2BWSA

His243ala escherichia coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
b'SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILAYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE P
molecule tags Hydrolase
source organism Escherichia coli
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwsA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwsA02
1CHMA 2V3YA 2GG0A 3S6BA 2V6CA 4U71A 5FCHA 4FLLA 4U70A 2BHDA 5E2CA 4FO7A 5JHUA 3L24A 4FLKA 1O0XA 4FUKA 4IU6A 5JI6A 2V3XA 3MR1A 1WLRA 3CB6A 2B3LA 4U6ZA 4Z7MA 4U6WA 2BHBA 2GGCA 1QZYA 1XGNA 4IF7A 2NQ6A 2NQ7A 1YW9A 4IECA 1QXYA 1JAWA 3MATA 1KQ9A 4OOKA 5CE6A 3O5VA 2P9AA 4IKTA 4U6EA 2BWVA 4EGEA 1B59A 4FKCA 2BN7A 3PKCA 5E5BA 2GG5A 2BWYA 1QXWA 2GG7A 1YJ3A 3IL0A 1R5HA 3BIPA 3IG4A 4S01A 5CIKA 3MX6A 4U75A 1B6AA 2Q8KA 2BH3A 4IDYA 1KP0A 2V3ZA 1C23A 3PKEA 1A16A 2GU4A 4RZZA 2GG9A 2BB7A 4U6JA 3RORA 3OOOA 3PKBA 5CDEA 3BIQA 5FCFA 2GA2A 2EVCA 3PEBA 3CB5A 4MATA 2GG3A 1WL6A 3OVKA 4IPAA 1Y1NA 3I7MA 4IKRA 1WBQA 4IKSA 3FMQA 2OKNA 1W2MA 4KM3A 1C21A 3PN9A 3QOCA 2G6PA 3D27A 3TAVA 3RVAA 3PKAA 3IU8A 4RGZ1 4QR8A 3L7GA 1BN5A 2DFIA 1XGMA 2EA4A 4FO8A 1YVMA 1WN1A 1R5GA 2MATA 4ZWPA 3IU9A 1N51A 4PNCA 5JFRA 2BWSA 2BHCA 1XNZA 5CDLA 3TB5A 5CNXA 1QXZA 1W7VA 4U6CA 2BWWA 4ZWOA 3BITA 2Q94A 2EVOA 4PV4A 2ADUA 2BWUA 4RZYA 2IW2A 2GU5A 3Q6DA 4ZNGA 2Q93A 4A6WA 1XGOA 4A6VA 2HOWA 4ZWUA 2B3KA 2GU7A 2GU6A 1YW7A 1WL9A 1XGSA 1WY2A 4IKUA 2GGBA 1KQ0A 5D6EA 4S2TP 4S2RP 2BWXA 1WKMA 2GG2A 1C24A 2P99A 5CDVA 2GTXA 2Q95A 4HXXA 2BHAA 1BOAA 2EA2A 2ZSGA 3CTZA 2GZ5A 3PKDA 4U1BA 3IU7A 4S00A 4B28A 2OAZA 2BWTA 1C27A 4FLJA 1R58A 1C22A 2B3HA 4FLIA 5D6FA 2GG8A 2P98A 3FM3A 1PV9A 1M35A 5CLSA 4U73A 1MATA 3FMRA 2EVMA 4U76A 4U69A 4JUQA 2Q92A 4R60A 2Q96A 1YW8A
chains in the Genus database with same CATH superfamily
1CHMA 2V3YA 2GG0A 3S6BA 2V6CA 4U71A 5FCHA 4FLLA 4U70A 2BHDA 5E2CA 4FO7A 5JHUA 3L24A 4FLKA 1O0XA 4FUKA 4IU6A 5JI6A 2V3XA 3MR1A 1WLRA 3CB6A 2B3LA 4U6ZA 4Z7MA 4U6WA 2BHBA 2GGCA 1QZYA 1XGNA 4IF7A 2NQ6A 2NQ7A 1YW9A 4IECA 1QXYA 1JAWA 3MATA 1KQ9A 4OOKA 5CE6A 3O5VA 2P9AA 4IKTA 4U6EA 2BWVA 4EGEA 1B59A 4FKCA 2BN7A 3PKCA 5E5BA 2GG5A 2BWYA 1QXWA 2GG7A 1YJ3A 3IL0A 1R5HA 3BIPA 3IG4A 4S01A 5CIKA 3MX6A 4U75A 1B6AA 2Q8KA 2BH3A 4IDYA 1KP0A 2V3ZA 1C23A 3PKEA 1A16A 2GU4A 4RZZA 2GG9A 2BB7A 4U6JA 3RORA 3OOOA 3PKBA 5CDEA 3BIQA 5FCFA 2GA2A 2EVCA 3PEBA 3CB5A 4MATA 2GG3A 1WL6A 3OVKA 4IPAA 1Y1NA 3I7MA 4IKRA 1WBQA 4IKSA 3FMQA 2OKNA 1W2MA 4KM3A 1C21A 3PN9A 3QOCA 2G6PA 3D27A 3TAVA 3RVAA 3PKAA 3IU8A 4RGZ1 4QR8A 3L7GA 1BN5A 2DFIA 1XGMA 2EA4A 4FO8A 1YVMA 1WN1A 1R5GA 2MATA 4ZWPA 3IU9A 1N51A 4PNCA 5JFRA 2BWSA 2BHCA 1XNZA 5CDLA 3TB5A 5CNXA 1QXZA 1W7VA 4U6CA 2BWWA 4ZWOA 3BITA 2Q94A 2EVOA 4PV4A 2ADUA 2BWUA 4RZYA 2IW2A 2GU5A 3Q6DA 4ZNGA 2Q93A 4A6WA 1XGOA 4A6VA 2HOWA 4ZWUA 2B3KA 2GU7A 2GU6A 1YW7A 1WL9A 1XGSA 1WY2A 4IKUA 2GGBA 1KQ0A 5D6EA 4S2TP 4S2RP 2BWXA 1WKMA 2GG2A 1C24A 2P99A 5CDVA 2GTXA 2Q95A 4HXXA 2BHAA 1BOAA 2EA2A 2ZSGA 3CTZA 2GZ5A 3PKDA 4U1BA 3IU7A 4S00A 4B28A 2OAZA 2BWTA 1C27A 4FLJA 1R58A 1C22A 2B3HA 4FLIA 5D6FA 2GG8A 2P98A 3FM3A 1PV9A 1M35A 5CLSA 4U73A 1MATA 3FMRA 2EVMA 4U76A 4U69A 4JUQA 2Q92A 4R60A 2Q96A 1YW8A
chains in the Genus database with same CATH topology
1CHMA 2V3YA 2GG0A 3S6BA 2V6CA 4U71A 5FCHA 4FLLA 4U70A 2BHDA 5E2CA 4FO7A 5JHUA 3L24A 4FLKA 1O0XA 4FUKA 4IU6A 5JI6A 2V3XA 3MR1A 1WLRA 3CB6A 2B3LA 4U6ZA 4Z7MA 4U6WA 2BHBA 2GGCA 1QZYA 1XGNA 4IF7A 2NQ6A 2NQ7A 1YW9A 4IECA 1QXYA 1JAWA 3MATA 1KQ9A 4OOKA 5CE6A 3O5VA 2P9AA 4IKTA 4U6EA 2BWVA 4EGEA 1B59A 4FKCA 2BN7A 3PKCA 5E5BA 2GG5A 2BWYA 1QXWA 2GG7A 1YJ3A 3IL0A 1R5HA 3BIPA 3IG4A 4S01A 5CIKA 3MX6A 4U75A 1B6AA 2Q8KA 2BH3A 4IDYA 1KP0A 2V3ZA 1C23A 3PKEA 1A16A 2GU4A 4RZZA 2GG9A 2BB7A 4U6JA 3RORA 3OOOA 3PKBA 5CDEA 3BIQA 5FCFA 2GA2A 2EVCA 3PEBA 3CB5A 4MATA 2GG3A 1WL6A 3OVKA 4IPAA 1Y1NA 3I7MA 4IKRA 1WBQA 4IKSA 3FMQA 2OKNA 1W2MA 4KM3A 1C21A 3PN9A 3QOCA 2G6PA 3D27A 3TAVA 3RVAA 3PKAA 3IU8A 4RGZ1 4QR8A 3L7GA 1BN5A 2DFIA 1XGMA 2EA4A 4FO8A 1YVMA 1WN1A 1R5GA 2MATA 4ZWPA 3IU9A 1N51A 4PNCA 5JFRA 2BWSA 2BHCA 1XNZA 5CDLA 3TB5A 5CNXA 1QXZA 1W7VA 4U6CA 2BWWA 4ZWOA 3BITA 2Q94A 2EVOA 4PV4A 2ADUA 2BWUA 4RZYA 2IW2A 2GU5A 3Q6DA 4ZNGA 2Q93A 4A6WA 1XGOA 4A6VA 2HOWA 4ZWUA 2B3KA 2GU7A 2GU6A 1YW7A 1WL9A 1XGSA 1WY2A 4IKUA 2GGBA 1KQ0A 5D6EA 4S2TP 4S2RP 2BWXA 1WKMA 2GG2A 1C24A 2P99A 5CDVA 2GTXA 2Q95A 4HXXA 2BHAA 1BOAA 2EA2A 2ZSGA 3CTZA 2GZ5A 3PKDA 4U1BA 3IU7A 4S00A 4B28A 2OAZA 2BWTA 1C27A 4FLJA 1R58A 1C22A 2B3HA 4FLIA 5D6FA 2GG8A 2P98A 3FM3A 1PV9A 1M35A 5CLSA 4U73A 1MATA 3FMRA 2EVMA 4U76A 4U69A 4JUQA 2Q92A 4R60A 2Q96A 1YW8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CHM A;  2V3Y A;  2GG0 A;  3S6B A;  2V6C A;  4U71 A;  5FCH A;  4FLL A;  4U70 A;  2BHD A;  5E2C A;  4FO7 A;  5JHU A;  3L24 A;  4FLK A;  1O0X A;  4FUK A;  4IU6 A;  5JI6 A;  2V3X A;  3MR1 A;  1WLR A;  3CB6 A;  2B3L A;  4U6Z A;  4Z7M A;  4U6W A;  2BHB A;  2GGC A;  1QZY A;  1XGN A;  4IF7 A;  2NQ6 A;  2NQ7 A;  1YW9 A;  4IEC A;  1QXY A;  1JAW A;  3MAT A;  1KQ9 A;  4OOK A;  5CE6 A;  3O5V A;  2P9A A;  4IKT A;  4U6E A;  2BWV A;  4EGE A;  1B59 A;  4FKC A;  2BN7 A;  3PKC A;  5E5B A;  2GG5 A;  2BWY A;  1QXW A;  2GG7 A;  1YJ3 A;  3IL0 A;  1R5H A;  3BIP A;  3IG4 A;  4S01 A;  5CIK A;  3MX6 A;  4U75 A;  1B6A A;  2Q8K A;  2BH3 A;  4IDY A;  1KP0 A;  2V3Z A;  1C23 A;  3PKE A;  1A16 A;  2GU4 A;  4RZZ A;  2GG9 A;  2BB7 A;  4U6J A;  3ROR A;  3OOO A;  3PKB A;  5CDE A;  3BIQ A;  5FCF A;  2GA2 A;  2EVC A;  3PEB A;  3CB5 A;  4MAT A;  2GG3 A;  1WL6 A;  3OVK A;  4IPA A;  1Y1N A;  3I7M A;  4IKR A;  1WBQ A;  4IKS A;  3FMQ A;  2OKN A;  1W2M A;  4KM3 A;  1C21 A;  3PN9 A;  3QOC A;  2G6P A;  3D27 A;  3TAV A;  3RVA A;  3PKA A;  3IU8 A;  4RGZ 1;  4QR8 A;  3L7G A;  1BN5 A;  2DFI A;  1XGM A;  2EA4 A;  4FO8 A;  1YVM A;  1WN1 A;  1R5G A;  2MAT A;  4ZWP A;  3IU9 A;  1N51 A;  4PNC A;  5JFR A;  2BWS A;  2BHC A;  1XNZ A;  5CDL A;  3TB5 A;  5CNX A;  1QXZ A;  1W7V A;  4U6C A;  2BWW A;  4ZWO A;  3BIT A;  2Q94 A;  2EVO A;  4PV4 A;  2ADU A;  2BWU A;  4RZY A;  2IW2 A;  2GU5 A;  3Q6D A;  4ZNG A;  2Q93 A;  4A6W A;  1XGO A;  4A6V A;  2HOW A;  4ZWU A;  2B3K A;  2GU7 A;  2GU6 A;  1YW7 A;  1WL9 A;  1XGS A;  1WY2 A;  4IKU A;  2GGB A;  1KQ0 A;  5D6E A;  4S2T P;  4S2R P;  2BWX A;  1WKM A;  2GG2 A;  1C24 A;  2P99 A;  5CDV A;  2GTX A;  2Q95 A;  4HXX A;  2BHA A;  1BOA A;  2EA2 A;  2ZSG A;  3CTZ A;  2GZ5 A;  3PKD A;  4U1B A;  3IU7 A;  4S00 A;  4B28 A;  2OAZ A;  2BWT A;  1C27 A;  4FLJ A;  1R58 A;  1C22 A;  2B3H A;  4FLI A;  5D6F A;  2GG8 A;  2P98 A;  3FM3 A;  1PV9 A;  1M35 A;  5CLS A;  4U73 A;  1MAT A;  3FMR A;  2EVM A;  4U76 A;  4U69 A;  4JUQ A;  2Q92 A;  4R60 A;  2Q96 A;  1YW8 A; 
#chains in the Genus database with same CATH topology
 1CHM A;  2V3Y A;  2GG0 A;  3S6B A;  2V6C A;  4U71 A;  5FCH A;  4FLL A;  4U70 A;  2BHD A;  5E2C A;  4FO7 A;  5JHU A;  3L24 A;  4FLK A;  1O0X A;  4FUK A;  4IU6 A;  5JI6 A;  2V3X A;  3MR1 A;  1WLR A;  3CB6 A;  2B3L A;  4U6Z A;  4Z7M A;  4U6W A;  2BHB A;  2GGC A;  1QZY A;  1XGN A;  4IF7 A;  2NQ6 A;  2NQ7 A;  1YW9 A;  4IEC A;  1QXY A;  1JAW A;  3MAT A;  1KQ9 A;  4OOK A;  5CE6 A;  3O5V A;  2P9A A;  4IKT A;  4U6E A;  2BWV A;  4EGE A;  1B59 A;  4FKC A;  2BN7 A;  3PKC A;  5E5B A;  2GG5 A;  2BWY A;  1QXW A;  2GG7 A;  1YJ3 A;  3IL0 A;  1R5H A;  3BIP A;  3IG4 A;  4S01 A;  5CIK A;  3MX6 A;  4U75 A;  1B6A A;  2Q8K A;  2BH3 A;  4IDY A;  1KP0 A;  2V3Z A;  1C23 A;  3PKE A;  1A16 A;  2GU4 A;  4RZZ A;  2GG9 A;  2BB7 A;  4U6J A;  3ROR A;  3OOO A;  3PKB A;  5CDE A;  3BIQ A;  5FCF A;  2GA2 A;  2EVC A;  3PEB A;  3CB5 A;  4MAT A;  2GG3 A;  1WL6 A;  3OVK A;  4IPA A;  1Y1N A;  3I7M A;  4IKR A;  1WBQ A;  4IKS A;  3FMQ A;  2OKN A;  1W2M A;  4KM3 A;  1C21 A;  3PN9 A;  3QOC A;  2G6P A;  3D27 A;  3TAV A;  3RVA A;  3PKA A;  3IU8 A;  4RGZ 1;  4QR8 A;  3L7G A;  1BN5 A;  2DFI A;  1XGM A;  2EA4 A;  4FO8 A;  1YVM A;  1WN1 A;  1R5G A;  2MAT A;  4ZWP A;  3IU9 A;  1N51 A;  4PNC A;  5JFR A;  2BWS A;  2BHC A;  1XNZ A;  5CDL A;  3TB5 A;  5CNX A;  1QXZ A;  1W7V A;  4U6C A;  2BWW A;  4ZWO A;  3BIT A;  2Q94 A;  2EVO A;  4PV4 A;  2ADU A;  2BWU A;  4RZY A;  2IW2 A;  2GU5 A;  3Q6D A;  4ZNG A;  2Q93 A;  4A6W A;  1XGO A;  4A6V A;  2HOW A;  4ZWU A;  2B3K A;  2GU7 A;  2GU6 A;  1YW7 A;  1WL9 A;  1XGS A;  1WY2 A;  4IKU A;  2GGB A;  1KQ0 A;  5D6E A;  4S2T P;  4S2R P;  2BWX A;  1WKM A;  2GG2 A;  1C24 A;  2P99 A;  5CDV A;  2GTX A;  2Q95 A;  4HXX A;  2BHA A;  1BOA A;  2EA2 A;  2ZSG A;  3CTZ A;  2GZ5 A;  3PKD A;  4U1B A;  3IU7 A;  4S00 A;  4B28 A;  2OAZ A;  2BWT A;  1C27 A;  4FLJ A;  1R58 A;  1C22 A;  2B3H A;  4FLI A;  5D6F A;  2GG8 A;  2P98 A;  3FM3 A;  1PV9 A;  1M35 A;  5CLS A;  4U73 A;  1MAT A;  3FMR A;  2EVM A;  4U76 A;  4U69 A;  4JUQ A;  2Q92 A;  4R60 A;  2Q96 A;  1YW8 A; 
#chains in the Genus database with same CATH homology
 1CHM A;  2V3Y A;  2GG0 A;  3S6B A;  2V6C A;  4U71 A;  5FCH A;  4FLL A;  4U70 A;  2BHD A;  5E2C A;  4FO7 A;  5JHU A;  3L24 A;  4FLK A;  1O0X A;  4FUK A;  4IU6 A;  5JI6 A;  2V3X A;  3MR1 A;  1WLR A;  3CB6 A;  2B3L A;  4U6Z A;  4Z7M A;  4U6W A;  2BHB A;  2GGC A;  1QZY A;  1XGN A;  4IF7 A;  2NQ6 A;  2NQ7 A;  1YW9 A;  4IEC A;  1QXY A;  1JAW A;  3MAT A;  1KQ9 A;  4OOK A;  5CE6 A;  3O5V A;  2P9A A;  4IKT A;  4U6E A;  2BWV A;  4EGE A;  1B59 A;  4FKC A;  2BN7 A;  3PKC A;  5E5B A;  2GG5 A;  2BWY A;  1QXW A;  2GG7 A;  1YJ3 A;  3IL0 A;  1R5H A;  3BIP A;  3IG4 A;  4S01 A;  5CIK A;  3MX6 A;  4U75 A;  1B6A A;  2Q8K A;  2BH3 A;  4IDY A;  1KP0 A;  2V3Z A;  1C23 A;  3PKE A;  1A16 A;  2GU4 A;  4RZZ A;  2GG9 A;  2BB7 A;  4U6J A;  3ROR A;  3OOO A;  3PKB A;  5CDE A;  3BIQ A;  5FCF A;  2GA2 A;  2EVC A;  3PEB A;  3CB5 A;  4MAT A;  2GG3 A;  1WL6 A;  3OVK A;  4IPA A;  1Y1N A;  3I7M A;  4IKR A;  1WBQ A;  4IKS A;  3FMQ A;  2OKN A;  1W2M A;  4KM3 A;  1C21 A;  3PN9 A;  3QOC A;  2G6P A;  3D27 A;  3TAV A;  3RVA A;  3PKA A;  3IU8 A;  4RGZ 1;  4QR8 A;  3L7G A;  1BN5 A;  2DFI A;  1XGM A;  2EA4 A;  4FO8 A;  1YVM A;  1WN1 A;  1R5G A;  2MAT A;  4ZWP A;  3IU9 A;  1N51 A;  4PNC A;  5JFR A;  2BWS A;  2BHC A;  1XNZ A;  5CDL A;  3TB5 A;  5CNX A;  1QXZ A;  1W7V A;  4U6C A;  2BWW A;  4ZWO A;  3BIT A;  2Q94 A;  2EVO A;  4PV4 A;  2ADU A;  2BWU A;  4RZY A;  2IW2 A;  2GU5 A;  3Q6D A;  4ZNG A;  2Q93 A;  4A6W A;  1XGO A;  4A6V A;  2HOW A;  4ZWU A;  2B3K A;  2GU7 A;  2GU6 A;  1YW7 A;  1WL9 A;  1XGS A;  1WY2 A;  4IKU A;  2GGB A;  1KQ0 A;  5D6E A;  4S2T P;  4S2R P;  2BWX A;  1WKM A;  2GG2 A;  1C24 A;  2P99 A;  5CDV A;  2GTX A;  2Q95 A;  4HXX A;  2BHA A;  1BOA A;  2EA2 A;  2ZSG A;  3CTZ A;  2GZ5 A;  3PKD A;  4U1B A;  3IU7 A;  4S00 A;  4B28 A;  2OAZ A;  2BWT A;  1C27 A;  4FLJ A;  1R58 A;  1C22 A;  2B3H A;  4FLI A;  5D6F A;  2GG8 A;  2P98 A;  3FM3 A;  1PV9 A;  1M35 A;  5CLS A;  4U73 A;  1MAT A;  3FMR A;  2EVM A;  4U76 A;  4U69 A;  4JUQ A;  2Q92 A;  4R60 A;  2Q96 A;  1YW8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...