5CDVA

Proline dipeptidase from deinococcus radiodurans r1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDGKVLVSPDGATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTVRGLRVGFEAESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESAFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Proline dipeptidase from Deinococcus radiodurans R1 at 1.45 Angstrom resolution
rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
molecule tags Hydrolase
molecule keywords Proline dipeptidase
total genus 110
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2015-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5cdvA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5cdvA02
5CLSA 3IU8A 2OAZA 2G6PA 2BHCA 4ZWUA 2GA2A 4IF7A 3OOOA 1B6AA 2B3LA 4FLKA 2P98A 2GG3A 3MR1A 2DFIA 4FLIA 4RZZA 4FLJA 3FMRA 4S2TP 2GG0A 1YW8A 3OVKA 4IKTA 3TB5A 2BWTA 1QXZA 4PNCA 1R5HA 4OOKA 5CDEA 2B3KA 2V6CA 1QZYA 2NQ7A 2EVOA 5CE6A 1MATA 2V3YA 2V3ZA 3IL0A 4QR8A 1CHMA 1QXYA 3O5VA 3IU7A 2GU6A 3L7GA 4B28A 1WKMA 2GU7A 1WY2A 1B59A 4EGEA 2BWXA 4U69A 2BWVA 3RVAA 3PN9A 1XGNA 4S01A 3BITA 1C22A 2EA2A 5JHUA 3QOCA 1BOAA 2ADUA 2EVMA 3D27A 4ZWPA 1M35A 2BWSA 4IKSA 1R5GA 2GG7A 3PKCA 5CDLA 1WN1A 5FCHA 4IDYA 1BN5A 2Q8KA 4FO8A 1N51A 4U1BA 3PKAA 1KQ9A 2EA4A 2IW2A 5FCFA 2GG9A 1XGOA 2GG5A 3FMQA 2BN7A 4ZNGA 4S2RP 1W2MA 2HOWA 3BIQA 4Z7MA 4U75A 1KP0A 3IG4A 2BB7A 2BWWA 1WBQA 5CNXA 3FM3A 3RORA 5D6FA 1C27A 4A6WA 4PV4A 1KQ0A 1YW9A 2GG2A 4IPAA 4KM3A 1WLRA 5D6EA 4IECA 3L24A 4U6ZA 1R58A 2OKNA 2Q93A 2P9AA 1W7VA 3PEBA 3IU9A 1JAWA 2BHAA 3Q6DA 1QXWA 4A6VA 2ZSGA 3PKEA 1XGMA 3I7MA 2Q94A 2V3XA 3PKBA 4FO7A 4RZYA 2EVCA 4U73A 5E2CA 4U6JA 3TAVA 5E5BA 2GG8A 2GU5A 4U6WA 2Q96A 2BHDA 1WL6A 4RGZ1 1YW7A 4MATA 2P99A 5CIKA 3CTZA 3BIPA 1YVMA 4S00A 2GGCA 5CDVA 2MATA 4FUKA 4R60A 4JUQA 1XGSA 3CB6A 3MATA 2Q95A 1PV9A 4U76A 2GGBA 1A16A 1WL9A 5JFRA 4U6CA 1C21A 2GU4A 3S6BA 4HXXA 4U71A 1O0XA 3MX6A 2GTXA 1YJ3A 2GZ5A 4IU6A 4ZWOA 5JI6A 2NQ6A 4FKCA 4FLLA 2BHBA 1C24A 2BH3A 2BWUA 4IKRA 2Q92A 4U6EA 3PKDA 4U70A 2BWYA 1Y1NA 1C23A 3CB5A 2B3HA 1XNZA 4IKUA
chains in the Genus database with same CATH superfamily
5CLSA 3IU8A 2OAZA 2G6PA 2BHCA 4ZWUA 2GA2A 4IF7A 3OOOA 1B6AA 2B3LA 4FLKA 2P98A 2GG3A 3MR1A 2DFIA 4FLIA 4RZZA 4FLJA 3FMRA 4S2TP 2GG0A 1YW8A 3OVKA 4IKTA 3TB5A 2BWTA 1QXZA 4PNCA 1R5HA 4OOKA 5CDEA 2B3KA 2V6CA 1QZYA 2NQ7A 2EVOA 5CE6A 1MATA 2V3YA 2V3ZA 3IL0A 4QR8A 1CHMA 1QXYA 3O5VA 3IU7A 2GU6A 3L7GA 4B28A 1WKMA 2GU7A 1WY2A 1B59A 4EGEA 2BWXA 4U69A 2BWVA 3RVAA 3PN9A 1XGNA 4S01A 3BITA 1C22A 2EA2A 5JHUA 3QOCA 1BOAA 2ADUA 2EVMA 3D27A 4ZWPA 1M35A 2BWSA 4IKSA 1R5GA 2GG7A 3PKCA 5CDLA 1WN1A 5FCHA 4IDYA 1BN5A 2Q8KA 4FO8A 1N51A 4U1BA 3PKAA 1KQ9A 2EA4A 2IW2A 5FCFA 2GG9A 1XGOA 2GG5A 3FMQA 2BN7A 4ZNGA 4S2RP 1W2MA 2HOWA 3BIQA 4Z7MA 4U75A 1KP0A 3IG4A 2BB7A 2BWWA 1WBQA 5CNXA 3FM3A 3RORA 5D6FA 1C27A 4A6WA 4PV4A 1KQ0A 1YW9A 2GG2A 4IPAA 4KM3A 1WLRA 5D6EA 4IECA 3L24A 4U6ZA 1R58A 2OKNA 2Q93A 2P9AA 1W7VA 3PEBA 3IU9A 1JAWA 2BHAA 3Q6DA 1QXWA 4A6VA 2ZSGA 3PKEA 1XGMA 3I7MA 2Q94A 2V3XA 3PKBA 4FO7A 4RZYA 2EVCA 4U73A 5E2CA 4U6JA 3TAVA 5E5BA 2GG8A 2GU5A 4U6WA 2Q96A 2BHDA 1WL6A 4RGZ1 1YW7A 4MATA 2P99A 5CIKA 3CTZA 3BIPA 1YVMA 4S00A 2GGCA 5CDVA 2MATA 4FUKA 4R60A 4JUQA 1XGSA 3CB6A 3MATA 2Q95A 1PV9A 4U76A 2GGBA 1A16A 1WL9A 5JFRA 4U6CA 1C21A 2GU4A 3S6BA 4HXXA 4U71A 1O0XA 3MX6A 2GTXA 1YJ3A 2GZ5A 4IU6A 4ZWOA 5JI6A 2NQ6A 4FKCA 4FLLA 2BHBA 1C24A 2BH3A 2BWUA 4IKRA 2Q92A 4U6EA 3PKDA 4U70A 2BWYA 1Y1NA 1C23A 3CB5A 2B3HA 1XNZA 4IKUA
chains in the Genus database with same CATH topology
5CLSA 3IU8A 2OAZA 2G6PA 2BHCA 4ZWUA 2GA2A 4IF7A 3OOOA 1B6AA 2B3LA 4FLKA 2P98A 2GG3A 3MR1A 2DFIA 4FLIA 4RZZA 4FLJA 3FMRA 4S2TP 2GG0A 1YW8A 3OVKA 4IKTA 3TB5A 2BWTA 1QXZA 4PNCA 1R5HA 4OOKA 5CDEA 2B3KA 2V6CA 1QZYA 2NQ7A 2EVOA 5CE6A 1MATA 2V3YA 2V3ZA 3IL0A 4QR8A 1CHMA 1QXYA 3O5VA 3IU7A 2GU6A 3L7GA 4B28A 1WKMA 2GU7A 1WY2A 1B59A 4EGEA 2BWXA 4U69A 2BWVA 3RVAA 3PN9A 1XGNA 4S01A 3BITA 1C22A 2EA2A 5JHUA 3QOCA 1BOAA 2ADUA 2EVMA 3D27A 4ZWPA 1M35A 2BWSA 4IKSA 1R5GA 2GG7A 3PKCA 5CDLA 1WN1A 5FCHA 4IDYA 1BN5A 2Q8KA 4FO8A 1N51A 4U1BA 3PKAA 1KQ9A 2EA4A 2IW2A 5FCFA 2GG9A 1XGOA 2GG5A 3FMQA 2BN7A 4ZNGA 4S2RP 1W2MA 2HOWA 3BIQA 4Z7MA 4U75A 1KP0A 3IG4A 2BB7A 2BWWA 1WBQA 5CNXA 3FM3A 3RORA 5D6FA 1C27A 4A6WA 4PV4A 1KQ0A 1YW9A 2GG2A 4IPAA 4KM3A 1WLRA 5D6EA 4IECA 3L24A 4U6ZA 1R58A 2OKNA 2Q93A 2P9AA 1W7VA 3PEBA 3IU9A 1JAWA 2BHAA 3Q6DA 1QXWA 4A6VA 2ZSGA 3PKEA 1XGMA 3I7MA 2Q94A 2V3XA 3PKBA 4FO7A 4RZYA 2EVCA 4U73A 5E2CA 4U6JA 3TAVA 5E5BA 2GG8A 2GU5A 4U6WA 2Q96A 2BHDA 1WL6A 4RGZ1 1YW7A 4MATA 2P99A 5CIKA 3CTZA 3BIPA 1YVMA 4S00A 2GGCA 5CDVA 2MATA 4FUKA 4R60A 4JUQA 1XGSA 3CB6A 3MATA 2Q95A 1PV9A 4U76A 2GGBA 1A16A 1WL9A 5JFRA 4U6CA 1C21A 2GU4A 3S6BA 4HXXA 4U71A 1O0XA 3MX6A 2GTXA 1YJ3A 2GZ5A 4IU6A 4ZWOA 5JI6A 2NQ6A 4FKCA 4FLLA 2BHBA 1C24A 2BH3A 2BWUA 4IKRA 2Q92A 4U6EA 3PKDA 4U70A 2BWYA 1Y1NA 1C23A 3CB5A 2B3HA 1XNZA 4IKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CLS A;  3IU8 A;  2OAZ A;  2G6P A;  2BHC A;  4ZWU A;  2GA2 A;  4IF7 A;  3OOO A;  1B6A A;  2B3L A;  4FLK A;  2P98 A;  2GG3 A;  3MR1 A;  2DFI A;  4FLI A;  4RZZ A;  4FLJ A;  3FMR A;  4S2T P;  2GG0 A;  1YW8 A;  3OVK A;  4IKT A;  3TB5 A;  2BWT A;  1QXZ A;  4PNC A;  1R5H A;  4OOK A;  5CDE A;  2B3K A;  2V6C A;  1QZY A;  2NQ7 A;  2EVO A;  5CE6 A;  1MAT A;  2V3Y A;  2V3Z A;  3IL0 A;  4QR8 A;  1CHM A;  1QXY A;  3O5V A;  3IU7 A;  2GU6 A;  3L7G A;  4B28 A;  1WKM A;  2GU7 A;  1WY2 A;  1B59 A;  4EGE A;  2BWX A;  4U69 A;  2BWV A;  3RVA A;  3PN9 A;  1XGN A;  4S01 A;  3BIT A;  1C22 A;  2EA2 A;  5JHU A;  3QOC A;  1BOA A;  2ADU A;  2EVM A;  3D27 A;  4ZWP A;  1M35 A;  2BWS A;  4IKS A;  1R5G A;  2GG7 A;  3PKC A;  5CDL A;  1WN1 A;  5FCH A;  4IDY A;  1BN5 A;  2Q8K A;  4FO8 A;  1N51 A;  4U1B A;  3PKA A;  1KQ9 A;  2EA4 A;  2IW2 A;  5FCF A;  2GG9 A;  1XGO A;  2GG5 A;  3FMQ A;  2BN7 A;  4ZNG A;  4S2R P;  1W2M A;  2HOW A;  3BIQ A;  4Z7M A;  4U75 A;  1KP0 A;  3IG4 A;  2BB7 A;  2BWW A;  1WBQ A;  5CNX A;  3FM3 A;  3ROR A;  5D6F A;  1C27 A;  4A6W A;  4PV4 A;  1KQ0 A;  1YW9 A;  2GG2 A;  4IPA A;  4KM3 A;  1WLR A;  5D6E A;  4IEC A;  3L24 A;  4U6Z A;  1R58 A;  2OKN A;  2Q93 A;  2P9A A;  1W7V A;  3PEB A;  3IU9 A;  1JAW A;  2BHA A;  3Q6D A;  1QXW A;  4A6V A;  2ZSG A;  3PKE A;  1XGM A;  3I7M A;  2Q94 A;  2V3X A;  3PKB A;  4FO7 A;  4RZY A;  2EVC A;  4U73 A;  5E2C A;  4U6J A;  3TAV A;  5E5B A;  2GG8 A;  2GU5 A;  4U6W A;  2Q96 A;  2BHD A;  1WL6 A;  4RGZ 1;  1YW7 A;  4MAT A;  2P99 A;  5CIK A;  3CTZ A;  3BIP A;  1YVM A;  4S00 A;  2GGC A;  5CDV A;  2MAT A;  4FUK A;  4R60 A;  4JUQ A;  1XGS A;  3CB6 A;  3MAT A;  2Q95 A;  1PV9 A;  4U76 A;  2GGB A;  1A16 A;  1WL9 A;  5JFR A;  4U6C A;  1C21 A;  2GU4 A;  3S6B A;  4HXX A;  4U71 A;  1O0X A;  3MX6 A;  2GTX A;  1YJ3 A;  2GZ5 A;  4IU6 A;  4ZWO A;  5JI6 A;  2NQ6 A;  4FKC A;  4FLL A;  2BHB A;  1C24 A;  2BH3 A;  2BWU A;  4IKR A;  2Q92 A;  4U6E A;  3PKD A;  4U70 A;  2BWY A;  1Y1N A;  1C23 A;  3CB5 A;  2B3H A;  1XNZ A;  4IKU A; 
#chains in the Genus database with same CATH topology
 5CLS A;  3IU8 A;  2OAZ A;  2G6P A;  2BHC A;  4ZWU A;  2GA2 A;  4IF7 A;  3OOO A;  1B6A A;  2B3L A;  4FLK A;  2P98 A;  2GG3 A;  3MR1 A;  2DFI A;  4FLI A;  4RZZ A;  4FLJ A;  3FMR A;  4S2T P;  2GG0 A;  1YW8 A;  3OVK A;  4IKT A;  3TB5 A;  2BWT A;  1QXZ A;  4PNC A;  1R5H A;  4OOK A;  5CDE A;  2B3K A;  2V6C A;  1QZY A;  2NQ7 A;  2EVO A;  5CE6 A;  1MAT A;  2V3Y A;  2V3Z A;  3IL0 A;  4QR8 A;  1CHM A;  1QXY A;  3O5V A;  3IU7 A;  2GU6 A;  3L7G A;  4B28 A;  1WKM A;  2GU7 A;  1WY2 A;  1B59 A;  4EGE A;  2BWX A;  4U69 A;  2BWV A;  3RVA A;  3PN9 A;  1XGN A;  4S01 A;  3BIT A;  1C22 A;  2EA2 A;  5JHU A;  3QOC A;  1BOA A;  2ADU A;  2EVM A;  3D27 A;  4ZWP A;  1M35 A;  2BWS A;  4IKS A;  1R5G A;  2GG7 A;  3PKC A;  5CDL A;  1WN1 A;  5FCH A;  4IDY A;  1BN5 A;  2Q8K A;  4FO8 A;  1N51 A;  4U1B A;  3PKA A;  1KQ9 A;  2EA4 A;  2IW2 A;  5FCF A;  2GG9 A;  1XGO A;  2GG5 A;  3FMQ A;  2BN7 A;  4ZNG A;  4S2R P;  1W2M A;  2HOW A;  3BIQ A;  4Z7M A;  4U75 A;  1KP0 A;  3IG4 A;  2BB7 A;  2BWW A;  1WBQ A;  5CNX A;  3FM3 A;  3ROR A;  5D6F A;  1C27 A;  4A6W A;  4PV4 A;  1KQ0 A;  1YW9 A;  2GG2 A;  4IPA A;  4KM3 A;  1WLR A;  5D6E A;  4IEC A;  3L24 A;  4U6Z A;  1R58 A;  2OKN A;  2Q93 A;  2P9A A;  1W7V A;  3PEB A;  3IU9 A;  1JAW A;  2BHA A;  3Q6D A;  1QXW A;  4A6V A;  2ZSG A;  3PKE A;  1XGM A;  3I7M A;  2Q94 A;  2V3X A;  3PKB A;  4FO7 A;  4RZY A;  2EVC A;  4U73 A;  5E2C A;  4U6J A;  3TAV A;  5E5B A;  2GG8 A;  2GU5 A;  4U6W A;  2Q96 A;  2BHD A;  1WL6 A;  4RGZ 1;  1YW7 A;  4MAT A;  2P99 A;  5CIK A;  3CTZ A;  3BIP A;  1YVM A;  4S00 A;  2GGC A;  5CDV A;  2MAT A;  4FUK A;  4R60 A;  4JUQ A;  1XGS A;  3CB6 A;  3MAT A;  2Q95 A;  1PV9 A;  4U76 A;  2GGB A;  1A16 A;  1WL9 A;  5JFR A;  4U6C A;  1C21 A;  2GU4 A;  3S6B A;  4HXX A;  4U71 A;  1O0X A;  3MX6 A;  2GTX A;  1YJ3 A;  2GZ5 A;  4IU6 A;  4ZWO A;  5JI6 A;  2NQ6 A;  4FKC A;  4FLL A;  2BHB A;  1C24 A;  2BH3 A;  2BWU A;  4IKR A;  2Q92 A;  4U6E A;  3PKD A;  4U70 A;  2BWY A;  1Y1N A;  1C23 A;  3CB5 A;  2B3H A;  1XNZ A;  4IKU A; 
#chains in the Genus database with same CATH homology
 5CLS A;  3IU8 A;  2OAZ A;  2G6P A;  2BHC A;  4ZWU A;  2GA2 A;  4IF7 A;  3OOO A;  1B6A A;  2B3L A;  4FLK A;  2P98 A;  2GG3 A;  3MR1 A;  2DFI A;  4FLI A;  4RZZ A;  4FLJ A;  3FMR A;  4S2T P;  2GG0 A;  1YW8 A;  3OVK A;  4IKT A;  3TB5 A;  2BWT A;  1QXZ A;  4PNC A;  1R5H A;  4OOK A;  5CDE A;  2B3K A;  2V6C A;  1QZY A;  2NQ7 A;  2EVO A;  5CE6 A;  1MAT A;  2V3Y A;  2V3Z A;  3IL0 A;  4QR8 A;  1CHM A;  1QXY A;  3O5V A;  3IU7 A;  2GU6 A;  3L7G A;  4B28 A;  1WKM A;  2GU7 A;  1WY2 A;  1B59 A;  4EGE A;  2BWX A;  4U69 A;  2BWV A;  3RVA A;  3PN9 A;  1XGN A;  4S01 A;  3BIT A;  1C22 A;  2EA2 A;  5JHU A;  3QOC A;  1BOA A;  2ADU A;  2EVM A;  3D27 A;  4ZWP A;  1M35 A;  2BWS A;  4IKS A;  1R5G A;  2GG7 A;  3PKC A;  5CDL A;  1WN1 A;  5FCH A;  4IDY A;  1BN5 A;  2Q8K A;  4FO8 A;  1N51 A;  4U1B A;  3PKA A;  1KQ9 A;  2EA4 A;  2IW2 A;  5FCF A;  2GG9 A;  1XGO A;  2GG5 A;  3FMQ A;  2BN7 A;  4ZNG A;  4S2R P;  1W2M A;  2HOW A;  3BIQ A;  4Z7M A;  4U75 A;  1KP0 A;  3IG4 A;  2BB7 A;  2BWW A;  1WBQ A;  5CNX A;  3FM3 A;  3ROR A;  5D6F A;  1C27 A;  4A6W A;  4PV4 A;  1KQ0 A;  1YW9 A;  2GG2 A;  4IPA A;  4KM3 A;  1WLR A;  5D6E A;  4IEC A;  3L24 A;  4U6Z A;  1R58 A;  2OKN A;  2Q93 A;  2P9A A;  1W7V A;  3PEB A;  3IU9 A;  1JAW A;  2BHA A;  3Q6D A;  1QXW A;  4A6V A;  2ZSG A;  3PKE A;  1XGM A;  3I7M A;  2Q94 A;  2V3X A;  3PKB A;  4FO7 A;  4RZY A;  2EVC A;  4U73 A;  5E2C A;  4U6J A;  3TAV A;  5E5B A;  2GG8 A;  2GU5 A;  4U6W A;  2Q96 A;  2BHD A;  1WL6 A;  4RGZ 1;  1YW7 A;  4MAT A;  2P99 A;  5CIK A;  3CTZ A;  3BIP A;  1YVM A;  4S00 A;  2GGC A;  5CDV A;  2MAT A;  4FUK A;  4R60 A;  4JUQ A;  1XGS A;  3CB6 A;  3MAT A;  2Q95 A;  1PV9 A;  4U76 A;  2GGB A;  1A16 A;  1WL9 A;  5JFR A;  4U6C A;  1C21 A;  2GU4 A;  3S6B A;  4HXX A;  4U71 A;  1O0X A;  3MX6 A;  2GTX A;  1YJ3 A;  2GZ5 A;  4IU6 A;  4ZWO A;  5JI6 A;  2NQ6 A;  4FKC A;  4FLL A;  2BHB A;  1C24 A;  2BH3 A;  2BWU A;  4IKR A;  2Q92 A;  4U6E A;  3PKD A;  4U70 A;  2BWY A;  1Y1N A;  1C23 A;  3CB5 A;  2B3H A;  1XNZ A;  4IKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...