IU8 A;  3D27 A;  2G6P A;  2BWW A;  2GA2 A;  4PV4 A;  2GZ5 A;  1B6A A;  2GU5 A;  2V6C A;  2BN7 A;  5E5B A;  1N51 A;  3FMR A;  4IPA A;  3ROR A;  2BWX A;  3S6B A;  4Z7M A;  2NQ7 A;  2P98 A;  3BIQ A;  4JUQ A;  4U71 A;  2P9A A;  2OKN A;  4HXX A;  2P99 A;  1WLR A;  3OOO A;  2GU7 A;  2EA2 A;  1C22 A;  1WL6 A;  5JFR A;  2V3X A;  5CDV A;  3PKD A;  3TB5 A;  4QR8 A;  3FMQ A;  2BH3 A;  5FCH A;  1YW7 A;  2BHB A;  3OVK A;  4S01 A;  1XGS A;  2BHC A;  2EVM A;  3PKA A;  5CE6 A;  2GG7 A;  4IU6 A;  4U6E A;  3RVA A;  4FLI A;  4RGZ 1;  2V3Z A;  4U6C A;  2BWU A;  1O0X A;  3PKE A;  5D6F A;  2BWY A;  4IKU A;  1C21 A;  1W2M A;  1W7V A;  1A16 A;  2BHD A;  4U6W A;  2DFI A;  4KM3 A;  1R5H A;  2GU6 A;  1PV9 A;  5CNX A;  3IL0 A;  2EVO A;  2V3Y A;  3O5V A;  2B3K A;  4U69 A;  2Q94 A;  4EGE A;  4IEC A;  3QOC A;  4U6Z A;  2GGC A;  1C24 A;  4FLJ A;  2Q93 A;  1M35 A;  3L24 A;  1CHM A;  4ZNG A;  2Q92 A;  1YJ3 A;  3CB6 A;  5D6E A;  4RZZ A;  5CDE A;  3MX6 A;  2Q96 A;  4PNC A;  4S00 A;  2BWV A;  2Q95 A;  2BHA A;  4U70 A;  1YW8 A;  4U75 A;  5CLS A;  1QXY A;  1XNZ A;  2GG3 A;  2Q8K A;  3IU7 A;  3BIP A;  4B28 A;  3IU9 A;  2GG0 A;  4U1B A;  4FKC A;  4U6J A;  1QZY A;  1BN5 A;  2GU4 A;  1QXZ A;  2BWS A;  1KQ0 A;  4IKR A;  4A6W A;  3CB5 A;  2ZSG A;  1MAT A;  4FLL A;  4OOK A;  3PN9 A;  3CTZ A;  4FLK A;  4S2T P;  4IKT A;  1QXW A;  2B3H A;  3I7M A;  4FO8 A;  1KQ9 A;  4ZWP A;  5E2C A;  5FCF A;  2BWT A;  3TAV A;  2ADU A;  4A6V A;  3PKC A;  1WKM A;  4R60 A;  4IKS A;  1WL9 A;  1WY2 A;  3Q6D A;  2GG9 A;  4FUK A;  1YW9 A;  1C27 A;  5JI6 A;  1KP0 A;  2BB7 A;  3MAT A;  3BIT A;  3MR1 A;  5JHU A;  4S2R P;  1XGM A;  2GG8 A;  2EVC A;  1R5G A;  1Y1N A;  1B59 A;  4FO7 A;  1R58 A;  3PEB A;  3PKB A;  1C23 A;  4IF7 A;  1XGO A;  1XGN A; 
#chains in the Genus database with same CATH topology
 2GGB A;  4U73 A;  4MAT A;  5CIK A;  2HOW A;  1WN1 A;  2GTX A;  1WBQ A;  3FM3 A;  4ZWU A;  5CDL A;  2B3L A;  3L7G A;  4RZY A;  2GG2 A;  2IW2 A;  1JAW A;  2MAT A;  1YVM A;  2EA4 A;  2NQ6 A;  2GG5 A;  4ZWO A;  3IG4 A;  4U76 A;  4IDY A;  1BOA A;  2OAZ A;  3IU8 A;  3D27 A;  2G6P A;  2BWW A;  2GA2 A;  4PV4 A;  2GZ5 A;  1B6A A;  2GU5 A;  2V6C A;  2BN7 A;  5E5B A;  1N51 A;  3FMR A;  4IPA A;  3ROR A;  2BWX A;  3S6B A;  4Z7M A;  2NQ7 A;  2P98 A;  3BIQ A;  4JUQ A;  4U71 A;  2P9A A;  2OKN A;  4HXX A;  2P99 A;  1WLR A;  3OOO A;  2GU7 A;  2EA2 A;  1C22 A;  1WL6 A;  5JFR A;  2V3X A;  5CDV A;  3PKD A;  3TB5 A;  4QR8 A;  3FMQ A;  2BH3 A;  5FCH A;  1YW7 A;  2BHB A;  3OVK A;  4S01 A;  1XGS A;  2BHC A;  2EVM A;  3PKA A;  5CE6 A;  2GG7 A;  4IU6 A;  4U6E A;  3RVA A;  4FLI A;  4RGZ 1;  2V3Z A;  4U6C A;  2BWU A;  1O0X A;  3PKE A;  5D6F A;  2BWY A;  4IKU A;  1C21 A;  1W2M A;  1W7V A;  1A16 A;  2BHD A;  4U6W A;  2DFI A;  4KM3 A;  1R5H A;  2GU6 A;  1PV9 A;  5CNX A;  3IL0 A;  2EVO A;  2V3Y A;  3O5V A;  2B3K A;  4U69 A;  2Q94 A;  4EGE A;  4IEC A;  3QOC A;  4U6Z A;  2GGC A;  1C24 A;  4FLJ A;  2Q93 A;  1M35 A;  3L24 A;  1CHM A;  4ZNG A;  2Q92 A;  1YJ3 A;  3CB6 A;  5D6E A;  4RZZ A;  5CDE A;  3MX6 A;  2Q96 A;  4PNC A;  4S00 A;  2BWV A;  2Q95 A;  2BHA A;  4U70 A;  1YW8 A;  4U75 A;  5CLS A;  1QXY A;  1XNZ A;  2GG3 A;  2Q8K A;  3IU7 A;  3BIP A;  4B28 A;  3IU9 A;  2GG0 A;  4U1B A;  4FKC A;  4U6J A;  1QZY A;  1BN5 A;  2GU4 A;  1QXZ A;  2BWS A;  1KQ0 A;  4IKR A;  4A6W A;  3CB5 A;  2ZSG A;  1MAT A;  4FLL A;  4OOK A;  3PN9 A;  3CTZ A;  4FLK A;  4S2T P;  4IKT A;  1QXW A;  2B3H A;  3I7M A;  4FO8 A;  1KQ9 A;  4ZWP A;  5E2C A;  5FCF A;  2BWT A;  3TAV A;  2ADU A;  4A6V A;  3PKC A;  1WKM A;  4R60 A;  4IKS A;  1WL9 A;  1WY2 A;  3Q6D A;  2GG9 A;  4FUK A;  1YW9 A;  1C27 A;  5JI6 A;  1KP0 A;  2BB7 A;  3MAT A;  3BIT A;  3MR1 A;  5JHU A;  4S2R P;  1XGM A;  2GG8 A;  2EVC A;  1R5G A;  1Y1N A;  1B59 A;  4FO7 A;  1R58 A;  3PEB A;  3PKB A;  1C23 A;  4IF7 A;  1XGO A;  1XGN A; 
#chains in the Genus database with same CATH homology
 2GGB A;  4U73 A;  4MAT A;  5CIK A;  2HOW A;  1WN1 A;  2GTX A;  1WBQ A;  3FM3 A;  4ZWU A;  5CDL A;  2B3L A;  3L7G A;  4RZY A;  2GG2 A;  2IW2 A;  1JAW A;  2MAT A;  1YVM A;  2EA4 A;  2NQ6 A;  2GG5 A;  4ZWO A;  3IG4 A;  4U76 A;  4IDY A;  1BOA A;  2OAZ A;  3IU8 A;  3D27 A;  2G6P A;  2BWW A;  2GA2 A;  4PV4 A;  2GZ5 A;  1B6A A;  2GU5 A;  2V6C A;  2BN7 A;  5E5B A;  1N51 A;  3FMR A;  4IPA A;  3ROR A;  2BWX A;  3S6B A;  4Z7M A;  2NQ7 A;  2P98 A;  3BIQ A;  4JUQ A;  4U71 A;  2P9A A;  2OKN A;  4HXX A;  2P99 A;  1WLR A;  3OOO A;  2GU7 A;  2EA2 A;  1C22 A;  1WL6 A;  5JFR A;  2V3X A;  5CDV A;  3PKD A;  3TB5 A;  4QR8 A;  3FMQ A;  2BH3 A;  5FCH A;  1YW7 A;  2BHB A;  3OVK A;  4S01 A;  1XGS A;  2BHC A;  2EVM A;  3PKA A;  5CE6 A;  2GG7 A;  4IU6 A;  4U6E A;  3RVA A;  4FLI A;  4RGZ 1;  2V3Z A;  4U6C A;  2BWU A;  1O0X A;  3PKE A;  5D6F A;  2BWY A;  4IKU A;  1C21 A;  1W2M A;  1W7V A;  1A16 A;  2BHD A;  4U6W A;  2DFI A;  4KM3 A;  1R5H A;  2GU6 A;  1PV9 A;  5CNX A;  3IL0 A;  2EVO A;  2V3Y A;  3O5V A;  2B3K A;  4U69 A;  2Q94 A;  4EGE A;  4IEC A;  3QOC A;  4U6Z A;  2GGC A;  1C24 A;  4FLJ A;  2Q93 A;  1M35 A;  3L24 A;  1CHM A;  4ZNG A;  2Q92 A;  1YJ3 A;  3CB6 A;  5D6E A;  4RZZ A;  5CDE A;  3MX6 A;  2Q96 A;  4PNC A;  4S00 A;  2BWV A;  2Q95 A;  2BHA A;  4U70 A;  1YW8 A;  4U75 A;  5CLS A;  1QXY A;  1XNZ A;  2GG3 A;  2Q8K A;  3IU7 A;  3BIP A;  4B28 A;  3IU9 A;  2GG0 A;  4U1B A;  4FKC A;  4U6J A;  1QZY A;  1BN5 A;  2GU4 A;  1QXZ A;  2BWS A;  1KQ0 A;  4IKR A;  4A6W A;  3CB5 A;  2ZSG A;  1MAT A;  4FLL A;  4OOK A;  3PN9 A;  3CTZ A;  4FLK A;  4S2T P;  4IKT A;  1QXW A;  2B3H A;  3I7M A;  4FO8 A;  1KQ9 A;  4ZWP A;  5E2C A;  5FCF A;  2BWT A;  3TAV A;  2ADU A;  4A6V A;  3PKC A;  1WKM A;  4R60 A;  4IKS A;  1WL9 A;  1WY2 A;  3Q6D A;  2GG9 A;  4FUK A;  1YW9 A;  1C27 A;  5JI6 A;  1KP0 A;  2BB7 A;  3MAT A;  3BIT A;  3MR1 A;  5JHU A;  4S2R P;  1XGM A;  2GG8 A;  2EVC A;  1R5G A;  1Y1N A;  1B59 A;  4FO7 A;  1R58 A;  3PEB A;  3PKB A;  1C23 A;  4IF7 A;  1XGO A;  1XGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...