5CDVA

Proline dipeptidase from deinococcus radiodurans r1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDGKVLVSPDGATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTVRGLRVGFEAESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESAFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline dipeptidase
publication title Proline dipeptidase from Deinococcus radiodurans R1 at 1.45 Angstrom resolution
rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
molecule tags Hydrolase
total genus 110
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2015-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5cdvA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5cdvA02
1WL6A 4QR8A 3S6BA 3PKEA 2BWVA 1PV9A 4U6CA 3PEBA 5CDEA 3MATA 4U6ZA 4ZWOA 1WKMA 4MATA 5CIKA 4S2TP 2NQ6A 5JFRA 3FMQA 5JHUA 4FKCA 2BWXA 2BHBA 1YW9A 4JUQA 4U1BA 2Q95A 1B59A 4PV4A 2GG3A 4U6EA 3OVKA 1BN5A 4IKTA 5CLSA 2OAZA 4U76A 5CDLA 2V3ZA 4ZWPA 3PKBA 5CDVA 2EVMA 4EGEA 4S00A 2G6PA 3MR1A 1N51A 3CB6A 2IW2A 2BWSA 3I7MA 2MATA 1MATA 3L7GA 5JI6A 1XGOA 1QXWA 1C24A 1A16A 1KQ9A 2GU6A 4FLLA 4IKSA 3L24A 4IECA 1C27A 4HXXA 5D6EA 2Q92A 1YW8A 2DFIA 3CTZA 1WL9A 1WLRA 4RZZA 2EA2A 2P98A 2EVOA 2HOWA 4ZNGA 1O0XA 1BOAA 4A6VA 5E5BA 2GGCA 4FO8A 3TB5A 1W7VA 1XGSA 4ZWUA 3IU8A 4FUKA 2Q8KA 4IPAA 1KP0A 3IL0A 3FM3A 3PN9A 2GU7A 1W2MA 5CE6A 1QZYA 4RGZ1 5CNXA 2GG9A 2GGBA 4OOKA 4IU6A 2B3HA 3RVAA 2EVCA 2GG0A 2B3KA 2GTXA 4IKRA 5D6FA 2GU5A 5FCHA 4IF7A 1XGMA 2BHAA 1R5GA 2BH3A 1R5HA 2BWUA 1QXZA 3BITA 3PKAA 2BB7A 3BIQA 2P99A 2P9AA 4KM3A 4U70A 2GG8A 2Q94A 2V3YA 1CHMA 1R58A 2Q96A 4FLJA 1XNZA 4S01A 2GZ5A 4U75A 2V3XA 2BHCA 1XGNA 2Q93A 4U6WA 4U69A 4IDYA 3RORA 2BWWA 2ZSGA 1QXYA 2B3LA 3PKCA 4RZYA 1YW7A 3OOOA 5E2CA 4Z7MA 3D27A 3O5VA 2GU4A 2GG7A 1C21A 4A6WA 4U73A 3MX6A 3PKDA 1WBQA 3BIPA 1JAWA 2BN7A 2EA4A 1KQ0A 2GG5A 3IU7A 3TAVA 5FCFA 2GA2A 4R60A 4S2RP 3FMRA 3CB5A 4IKUA 2BWYA 2ADUA 3IG4A 1B6AA 1WY2A 2NQ7A 2BWTA 1C22A 4B28A 1YVMA 2OKNA 4FO7A 4FLIA 3QOCA 2V6CA 4PNCA 3Q6DA 4FLKA 2BHDA 2GG2A 3IU9A 4U71A 1WN1A 1YJ3A 1M35A 1Y1NA 1C23A 4U6JA
chains in the Genus database with same CATH superfamily
1WL6A 4QR8A 3S6BA 3PKEA 2BWVA 1PV9A 4U6CA 3PEBA 5CDEA 3MATA 4U6ZA 4ZWOA 1WKMA 4MATA 5CIKA 4S2TP 2NQ6A 5JFRA 3FMQA 5JHUA 4FKCA 2BWXA 2BHBA 1YW9A 4JUQA 4U1BA 2Q95A 1B59A 4PV4A 2GG3A 4U6EA 3OVKA 1BN5A 4IKTA 5CLSA 2OAZA 4U76A 5CDLA 2V3ZA 4ZWPA 3PKBA 5CDVA 2EVMA 4EGEA 4S00A 2G6PA 3MR1A 1N51A 3CB6A 2IW2A 2BWSA 3I7MA 2MATA 1MATA 3L7GA 5JI6A 1XGOA 1QXWA 1C24A 1A16A 1KQ9A 2GU6A 4FLLA 4IKSA 3L24A 4IECA 1C27A 4HXXA 5D6EA 2Q92A 1YW8A 2DFIA 3CTZA 1WL9A 1WLRA 4RZZA 2EA2A 2P98A 2EVOA 2HOWA 4ZNGA 1O0XA 1BOAA 4A6VA 5E5BA 2GGCA 4FO8A 3TB5A 1W7VA 1XGSA 4ZWUA 3IU8A 4FUKA 2Q8KA 4IPAA 1KP0A 3IL0A 3FM3A 3PN9A 2GU7A 1W2MA 5CE6A 1QZYA 4RGZ1 5CNXA 2GG9A 2GGBA 4OOKA 4IU6A 2B3HA 3RVAA 2EVCA 2GG0A 2B3KA 2GTXA 4IKRA 5D6FA 2GU5A 5FCHA 4IF7A 1XGMA 2BHAA 1R5GA 2BH3A 1R5HA 2BWUA 1QXZA 3BITA 3PKAA 2BB7A 3BIQA 2P99A 2P9AA 4KM3A 4U70A 2GG8A 2Q94A 2V3YA 1CHMA 1R58A 2Q96A 4FLJA 1XNZA 4S01A 2GZ5A 4U75A 2V3XA 2BHCA 1XGNA 2Q93A 4U6WA 4U69A 4IDYA 3RORA 2BWWA 2ZSGA 1QXYA 2B3LA 3PKCA 4RZYA 1YW7A 3OOOA 5E2CA 4Z7MA 3D27A 3O5VA 2GU4A 2GG7A 1C21A 4A6WA 4U73A 3MX6A 3PKDA 1WBQA 3BIPA 1JAWA 2BN7A 2EA4A 1KQ0A 2GG5A 3IU7A 3TAVA 5FCFA 2GA2A 4R60A 4S2RP 3FMRA 3CB5A 4IKUA 2BWYA 2ADUA 3IG4A 1B6AA 1WY2A 2NQ7A 2BWTA 1C22A 4B28A 1YVMA 2OKNA 4FO7A 4FLIA 3QOCA 2V6CA 4PNCA 3Q6DA 4FLKA 2BHDA 2GG2A 3IU9A 4U71A 1WN1A 1YJ3A 1M35A 1Y1NA 1C23A 4U6JA
chains in the Genus database with same CATH topology
1WL6A 4QR8A 3S6BA 3PKEA 2BWVA 1PV9A 4U6CA 3PEBA 5CDEA 3MATA 4U6ZA 4ZWOA 1WKMA 4MATA 5CIKA 4S2TP 2NQ6A 5JFRA 3FMQA 5JHUA 4FKCA 2BWXA 2BHBA 1YW9A 4JUQA 4U1BA 2Q95A 1B59A 4PV4A 2GG3A 4U6EA 3OVKA 1BN5A 4IKTA 5CLSA 2OAZA 4U76A 5CDLA 2V3ZA 4ZWPA 3PKBA 5CDVA 2EVMA 4EGEA 4S00A 2G6PA 3MR1A 1N51A 3CB6A 2IW2A 2BWSA 3I7MA 2MATA 1MATA 3L7GA 5JI6A 1XGOA 1QXWA 1C24A 1A16A 1KQ9A 2GU6A 4FLLA 4IKSA 3L24A 4IECA 1C27A 4HXXA 5D6EA 2Q92A 1YW8A 2DFIA 3CTZA 1WL9A 1WLRA 4RZZA 2EA2A 2P98A 2EVOA 2HOWA 4ZNGA 1O0XA 1BOAA 4A6VA 5E5BA 2GGCA 4FO8A 3TB5A 1W7VA 1XGSA 4ZWUA 3IU8A 4FUKA 2Q8KA 4IPAA 1KP0A 3IL0A 3FM3A 3PN9A 2GU7A 1W2MA 5CE6A 1QZYA 4RGZ1 5CNXA 2GG9A 2GGBA 4OOKA 4IU6A 2B3HA 3RVAA 2EVCA 2GG0A 2B3KA 2GTXA 4IKRA 5D6FA 2GU5A 5FCHA 4IF7A 1XGMA 2BHAA 1R5GA 2BH3A 1R5HA 2BWUA 1QXZA 3BITA 3PKAA 2BB7A 3BIQA 2P99A 2P9AA 4KM3A 4U70A 2GG8A 2Q94A 2V3YA 1CHMA 1R58A 2Q96A 4FLJA 1XNZA 4S01A 2GZ5A 4U75A 2V3XA 2BHCA 1XGNA 2Q93A 4U6WA 4U69A 4IDYA 3RORA 2BWWA 2ZSGA 1QXYA 2B3LA 3PKCA 4RZYA 1YW7A 3OOOA 5E2CA 4Z7MA 3D27A 3O5VA 2GU4A 2GG7A 1C21A 4A6WA 4U73A 3MX6A 3PKDA 1WBQA 3BIPA 1JAWA 2BN7A 2EA4A 1KQ0A 2GG5A 3IU7A 3TAVA 5FCFA 2GA2A 4R60A 4S2RP 3FMRA 3CB5A 4IKUA 2BWYA 2ADUA 3IG4A 1B6AA 1WY2A 2NQ7A 2BWTA 1C22A 4B28A 1YVMA 2OKNA 4FO7A 4FLIA 3QOCA 2V6CA 4PNCA 3Q6DA 4FLKA 2BHDA 2GG2A 3IU9A 4U71A 1WN1A 1YJ3A 1M35A 1Y1NA 1C23A 4U6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WL6 A;  4QR8 A;  3S6B A;  3PKE A;  2BWV A;  1PV9 A;  4U6C A;  3PEB A;  5CDE A;  3MAT A;  4U6Z A;  4ZWO A;  1WKM A;  4MAT A;  5CIK A;  4S2T P;  2NQ6 A;  5JFR A;  3FMQ A;  5JHU A;  4FKC A;  2BWX A;  2BHB A;  1YW9 A;  4JUQ A;  4U1B A;  2Q95 A;  1B59 A;  4PV4 A;  2GG3 A;  4U6E A;  3OVK A;  1BN5 A;  4IKT A;  5CLS A;  2OAZ A;  4U76 A;  5CDL A;  2V3Z A;  4ZWP A;  3PKB A;  5CDV A;  2EVM A;  4EGE A;  4S00 A;  2G6P A;  3MR1 A;  1N51 A;  3CB6 A;  2IW2 A;  2BWS A;  3I7M A;  2MAT A;  1MAT A;  3L7G A;  5JI6 A;  1XGO A;  1QXW A;  1C24 A;  1A16 A;  1KQ9 A;  2GU6 A;  4FLL A;  4IKS A;  3L24 A;  4IEC A;  1C27 A;  4HXX A;  5D6E A;  2Q92 A;  1YW8 A;  2DFI A;  3CTZ A;  1WL9 A;  1WLR A;  4RZZ A;  2EA2 A;  2P98 A;  2EVO A;  2HOW A;  4ZNG A;  1O0X A;  1BOA A;  4A6V A;  5E5B A;  2GGC A;  4FO8 A;  3TB5 A;  1W7V A;  1XGS A;  4ZWU A;  3IU8 A;  4FUK A;  2Q8K A;  4IPA A;  1KP0 A;  3IL0 A;  3FM3 A;  3PN9 A;  2GU7 A;  1W2M A;  5CE6 A;  1QZY A;  4RGZ 1;  5CNX A;  2GG9 A;  2GGB A;  4OOK A;  4IU6 A;  2B3H A;  3RVA A;  2EVC A;  2GG0 A;  2B3K A;  2GTX A;  4IKR A;  5D6F A;  2GU5 A;  5FCH A;  4IF7 A;  1XGM A;  2BHA A;  1R5G A;  2BH3 A;  1R5H A;  2BWU A;  1QXZ A;  3BIT A;  3PKA A;  2BB7 A;  3BIQ A;  2P99 A;  2P9A A;  4KM3 A;  4U70 A;  2GG8 A;  2Q94 A;  2V3Y A;  1CHM A;  1R58 A;  2Q96 A;  4FLJ A;  1XNZ A;  4S01 A;  2GZ5 A;  4U75 A;  2V3X A;  2BHC A;  1XGN A;  2Q93 A;  4U6W A;  4U69 A;  4IDY A;  3ROR A;  2BWW A;  2ZSG A;  1QXY A;  2B3L A;  3PKC A;  4RZY A;  1YW7 A;  3OOO A;  5E2C A;  4Z7M A;  3D27 A;  3O5V A;  2GU4 A;  2GG7 A;  1C21 A;  4A6W A;  4U73 A;  3MX6 A;  3PKD A;  1WBQ A;  3BIP A;  1JAW A;  2BN7 A;  2EA4 A;  1KQ0 A;  2GG5 A;  3IU7 A;  3TAV A;  5FCF A;  2GA2 A;  4R60 A;  4S2R P;  3FMR A;  3CB5 A;  4IKU A;  2BWY A;  2ADU A;  3IG4 A;  1B6A A;  1WY2 A;  2NQ7 A;  2BWT A;  1C22 A;  4B28 A;  1YVM A;  2OKN A;  4FO7 A;  4FLI A;  3QOC A;  2V6C A;  4PNC A;  3Q6D A;  4FLK A;  2BHD A;  2GG2 A;  3IU9 A;  4U71 A;  1WN1 A;  1YJ3 A;  1M35 A;  1Y1N A;  1C23 A;  4U6J A; 
#chains in the Genus database with same CATH topology
 1WL6 A;  4QR8 A;  3S6B A;  3PKE A;  2BWV A;  1PV9 A;  4U6C A;  3PEB A;  5CDE A;  3MAT A;  4U6Z A;  4ZWO A;  1WKM A;  4MAT A;  5CIK A;  4S2T P;  2NQ6 A;  5JFR A;  3FMQ A;  5JHU A;  4FKC A;  2BWX A;  2BHB A;  1YW9 A;  4JUQ A;  4U1B A;  2Q95 A;  1B59 A;  4PV4 A;  2GG3 A;  4U6E A;  3OVK A;  1BN5 A;  4IKT A;  5CLS A;  2OAZ A;  4U76 A;  5CDL A;  2V3Z A;  4ZWP A;  3PKB A;  5CDV A;  2EVM A;  4EGE A;  4S00 A;  2G6P A;  3MR1 A;  1N51 A;  3CB6 A;  2IW2 A;  2BWS A;  3I7M A;  2MAT A;  1MAT A;  3L7G A;  5JI6 A;  1XGO A;  1QXW A;  1C24 A;  1A16 A;  1KQ9 A;  2GU6 A;  4FLL A;  4IKS A;  3L24 A;  4IEC A;  1C27 A;  4HXX A;  5D6E A;  2Q92 A;  1YW8 A;  2DFI A;  3CTZ A;  1WL9 A;  1WLR A;  4RZZ A;  2EA2 A;  2P98 A;  2EVO A;  2HOW A;  4ZNG A;  1O0X A;  1BOA A;  4A6V A;  5E5B A;  2GGC A;  4FO8 A;  3TB5 A;  1W7V A;  1XGS A;  4ZWU A;  3IU8 A;  4FUK A;  2Q8K A;  4IPA A;  1KP0 A;  3IL0 A;  3FM3 A;  3PN9 A;  2GU7 A;  1W2M A;  5CE6 A;  1QZY A;  4RGZ 1;  5CNX A;  2GG9 A;  2GGB A;  4OOK A;  4IU6 A;  2B3H A;  3RVA A;  2EVC A;  2GG0 A;  2B3K A;  2GTX A;  4IKR A;  5D6F A;  2GU5 A;  5FCH A;  4IF7 A;  1XGM A;  2BHA A;  1R5G A;  2BH3 A;  1R5H A;  2BWU A;  1QXZ A;  3BIT A;  3PKA A;  2BB7 A;  3BIQ A;  2P99 A;  2P9A A;  4KM3 A;  4U70 A;  2GG8 A;  2Q94 A;  2V3Y A;  1CHM A;  1R58 A;  2Q96 A;  4FLJ A;  1XNZ A;  4S01 A;  2GZ5 A;  4U75 A;  2V3X A;  2BHC A;  1XGN A;  2Q93 A;  4U6W A;  4U69 A;  4IDY A;  3ROR A;  2BWW A;  2ZSG A;  1QXY A;  2B3L A;  3PKC A;  4RZY A;  1YW7 A;  3OOO A;  5E2C A;  4Z7M A;  3D27 A;  3O5V A;  2GU4 A;  2GG7 A;  1C21 A;  4A6W A;  4U73 A;  3MX6 A;  3PKD A;  1WBQ A;  3BIP A;  1JAW A;  2BN7 A;  2EA4 A;  1KQ0 A;  2GG5 A;  3IU7 A;  3TAV A;  5FCF A;  2GA2 A;  4R60 A;  4S2R P;  3FMR A;  3CB5 A;  4IKU A;  2BWY A;  2ADU A;  3IG4 A;  1B6A A;  1WY2 A;  2NQ7 A;  2BWT A;  1C22 A;  4B28 A;  1YVM A;  2OKN A;  4FO7 A;  4FLI A;  3QOC A;  2V6C A;  4PNC A;  3Q6D A;  4FLK A;  2BHD A;  2GG2 A;  3IU9 A;  4U71 A;  1WN1 A;  1YJ3 A;  1M35 A;  1Y1N A;  1C23 A;  4U6J A; 
#chains in the Genus database with same CATH homology
 1WL6 A;  4QR8 A;  3S6B A;  3PKE A;  2BWV A;  1PV9 A;  4U6C A;  3PEB A;  5CDE A;  3MAT A;  4U6Z A;  4ZWO A;  1WKM A;  4MAT A;  5CIK A;  4S2T P;  2NQ6 A;  5JFR A;  3FMQ A;  5JHU A;  4FKC A;  2BWX A;  2BHB A;  1YW9 A;  4JUQ A;  4U1B A;  2Q95 A;  1B59 A;  4PV4 A;  2GG3 A;  4U6E A;  3OVK A;  1BN5 A;  4IKT A;  5CLS A;  2OAZ A;  4U76 A;  5CDL A;  2V3Z A;  4ZWP A;  3PKB A;  5CDV A;  2EVM A;  4EGE A;  4S00 A;  2G6P A;  3MR1 A;  1N51 A;  3CB6 A;  2IW2 A;  2BWS A;  3I7M A;  2MAT A;  1MAT A;  3L7G A;  5JI6 A;  1XGO A;  1QXW A;  1C24 A;  1A16 A;  1KQ9 A;  2GU6 A;  4FLL A;  4IKS A;  3L24 A;  4IEC A;  1C27 A;  4HXX A;  5D6E A;  2Q92 A;  1YW8 A;  2DFI A;  3CTZ A;  1WL9 A;  1WLR A;  4RZZ A;  2EA2 A;  2P98 A;  2EVO A;  2HOW A;  4ZNG A;  1O0X A;  1BOA A;  4A6V A;  5E5B A;  2GGC A;  4FO8 A;  3TB5 A;  1W7V A;  1XGS A;  4ZWU A;  3IU8 A;  4FUK A;  2Q8K A;  4IPA A;  1KP0 A;  3IL0 A;  3FM3 A;  3PN9 A;  2GU7 A;  1W2M A;  5CE6 A;  1QZY A;  4RGZ 1;  5CNX A;  2GG9 A;  2GGB A;  4OOK A;  4IU6 A;  2B3H A;  3RVA A;  2EVC A;  2GG0 A;  2B3K A;  2GTX A;  4IKR A;  5D6F A;  2GU5 A;  5FCH A;  4IF7 A;  1XGM A;  2BHA A;  1R5G A;  2BH3 A;  1R5H A;  2BWU A;  1QXZ A;  3BIT A;  3PKA A;  2BB7 A;  3BIQ A;  2P99 A;  2P9A A;  4KM3 A;  4U70 A;  2GG8 A;  2Q94 A;  2V3Y A;  1CHM A;  1R58 A;  2Q96 A;  4FLJ A;  1XNZ A;  4S01 A;  2GZ5 A;  4U75 A;  2V3X A;  2BHC A;  1XGN A;  2Q93 A;  4U6W A;  4U69 A;  4IDY A;  3ROR A;  2BWW A;  2ZSG A;  1QXY A;  2B3L A;  3PKC A;  4RZY A;  1YW7 A;  3OOO A;  5E2C A;  4Z7M A;  3D27 A;  3O5V A;  2GU4 A;  2GG7 A;  1C21 A;  4A6W A;  4U73 A;  3MX6 A;  3PKD A;  1WBQ A;  3BIP A;  1JAW A;  2BN7 A;  2EA4 A;  1KQ0 A;  2GG5 A;  3IU7 A;  3TAV A;  5FCF A;  2GA2 A;  4R60 A;  4S2R P;  3FMR A;  3CB5 A;  4IKU A;  2BWY A;  2ADU A;  3IG4 A;  1B6A A;  1WY2 A;  2NQ7 A;  2BWT A;  1C22 A;  4B28 A;  1YVM A;  2OKN A;  4FO7 A;  4FLI A;  3QOC A;  2V6C A;  4PNC A;  3Q6D A;  4FLK A;  2BHD A;  2GG2 A;  3IU9 A;  4U71 A;  1WN1 A;  1YJ3 A;  1M35 A;  1Y1N A;  1C23 A;  4U6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...