2BWSA

His243ala escherichia coli aminopeptidase p
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
440
structure length
439
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILAYTENEEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE P
publication title Kinetic and Crystallographic Analysis of Mutant Escherichia Coli Aminopeptidase P: Insights Into Substrate Recognition and the Mechanism of Catalysis.
pubmed doi rcsb
source organism Escherichia coli
total genus 160
structure length 439
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bwsA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bwsA02
1Y1NA 1C23A 3PKBA 2EA4A 4MATA 4U6WA 4IKTA 2Q93A 1O0XA 3PKCA 3MX6A 1R5HA 1YW8A 2P98A 3PKEA 3TAVA 4IECA 1YVMA 1WL6A 2OKNA 2V6CA 4IKSA 5CLSA 2BN7A 1R5GA 2P9AA 3PKDA 1C22A 3MATA 1PV9A 1XGOA 1WY2A 2GGCA 4U6CA 3PEBA 3BITA 4R60A 1B6AA 2GG0A 4Z7MA 4RZZA 2HOWA 2GA2A 5JHUA 3IU7A 4FLKA 4U6ZA 2B3KA 3L24A 1JAWA 4IU6A 4HXXA 1WN1A 4RZYA 2BHAA 5JI6A 3BIPA 2BH3A 3I7MA 1WKMA 4IF7A 1C21A 1C24A 2GG8A 1N51A 4JUQA 2GG3A 2BHDA 3CB5A 2NQ6A 3FMQA 5CNXA 4IKRA 3PKAA 2BWUA 2BHBA 4RGZ1 1YJ3A 1QXYA 3IU9A 2GG7A 2ZSGA 1B59A 4QR8A 2B3HA 2V3XA 1M35A 4U71A 3FMRA 3TB5A 4FLIA 2BWVA 2BWWA 5CDEA 2EVCA 5FCFA 4FO8A 2BHCA 3CB6A 2OAZA 3OVKA 2B3LA 2BWYA 4KM3A 2GG2A 4FKCA 1KQ9A 3O5VA 1WL9A 1MATA 5CDVA 4FLLA 3IG4A 3S6BA 2EVMA 4IDYA 4U1BA 2GTXA 1XGMA 2GU5A 3IU8A 1YW7A 4EGEA 3MR1A 4S2TP 4FLJA 1XNZA 2BWTA 5CE6A 2BWSA 2GG9A 2NQ7A 4U6JA 2ADUA 1BOAA 1W2MA 4IKUA 1WLRA 3BIQA 3OOOA 4U70A 2GG5A 5E2CA 1A16A 2GU6A 4OOKA 4U75A 4IPAA 2Q95A 1KP0A 4ZWOA 2MATA 4A6WA 1KQ0A 3PN9A 2Q8KA 5CDLA 1YW9A 1QXZA 2V3YA 5D6FA 5JFRA 3QOCA 5E5BA 4PNCA 1QXWA 4S2RP 2GGBA 2V3ZA 4ZWPA 3RORA 4U69A 1BN5A 2P99A 3D27A 2G6PA 4S00A 4U6EA 3Q6DA 4U76A 2DFIA 4B28A 1R58A 4FUKA 2GZ5A 4PV4A 2EA2A 2EVOA 4U73A 4A6VA 4FO7A 4ZWUA 3RVAA 1W7VA 1XGNA 1CHMA 2IW2A 2GU4A 1C27A 2Q94A 5FCHA 1QZYA 3CTZA 1XGSA 2GU7A 3IL0A 2Q92A 5D6EA 1WBQA 5CIKA 3L7GA 2BWXA 2BB7A 3FM3A 4S01A 2Q96A 4ZNGA
chains in the Genus database with same CATH superfamily
1Y1NA 1C23A 3PKBA 2EA4A 4MATA 4U6WA 4IKTA 2Q93A 1O0XA 3PKCA 3MX6A 1R5HA 1YW8A 2P98A 3PKEA 3TAVA 4IECA 1YVMA 1WL6A 2OKNA 2V6CA 4IKSA 5CLSA 2BN7A 1R5GA 2P9AA 3PKDA 1C22A 3MATA 1PV9A 1XGOA 1WY2A 2GGCA 4U6CA 3PEBA 3BITA 4R60A 1B6AA 2GG0A 4Z7MA 4RZZA 2HOWA 2GA2A 5JHUA 3IU7A 4FLKA 4U6ZA 2B3KA 3L24A 1JAWA 4IU6A 4HXXA 1WN1A 4RZYA 2BHAA 5JI6A 3BIPA 2BH3A 3I7MA 1WKMA 4IF7A 1C21A 1C24A 2GG8A 1N51A 4JUQA 2GG3A 2BHDA 3CB5A 2NQ6A 3FMQA 5CNXA 4IKRA 3PKAA 2BWUA 2BHBA 4RGZ1 1YJ3A 1QXYA 3IU9A 2GG7A 2ZSGA 1B59A 4QR8A 2B3HA 2V3XA 1M35A 4U71A 3FMRA 3TB5A 4FLIA 2BWVA 2BWWA 5CDEA 2EVCA 5FCFA 4FO8A 2BHCA 3CB6A 2OAZA 3OVKA 2B3LA 2BWYA 4KM3A 2GG2A 4FKCA 1KQ9A 3O5VA 1WL9A 1MATA 5CDVA 4FLLA 3IG4A 3S6BA 2EVMA 4IDYA 4U1BA 2GTXA 1XGMA 2GU5A 3IU8A 1YW7A 4EGEA 3MR1A 4S2TP 4FLJA 1XNZA 2BWTA 5CE6A 2BWSA 2GG9A 2NQ7A 4U6JA 2ADUA 1BOAA 1W2MA 4IKUA 1WLRA 3BIQA 3OOOA 4U70A 2GG5A 5E2CA 1A16A 2GU6A 4OOKA 4U75A 4IPAA 2Q95A 1KP0A 4ZWOA 2MATA 4A6WA 1KQ0A 3PN9A 2Q8KA 5CDLA 1YW9A 1QXZA 2V3YA 5D6FA 5JFRA 3QOCA 5E5BA 4PNCA 1QXWA 4S2RP 2GGBA 2V3ZA 4ZWPA 3RORA 4U69A 1BN5A 2P99A 3D27A 2G6PA 4S00A 4U6EA 3Q6DA 4U76A 2DFIA 4B28A 1R58A 4FUKA 2GZ5A 4PV4A 2EA2A 2EVOA 4U73A 4A6VA 4FO7A 4ZWUA 3RVAA 1W7VA 1XGNA 1CHMA 2IW2A 2GU4A 1C27A 2Q94A 5FCHA 1QZYA 3CTZA 1XGSA 2GU7A 3IL0A 2Q92A 5D6EA 1WBQA 5CIKA 3L7GA 2BWXA 2BB7A 3FM3A 4S01A 2Q96A 4ZNGA
chains in the Genus database with same CATH topology
1Y1NA 1C23A 3PKBA 2EA4A 4MATA 4U6WA 4IKTA 2Q93A 1O0XA 3PKCA 3MX6A 1R5HA 1YW8A 2P98A 3PKEA 3TAVA 4IECA 1YVMA 1WL6A 2OKNA 2V6CA 4IKSA 5CLSA 2BN7A 1R5GA 2P9AA 3PKDA 1C22A 3MATA 1PV9A 1XGOA 1WY2A 2GGCA 4U6CA 3PEBA 3BITA 4R60A 1B6AA 2GG0A 4Z7MA 4RZZA 2HOWA 2GA2A 5JHUA 3IU7A 4FLKA 4U6ZA 2B3KA 3L24A 1JAWA 4IU6A 4HXXA 1WN1A 4RZYA 2BHAA 5JI6A 3BIPA 2BH3A 3I7MA 1WKMA 4IF7A 1C21A 1C24A 2GG8A 1N51A 4JUQA 2GG3A 2BHDA 3CB5A 2NQ6A 3FMQA 5CNXA 4IKRA 3PKAA 2BWUA 2BHBA 4RGZ1 1YJ3A 1QXYA 3IU9A 2GG7A 2ZSGA 1B59A 4QR8A 2B3HA 2V3XA 1M35A 4U71A 3FMRA 3TB5A 4FLIA 2BWVA 2BWWA 5CDEA 2EVCA 5FCFA 4FO8A 2BHCA 3CB6A 2OAZA 3OVKA 2B3LA 2BWYA 4KM3A 2GG2A 4FKCA 1KQ9A 3O5VA 1WL9A 1MATA 5CDVA 4FLLA 3IG4A 3S6BA 2EVMA 4IDYA 4U1BA 2GTXA 1XGMA 2GU5A 3IU8A 1YW7A 4EGEA 3MR1A 4S2TP 4FLJA 1XNZA 2BWTA 5CE6A 2BWSA 2GG9A 2NQ7A 4U6JA 2ADUA 1BOAA 1W2MA 4IKUA 1WLRA 3BIQA 3OOOA 4U70A 2GG5A 5E2CA 1A16A 2GU6A 4OOKA 4U75A 4IPAA 2Q95A 1KP0A 4ZWOA 2MATA 4A6WA 1KQ0A 3PN9A 2Q8KA 5CDLA 1YW9A 1QXZA 2V3YA 5D6FA 5JFRA 3QOCA 5E5BA 4PNCA 1QXWA 4S2RP 2GGBA 2V3ZA 4ZWPA 3RORA 4U69A 1BN5A 2P99A 3D27A 2G6PA 4S00A 4U6EA 3Q6DA 4U76A 2DFIA 4B28A 1R58A 4FUKA 2GZ5A 4PV4A 2EA2A 2EVOA 4U73A 4A6VA 4FO7A 4ZWUA 3RVAA 1W7VA 1XGNA 1CHMA 2IW2A 2GU4A 1C27A 2Q94A 5FCHA 1QZYA 3CTZA 1XGSA 2GU7A 3IL0A 2Q92A 5D6EA 1WBQA 5CIKA 3L7GA 2BWXA 2BB7A 3FM3A 4S01A 2Q96A 4ZNGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y1N A;  1C23 A;  3PKB A;  2EA4 A;  4MAT A;  4U6W A;  4IKT A;  2Q93 A;  1O0X A;  3PKC A;  3MX6 A;  1R5H A;  1YW8 A;  2P98 A;  3PKE A;  3TAV A;  4IEC A;  1YVM A;  1WL6 A;  2OKN A;  2V6C A;  4IKS A;  5CLS A;  2BN7 A;  1R5G A;  2P9A A;  3PKD A;  1C22 A;  3MAT A;  1PV9 A;  1XGO A;  1WY2 A;  2GGC A;  4U6C A;  3PEB A;  3BIT A;  4R60 A;  1B6A A;  2GG0 A;  4Z7M A;  4RZZ A;  2HOW A;  2GA2 A;  5JHU A;  3IU7 A;  4FLK A;  4U6Z A;  2B3K A;  3L24 A;  1JAW A;  4IU6 A;  4HXX A;  1WN1 A;  4RZY A;  2BHA A;  5JI6 A;  3BIP A;  2BH3 A;  3I7M A;  1WKM A;  4IF7 A;  1C21 A;  1C24 A;  2GG8 A;  1N51 A;  4JUQ A;  2GG3 A;  2BHD A;  3CB5 A;  2NQ6 A;  3FMQ A;  5CNX A;  4IKR A;  3PKA A;  2BWU A;  2BHB A;  4RGZ 1;  1YJ3 A;  1QXY A;  3IU9 A;  2GG7 A;  2ZSG A;  1B59 A;  4QR8 A;  2B3H A;  2V3X A;  1M35 A;  4U71 A;  3FMR A;  3TB5 A;  4FLI A;  2BWV A;  2BWW A;  5CDE A;  2EVC A;  5FCF A;  4FO8 A;  2BHC A;  3CB6 A;  2OAZ A;  3OVK A;  2B3L A;  2BWY A;  4KM3 A;  2GG2 A;  4FKC A;  1KQ9 A;  3O5V A;  1WL9 A;  1MAT A;  5CDV A;  4FLL A;  3IG4 A;  3S6B A;  2EVM A;  4IDY A;  4U1B A;  2GTX A;  1XGM A;  2GU5 A;  3IU8 A;  1YW7 A;  4EGE A;  3MR1 A;  4S2T P;  4FLJ A;  1XNZ A;  2BWT A;  5CE6 A;  2BWS A;  2GG9 A;  2NQ7 A;  4U6J A;  2ADU A;  1BOA A;  1W2M A;  4IKU A;  1WLR A;  3BIQ A;  3OOO A;  4U70 A;  2GG5 A;  5E2C A;  1A16 A;  2GU6 A;  4OOK A;  4U75 A;  4IPA A;  2Q95 A;  1KP0 A;  4ZWO A;  2MAT A;  4A6W A;  1KQ0 A;  3PN9 A;  2Q8K A;  5CDL A;  1YW9 A;  1QXZ A;  2V3Y A;  5D6F A;  5JFR A;  3QOC A;  5E5B A;  4PNC A;  1QXW A;  4S2R P;  2GGB A;  2V3Z A;  4ZWP A;  3ROR A;  4U69 A;  1BN5 A;  2P99 A;  3D27 A;  2G6P A;  4S00 A;  4U6E A;  3Q6D A;  4U76 A;  2DFI A;  4B28 A;  1R58 A;  4FUK A;  2GZ5 A;  4PV4 A;  2EA2 A;  2EVO A;  4U73 A;  4A6V A;  4FO7 A;  4ZWU A;  3RVA A;  1W7V A;  1XGN A;  1CHM A;  2IW2 A;  2GU4 A;  1C27 A;  2Q94 A;  5FCH A;  1QZY A;  3CTZ A;  1XGS A;  2GU7 A;  3IL0 A;  2Q92 A;  5D6E A;  1WBQ A;  5CIK A;  3L7G A;  2BWX A;  2BB7 A;  3FM3 A;  4S01 A;  2Q96 A;  4ZNG A; 
#chains in the Genus database with same CATH topology
 1Y1N A;  1C23 A;  3PKB A;  2EA4 A;  4MAT A;  4U6W A;  4IKT A;  2Q93 A;  1O0X A;  3PKC A;  3MX6 A;  1R5H A;  1YW8 A;  2P98 A;  3PKE A;  3TAV A;  4IEC A;  1YVM A;  1WL6 A;  2OKN A;  2V6C A;  4IKS A;  5CLS A;  2BN7 A;  1R5G A;  2P9A A;  3PKD A;  1C22 A;  3MAT A;  1PV9 A;  1XGO A;  1WY2 A;  2GGC A;  4U6C A;  3PEB A;  3BIT A;  4R60 A;  1B6A A;  2GG0 A;  4Z7M A;  4RZZ A;  2HOW A;  2GA2 A;  5JHU A;  3IU7 A;  4FLK A;  4U6Z A;  2B3K A;  3L24 A;  1JAW A;  4IU6 A;  4HXX A;  1WN1 A;  4RZY A;  2BHA A;  5JI6 A;  3BIP A;  2BH3 A;  3I7M A;  1WKM A;  4IF7 A;  1C21 A;  1C24 A;  2GG8 A;  1N51 A;  4JUQ A;  2GG3 A;  2BHD A;  3CB5 A;  2NQ6 A;  3FMQ A;  5CNX A;  4IKR A;  3PKA A;  2BWU A;  2BHB A;  4RGZ 1;  1YJ3 A;  1QXY A;  3IU9 A;  2GG7 A;  2ZSG A;  1B59 A;  4QR8 A;  2B3H A;  2V3X A;  1M35 A;  4U71 A;  3FMR A;  3TB5 A;  4FLI A;  2BWV A;  2BWW A;  5CDE A;  2EVC A;  5FCF A;  4FO8 A;  2BHC A;  3CB6 A;  2OAZ A;  3OVK A;  2B3L A;  2BWY A;  4KM3 A;  2GG2 A;  4FKC A;  1KQ9 A;  3O5V A;  1WL9 A;  1MAT A;  5CDV A;  4FLL A;  3IG4 A;  3S6B A;  2EVM A;  4IDY A;  4U1B A;  2GTX A;  1XGM A;  2GU5 A;  3IU8 A;  1YW7 A;  4EGE A;  3MR1 A;  4S2T P;  4FLJ A;  1XNZ A;  2BWT A;  5CE6 A;  2BWS A;  2GG9 A;  2NQ7 A;  4U6J A;  2ADU A;  1BOA A;  1W2M A;  4IKU A;  1WLR A;  3BIQ A;  3OOO A;  4U70 A;  2GG5 A;  5E2C A;  1A16 A;  2GU6 A;  4OOK A;  4U75 A;  4IPA A;  2Q95 A;  1KP0 A;  4ZWO A;  2MAT A;  4A6W A;  1KQ0 A;  3PN9 A;  2Q8K A;  5CDL A;  1YW9 A;  1QXZ A;  2V3Y A;  5D6F A;  5JFR A;  3QOC A;  5E5B A;  4PNC A;  1QXW A;  4S2R P;  2GGB A;  2V3Z A;  4ZWP A;  3ROR A;  4U69 A;  1BN5 A;  2P99 A;  3D27 A;  2G6P A;  4S00 A;  4U6E A;  3Q6D A;  4U76 A;  2DFI A;  4B28 A;  1R58 A;  4FUK A;  2GZ5 A;  4PV4 A;  2EA2 A;  2EVO A;  4U73 A;  4A6V A;  4FO7 A;  4ZWU A;  3RVA A;  1W7V A;  1XGN A;  1CHM A;  2IW2 A;  2GU4 A;  1C27 A;  2Q94 A;  5FCH A;  1QZY A;  3CTZ A;  1XGS A;  2GU7 A;  3IL0 A;  2Q92 A;  5D6E A;  1WBQ A;  5CIK A;  3L7G A;  2BWX A;  2BB7 A;  3FM3 A;  4S01 A;  2Q96 A;  4ZNG A; 
#chains in the Genus database with same CATH homology
 1Y1N A;  1C23 A;  3PKB A;  2EA4 A;  4MAT A;  4U6W A;  4IKT A;  2Q93 A;  1O0X A;  3PKC A;  3MX6 A;  1R5H A;  1YW8 A;  2P98 A;  3PKE A;  3TAV A;  4IEC A;  1YVM A;  1WL6 A;  2OKN A;  2V6C A;  4IKS A;  5CLS A;  2BN7 A;  1R5G A;  2P9A A;  3PKD A;  1C22 A;  3MAT A;  1PV9 A;  1XGO A;  1WY2 A;  2GGC A;  4U6C A;  3PEB A;  3BIT A;  4R60 A;  1B6A A;  2GG0 A;  4Z7M A;  4RZZ A;  2HOW A;  2GA2 A;  5JHU A;  3IU7 A;  4FLK A;  4U6Z A;  2B3K A;  3L24 A;  1JAW A;  4IU6 A;  4HXX A;  1WN1 A;  4RZY A;  2BHA A;  5JI6 A;  3BIP A;  2BH3 A;  3I7M A;  1WKM A;  4IF7 A;  1C21 A;  1C24 A;  2GG8 A;  1N51 A;  4JUQ A;  2GG3 A;  2BHD A;  3CB5 A;  2NQ6 A;  3FMQ A;  5CNX A;  4IKR A;  3PKA A;  2BWU A;  2BHB A;  4RGZ 1;  1YJ3 A;  1QXY A;  3IU9 A;  2GG7 A;  2ZSG A;  1B59 A;  4QR8 A;  2B3H A;  2V3X A;  1M35 A;  4U71 A;  3FMR A;  3TB5 A;  4FLI A;  2BWV A;  2BWW A;  5CDE A;  2EVC A;  5FCF A;  4FO8 A;  2BHC A;  3CB6 A;  2OAZ A;  3OVK A;  2B3L A;  2BWY A;  4KM3 A;  2GG2 A;  4FKC A;  1KQ9 A;  3O5V A;  1WL9 A;  1MAT A;  5CDV A;  4FLL A;  3IG4 A;  3S6B A;  2EVM A;  4IDY A;  4U1B A;  2GTX A;  1XGM A;  2GU5 A;  3IU8 A;  1YW7 A;  4EGE A;  3MR1 A;  4S2T P;  4FLJ A;  1XNZ A;  2BWT A;  5CE6 A;  2BWS A;  2GG9 A;  2NQ7 A;  4U6J A;  2ADU A;  1BOA A;  1W2M A;  4IKU A;  1WLR A;  3BIQ A;  3OOO A;  4U70 A;  2GG5 A;  5E2C A;  1A16 A;  2GU6 A;  4OOK A;  4U75 A;  4IPA A;  2Q95 A;  1KP0 A;  4ZWO A;  2MAT A;  4A6W A;  1KQ0 A;  3PN9 A;  2Q8K A;  5CDL A;  1YW9 A;  1QXZ A;  2V3Y A;  5D6F A;  5JFR A;  3QOC A;  5E5B A;  4PNC A;  1QXW A;  4S2R P;  2GGB A;  2V3Z A;  4ZWP A;  3ROR A;  4U69 A;  1BN5 A;  2P99 A;  3D27 A;  2G6P A;  4S00 A;  4U6E A;  3Q6D A;  4U76 A;  2DFI A;  4B28 A;  1R58 A;  4FUK A;  2GZ5 A;  4PV4 A;  2EA2 A;  2EVO A;  4U73 A;  4A6V A;  4FO7 A;  4ZWU A;  3RVA A;  1W7V A;  1XGN A;  1CHM A;  2IW2 A;  2GU4 A;  1C27 A;  2Q94 A;  5FCH A;  1QZY A;  3CTZ A;  1XGS A;  2GU7 A;  3IL0 A;  2Q92 A;  5D6E A;  1WBQ A;  5CIK A;  3L7G A;  2BWX A;  2BB7 A;  3FM3 A;  4S01 A;  2Q96 A;  4ZNG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...