2BWSA

His243ala escherichia coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILAYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE P
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwsA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwsA02
1W2MA 4U1BA 4IKTA 2BHAA 1BOAA 1Y1NA 3PKCA 4U6EA 2Q94A 1QXWA 4ZWPA 2BHBA 2P99A 2Q95A 5E5BA 2B3LA 3CB6A 4S2RP 1XNZA 1KP0A 3MATA 4U70A 4EGEA 2EA2A 2EVMA 1XGMA 2ZSGA 2V6CA 2V3ZA 4PV4A 3L24A 4A6WA 2BWUA 1YW9A 2GU4A 5JFRA 1WL6A 3FMQA 4IDYA 2EVOA 1WKMA 5CIKA 3PKDA 3Q6DA 3CB5A 5CDEA 3TAVA 1QZYA 1JAWA 2IW2A 4FO8A 4U75A 3QOCA 1XGNA 3BITA 4U6JA 3O5VA 2BN7A 3MX6A 4IKSA 4MATA 2BWXA 3IU7A 4A6VA 2B3HA 2GGCA 3MR1A 3IL0A 1A16A 4S00A 2P98A 2BH3A 5FCHA 2GG2A 4RZZA 2Q8KA 4FLIA 1QXZA 1YVMA 2BWTA 3OOOA 4U73A 2GU7A 2Q96A 2BHDA 3TB5A 1KQ0A 1YW8A 4FLLA 1XGSA 4PNCA 3PEBA 4OOKA 5JI6A 1N51A 3PKBA 4FLJA 1QXYA 2GG5A 1WY2A 2GG9A 1YJ3A 4FUKA 3PKEA 3IG4A 1C27A 3L7GA 3D27A 1PV9A 2GG0A 4IU6A 4ZNGA 1C24A 4IKRA 4FLKA 2GU6A 1C23A 3IU9A 2BWVA 4Z7MA 3OVKA 2ADUA 3RVAA 2NQ7A 2EA4A 2MATA 4QR8A 2GTXA 1WBQA 1WN1A 2GGBA 1R58A 2OAZA 5CDLA 4U69A 4IPAA 4FO7A 4RGZ1 4IF7A 3BIQA 5JHUA 4U6CA 2NQ6A 3RORA 1KQ9A 5D6FA 1O0XA 2P9AA 3S6BA 2GG3A 5CDVA 4S01A 3PN9A 4R60A 2GU5A 1YW7A 2HOWA 3CTZA 1M35A 1C21A 2GG8A 3FM3A 1R5GA 2BB7A 5CNXA 1R5HA 4FKCA 4U76A 4U6WA 2B3KA 4B28A 1BN5A 1MATA 1W7VA 2G6PA 2GZ5A 2V3YA 2DFIA 2BHCA 1B6AA 4IKUA 4HXXA 4JUQA 2BWSA 3PKAA 4ZWOA 2BWYA 2OKNA 2GA2A 2EVCA 4KM3A 2BWWA 3I7MA 4S2TP 2GG7A 3IU8A 5D6EA 5E2CA 2Q92A 2V3XA 2Q93A 1C22A 3BIPA 5CE6A 4RZYA 1XGOA 4U71A 5CLSA 4ZWUA 4U6ZA 3FMRA 5FCFA 1CHMA 1WL9A 4IECA 1B59A 1WLRA
chains in the Genus database with same CATH superfamily
1W2MA 4U1BA 4IKTA 2BHAA 1BOAA 1Y1NA 3PKCA 4U6EA 2Q94A 1QXWA 4ZWPA 2BHBA 2P99A 2Q95A 5E5BA 2B3LA 3CB6A 4S2RP 1XNZA 1KP0A 3MATA 4U70A 4EGEA 2EA2A 2EVMA 1XGMA 2ZSGA 2V6CA 2V3ZA 4PV4A 3L24A 4A6WA 2BWUA 1YW9A 2GU4A 5JFRA 1WL6A 3FMQA 4IDYA 2EVOA 1WKMA 5CIKA 3PKDA 3Q6DA 3CB5A 5CDEA 3TAVA 1QZYA 1JAWA 2IW2A 4FO8A 4U75A 3QOCA 1XGNA 3BITA 4U6JA 3O5VA 2BN7A 3MX6A 4IKSA 4MATA 2BWXA 3IU7A 4A6VA 2B3HA 2GGCA 3MR1A 3IL0A 1A16A 4S00A 2P98A 2BH3A 5FCHA 2GG2A 4RZZA 2Q8KA 4FLIA 1QXZA 1YVMA 2BWTA 3OOOA 4U73A 2GU7A 2Q96A 2BHDA 3TB5A 1KQ0A 1YW8A 4FLLA 1XGSA 4PNCA 3PEBA 4OOKA 5JI6A 1N51A 3PKBA 4FLJA 1QXYA 2GG5A 1WY2A 2GG9A 1YJ3A 4FUKA 3PKEA 3IG4A 1C27A 3L7GA 3D27A 1PV9A 2GG0A 4IU6A 4ZNGA 1C24A 4IKRA 4FLKA 2GU6A 1C23A 3IU9A 2BWVA 4Z7MA 3OVKA 2ADUA 3RVAA 2NQ7A 2EA4A 2MATA 4QR8A 2GTXA 1WBQA 1WN1A 2GGBA 1R58A 2OAZA 5CDLA 4U69A 4IPAA 4FO7A 4RGZ1 4IF7A 3BIQA 5JHUA 4U6CA 2NQ6A 3RORA 1KQ9A 5D6FA 1O0XA 2P9AA 3S6BA 2GG3A 5CDVA 4S01A 3PN9A 4R60A 2GU5A 1YW7A 2HOWA 3CTZA 1M35A 1C21A 2GG8A 3FM3A 1R5GA 2BB7A 5CNXA 1R5HA 4FKCA 4U76A 4U6WA 2B3KA 4B28A 1BN5A 1MATA 1W7VA 2G6PA 2GZ5A 2V3YA 2DFIA 2BHCA 1B6AA 4IKUA 4HXXA 4JUQA 2BWSA 3PKAA 4ZWOA 2BWYA 2OKNA 2GA2A 2EVCA 4KM3A 2BWWA 3I7MA 4S2TP 2GG7A 3IU8A 5D6EA 5E2CA 2Q92A 2V3XA 2Q93A 1C22A 3BIPA 5CE6A 4RZYA 1XGOA 4U71A 5CLSA 4ZWUA 4U6ZA 3FMRA 5FCFA 1CHMA 1WL9A 4IECA 1B59A 1WLRA
chains in the Genus database with same CATH topology
1W2MA 4U1BA 4IKTA 2BHAA 1BOAA 1Y1NA 3PKCA 4U6EA 2Q94A 1QXWA 4ZWPA 2BHBA 2P99A 2Q95A 5E5BA 2B3LA 3CB6A 4S2RP 1XNZA 1KP0A 3MATA 4U70A 4EGEA 2EA2A 2EVMA 1XGMA 2ZSGA 2V6CA 2V3ZA 4PV4A 3L24A 4A6WA 2BWUA 1YW9A 2GU4A 5JFRA 1WL6A 3FMQA 4IDYA 2EVOA 1WKMA 5CIKA 3PKDA 3Q6DA 3CB5A 5CDEA 3TAVA 1QZYA 1JAWA 2IW2A 4FO8A 4U75A 3QOCA 1XGNA 3BITA 4U6JA 3O5VA 2BN7A 3MX6A 4IKSA 4MATA 2BWXA 3IU7A 4A6VA 2B3HA 2GGCA 3MR1A 3IL0A 1A16A 4S00A 2P98A 2BH3A 5FCHA 2GG2A 4RZZA 2Q8KA 4FLIA 1QXZA 1YVMA 2BWTA 3OOOA 4U73A 2GU7A 2Q96A 2BHDA 3TB5A 1KQ0A 1YW8A 4FLLA 1XGSA 4PNCA 3PEBA 4OOKA 5JI6A 1N51A 3PKBA 4FLJA 1QXYA 2GG5A 1WY2A 2GG9A 1YJ3A 4FUKA 3PKEA 3IG4A 1C27A 3L7GA 3D27A 1PV9A 2GG0A 4IU6A 4ZNGA 1C24A 4IKRA 4FLKA 2GU6A 1C23A 3IU9A 2BWVA 4Z7MA 3OVKA 2ADUA 3RVAA 2NQ7A 2EA4A 2MATA 4QR8A 2GTXA 1WBQA 1WN1A 2GGBA 1R58A 2OAZA 5CDLA 4U69A 4IPAA 4FO7A 4RGZ1 4IF7A 3BIQA 5JHUA 4U6CA 2NQ6A 3RORA 1KQ9A 5D6FA 1O0XA 2P9AA 3S6BA 2GG3A 5CDVA 4S01A 3PN9A 4R60A 2GU5A 1YW7A 2HOWA 3CTZA 1M35A 1C21A 2GG8A 3FM3A 1R5GA 2BB7A 5CNXA 1R5HA 4FKCA 4U76A 4U6WA 2B3KA 4B28A 1BN5A 1MATA 1W7VA 2G6PA 2GZ5A 2V3YA 2DFIA 2BHCA 1B6AA 4IKUA 4HXXA 4JUQA 2BWSA 3PKAA 4ZWOA 2BWYA 2OKNA 2GA2A 2EVCA 4KM3A 2BWWA 3I7MA 4S2TP 2GG7A 3IU8A 5D6EA 5E2CA 2Q92A 2V3XA 2Q93A 1C22A 3BIPA 5CE6A 4RZYA 1XGOA 4U71A 5CLSA 4ZWUA 4U6ZA 3FMRA 5FCFA 1CHMA 1WL9A 4IECA 1B59A 1WLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2M A;  4U1B A;  4IKT A;  2BHA A;  1BOA A;  1Y1N A;  3PKC A;  4U6E A;  2Q94 A;  1QXW A;  4ZWP A;  2BHB A;  2P99 A;  2Q95 A;  5E5B A;  2B3L A;  3CB6 A;  4S2R P;  1XNZ A;  1KP0 A;  3MAT A;  4U70 A;  4EGE A;  2EA2 A;  2EVM A;  1XGM A;  2ZSG A;  2V6C A;  2V3Z A;  4PV4 A;  3L24 A;  4A6W A;  2BWU A;  1YW9 A;  2GU4 A;  5JFR A;  1WL6 A;  3FMQ A;  4IDY A;  2EVO A;  1WKM A;  5CIK A;  3PKD A;  3Q6D A;  3CB5 A;  5CDE A;  3TAV A;  1QZY A;  1JAW A;  2IW2 A;  4FO8 A;  4U75 A;  3QOC A;  1XGN A;  3BIT A;  4U6J A;  3O5V A;  2BN7 A;  3MX6 A;  4IKS A;  4MAT A;  2BWX A;  3IU7 A;  4A6V A;  2B3H A;  2GGC A;  3MR1 A;  3IL0 A;  1A16 A;  4S00 A;  2P98 A;  2BH3 A;  5FCH A;  2GG2 A;  4RZZ A;  2Q8K A;  4FLI A;  1QXZ A;  1YVM A;  2BWT A;  3OOO A;  4U73 A;  2GU7 A;  2Q96 A;  2BHD A;  3TB5 A;  1KQ0 A;  1YW8 A;  4FLL A;  1XGS A;  4PNC A;  3PEB A;  4OOK A;  5JI6 A;  1N51 A;  3PKB A;  4FLJ A;  1QXY A;  2GG5 A;  1WY2 A;  2GG9 A;  1YJ3 A;  4FUK A;  3PKE A;  3IG4 A;  1C27 A;  3L7G A;  3D27 A;  1PV9 A;  2GG0 A;  4IU6 A;  4ZNG A;  1C24 A;  4IKR A;  4FLK A;  2GU6 A;  1C23 A;  3IU9 A;  2BWV A;  4Z7M A;  3OVK A;  2ADU A;  3RVA A;  2NQ7 A;  2EA4 A;  2MAT A;  4QR8 A;  2GTX A;  1WBQ A;  1WN1 A;  2GGB A;  1R58 A;  2OAZ A;  5CDL A;  4U69 A;  4IPA A;  4FO7 A;  4RGZ 1;  4IF7 A;  3BIQ A;  5JHU A;  4U6C A;  2NQ6 A;  3ROR A;  1KQ9 A;  5D6F A;  1O0X A;  2P9A A;  3S6B A;  2GG3 A;  5CDV A;  4S01 A;  3PN9 A;  4R60 A;  2GU5 A;  1YW7 A;  2HOW A;  3CTZ A;  1M35 A;  1C21 A;  2GG8 A;  3FM3 A;  1R5G A;  2BB7 A;  5CNX A;  1R5H A;  4FKC A;  4U76 A;  4U6W A;  2B3K A;  4B28 A;  1BN5 A;  1MAT A;  1W7V A;  2G6P A;  2GZ5 A;  2V3Y A;  2DFI A;  2BHC A;  1B6A A;  4IKU A;  4HXX A;  4JUQ A;  2BWS A;  3PKA A;  4ZWO A;  2BWY A;  2OKN A;  2GA2 A;  2EVC A;  4KM3 A;  2BWW A;  3I7M A;  4S2T P;  2GG7 A;  3IU8 A;  5D6E A;  5E2C A;  2Q92 A;  2V3X A;  2Q93 A;  1C22 A;  3BIP A;  5CE6 A;  4RZY A;  1XGO A;  4U71 A;  5CLS A;  4ZWU A;  4U6Z A;  3FMR A;  5FCF A;  1CHM A;  1WL9 A;  4IEC A;  1B59 A;  1WLR A; 
#chains in the Genus database with same CATH topology
 1W2M A;  4U1B A;  4IKT A;  2BHA A;  1BOA A;  1Y1N A;  3PKC A;  4U6E A;  2Q94 A;  1QXW A;  4ZWP A;  2BHB A;  2P99 A;  2Q95 A;  5E5B A;  2B3L A;  3CB6 A;  4S2R P;  1XNZ A;  1KP0 A;  3MAT A;  4U70 A;  4EGE A;  2EA2 A;  2EVM A;  1XGM A;  2ZSG A;  2V6C A;  2V3Z A;  4PV4 A;  3L24 A;  4A6W A;  2BWU A;  1YW9 A;  2GU4 A;  5JFR A;  1WL6 A;  3FMQ A;  4IDY A;  2EVO A;  1WKM A;  5CIK A;  3PKD A;  3Q6D A;  3CB5 A;  5CDE A;  3TAV A;  1QZY A;  1JAW A;  2IW2 A;  4FO8 A;  4U75 A;  3QOC A;  1XGN A;  3BIT A;  4U6J A;  3O5V A;  2BN7 A;  3MX6 A;  4IKS A;  4MAT A;  2BWX A;  3IU7 A;  4A6V A;  2B3H A;  2GGC A;  3MR1 A;  3IL0 A;  1A16 A;  4S00 A;  2P98 A;  2BH3 A;  5FCH A;  2GG2 A;  4RZZ A;  2Q8K A;  4FLI A;  1QXZ A;  1YVM A;  2BWT A;  3OOO A;  4U73 A;  2GU7 A;  2Q96 A;  2BHD A;  3TB5 A;  1KQ0 A;  1YW8 A;  4FLL A;  1XGS A;  4PNC A;  3PEB A;  4OOK A;  5JI6 A;  1N51 A;  3PKB A;  4FLJ A;  1QXY A;  2GG5 A;  1WY2 A;  2GG9 A;  1YJ3 A;  4FUK A;  3PKE A;  3IG4 A;  1C27 A;  3L7G A;  3D27 A;  1PV9 A;  2GG0 A;  4IU6 A;  4ZNG A;  1C24 A;  4IKR A;  4FLK A;  2GU6 A;  1C23 A;  3IU9 A;  2BWV A;  4Z7M A;  3OVK A;  2ADU A;  3RVA A;  2NQ7 A;  2EA4 A;  2MAT A;  4QR8 A;  2GTX A;  1WBQ A;  1WN1 A;  2GGB A;  1R58 A;  2OAZ A;  5CDL A;  4U69 A;  4IPA A;  4FO7 A;  4RGZ 1;  4IF7 A;  3BIQ A;  5JHU A;  4U6C A;  2NQ6 A;  3ROR A;  1KQ9 A;  5D6F A;  1O0X A;  2P9A A;  3S6B A;  2GG3 A;  5CDV A;  4S01 A;  3PN9 A;  4R60 A;  2GU5 A;  1YW7 A;  2HOW A;  3CTZ A;  1M35 A;  1C21 A;  2GG8 A;  3FM3 A;  1R5G A;  2BB7 A;  5CNX A;  1R5H A;  4FKC A;  4U76 A;  4U6W A;  2B3K A;  4B28 A;  1BN5 A;  1MAT A;  1W7V A;  2G6P A;  2GZ5 A;  2V3Y A;  2DFI A;  2BHC A;  1B6A A;  4IKU A;  4HXX A;  4JUQ A;  2BWS A;  3PKA A;  4ZWO A;  2BWY A;  2OKN A;  2GA2 A;  2EVC A;  4KM3 A;  2BWW A;  3I7M A;  4S2T P;  2GG7 A;  3IU8 A;  5D6E A;  5E2C A;  2Q92 A;  2V3X A;  2Q93 A;  1C22 A;  3BIP A;  5CE6 A;  4RZY A;  1XGO A;  4U71 A;  5CLS A;  4ZWU A;  4U6Z A;  3FMR A;  5FCF A;  1CHM A;  1WL9 A;  4IEC A;  1B59 A;  1WLR A; 
#chains in the Genus database with same CATH homology
 1W2M A;  4U1B A;  4IKT A;  2BHA A;  1BOA A;  1Y1N A;  3PKC A;  4U6E A;  2Q94 A;  1QXW A;  4ZWP A;  2BHB A;  2P99 A;  2Q95 A;  5E5B A;  2B3L A;  3CB6 A;  4S2R P;  1XNZ A;  1KP0 A;  3MAT A;  4U70 A;  4EGE A;  2EA2 A;  2EVM A;  1XGM A;  2ZSG A;  2V6C A;  2V3Z A;  4PV4 A;  3L24 A;  4A6W A;  2BWU A;  1YW9 A;  2GU4 A;  5JFR A;  1WL6 A;  3FMQ A;  4IDY A;  2EVO A;  1WKM A;  5CIK A;  3PKD A;  3Q6D A;  3CB5 A;  5CDE A;  3TAV A;  1QZY A;  1JAW A;  2IW2 A;  4FO8 A;  4U75 A;  3QOC A;  1XGN A;  3BIT A;  4U6J A;  3O5V A;  2BN7 A;  3MX6 A;  4IKS A;  4MAT A;  2BWX A;  3IU7 A;  4A6V A;  2B3H A;  2GGC A;  3MR1 A;  3IL0 A;  1A16 A;  4S00 A;  2P98 A;  2BH3 A;  5FCH A;  2GG2 A;  4RZZ A;  2Q8K A;  4FLI A;  1QXZ A;  1YVM A;  2BWT A;  3OOO A;  4U73 A;  2GU7 A;  2Q96 A;  2BHD A;  3TB5 A;  1KQ0 A;  1YW8 A;  4FLL A;  1XGS A;  4PNC A;  3PEB A;  4OOK A;  5JI6 A;  1N51 A;  3PKB A;  4FLJ A;  1QXY A;  2GG5 A;  1WY2 A;  2GG9 A;  1YJ3 A;  4FUK A;  3PKE A;  3IG4 A;  1C27 A;  3L7G A;  3D27 A;  1PV9 A;  2GG0 A;  4IU6 A;  4ZNG A;  1C24 A;  4IKR A;  4FLK A;  2GU6 A;  1C23 A;  3IU9 A;  2BWV A;  4Z7M A;  3OVK A;  2ADU A;  3RVA A;  2NQ7 A;  2EA4 A;  2MAT A;  4QR8 A;  2GTX A;  1WBQ A;  1WN1 A;  2GGB A;  1R58 A;  2OAZ A;  5CDL A;  4U69 A;  4IPA A;  4FO7 A;  4RGZ 1;  4IF7 A;  3BIQ A;  5JHU A;  4U6C A;  2NQ6 A;  3ROR A;  1KQ9 A;  5D6F A;  1O0X A;  2P9A A;  3S6B A;  2GG3 A;  5CDV A;  4S01 A;  3PN9 A;  4R60 A;  2GU5 A;  1YW7 A;  2HOW A;  3CTZ A;  1M35 A;  1C21 A;  2GG8 A;  3FM3 A;  1R5G A;  2BB7 A;  5CNX A;  1R5H A;  4FKC A;  4U76 A;  4U6W A;  2B3K A;  4B28 A;  1BN5 A;  1MAT A;  1W7V A;  2G6P A;  2GZ5 A;  2V3Y A;  2DFI A;  2BHC A;  1B6A A;  4IKU A;  4HXX A;  4JUQ A;  2BWS A;  3PKA A;  4ZWO A;  2BWY A;  2OKN A;  2GA2 A;  2EVC A;  4KM3 A;  2BWW A;  3I7M A;  4S2T P;  2GG7 A;  3IU8 A;  5D6E A;  5E2C A;  2Q92 A;  2V3X A;  2Q93 A;  1C22 A;  3BIP A;  5CE6 A;  4RZY A;  1XGO A;  4U71 A;  5CLS A;  4ZWU A;  4U6Z A;  3FMR A;  5FCF A;  1CHM A;  1WL9 A;  4IEC A;  1B59 A;  1WLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...