5CDVA

Proline dipeptidase from deinococcus radiodurans r1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDGKVLVSPDGATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTVRGLRVGFEAESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESAFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Proline dipeptidase
publication title Proline dipeptidase from Deinococcus radiodurans R1 at 1.45 Angstrom resolution
rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
total genus 110
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2015-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5cdvA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5cdvA02
4U6EA 1WL6A 4S00A 1C21A 1R58A 4FKCA 2V3XA 4Z7MA 3PEBA 4IDYA 3BITA 5E2CA 1R5HA 3CB6A 1BOAA 4FLJA 1YW9A 1C24A 4A6WA 3PN9A 2GA2A 3D27A 4ZWPA 2BWUA 3L24A 1QZYA 1YW8A 2GU5A 2B3HA 3MX6A 3PKBA 2GG3A 2Q8KA 1WLRA 5CDEA 4OOKA 3IU8A 1W7VA 2B3KA 4A6VA 5D6FA 4IU6A 3TAVA 2BHCA 2ZSGA 5FCHA 2OAZA 3FMRA 2Q96A 4RZZA 3IG4A 4R60A 2Q94A 4FO8A 1QXWA 1BN5A 2EVOA 2BWXA 3PKCA 4RZYA 4ZNGA 1B59A 2B3LA 2GG9A 1O0XA 2OKNA 4U70A 3FM3A 1XNZA 2GG2A 3O5VA 4U73A 2GGBA 3I7MA 3PKAA 4FLKA 5JI6A 1WBQA 1B6AA 1C22A 4QR8A 2P98A 3BIQA 4IPAA 2GZ5A 3OVKA 3PKEA 4U6CA 2BHDA 4FLLA 2BB7A 2Q93A 3OOOA 4ZWOA 2GG7A 3FMQA 1YW7A 5JHUA 5CE6A 5CLSA 4IKTA 4U76A 2GG5A 4IKSA 5CIKA 4EGEA 2EA4A 1CHMA 2HOWA 2P99A 4FUKA 5JFRA 4U6ZA 5CDLA 1KQ9A 2GG0A 2BHBA 4HXXA 4RGZ1 1R5GA 2NQ6A 4MATA 4JUQA 2DFIA 2EA2A 1WN1A 2V6CA 2P9AA 4U69A 4U75A 1PV9A 3CTZA 4S2TP 2GU4A 5D6EA 2BH3A 4PNCA 1WL9A 2BWWA 1KQ0A 1XGSA 2Q95A 4KM3A 2ADUA 1QXZA 2BWSA 4ZWUA 3IU9A 4IF7A 2BWYA 4U6JA 5CDVA 1N51A 5FCFA 4U6WA 4U71A 2GTXA 4U1BA 4IKUA 3S6BA 1YVMA 2EVMA 2Q92A 3PKDA 3RORA 2GGCA 2V3YA 1Y1NA 1WY2A 3IL0A 3IU7A 3MATA 2G6PA 1W2MA 4PV4A 2GG8A 4IECA 1XGNA 2BN7A 1JAWA 4IKRA 2GU7A 2IW2A 2NQ7A 3TB5A 1M35A 3L7GA 1YJ3A 1XGOA 2BWVA 4FO7A 1C27A 2V3ZA 3Q6DA 1C23A 5CNXA 5E5BA 1MATA 1QXYA 1KP0A 3RVAA 4B28A 4S01A 3BIPA 3QOCA 3CB5A 2BWTA 1XGMA 2GU6A 2MATA 2EVCA 4FLIA 1WKMA 2BHAA 1A16A 3MR1A 4S2RP
chains in the Genus database with same CATH superfamily
4U6EA 1WL6A 4S00A 1C21A 1R58A 4FKCA 2V3XA 4Z7MA 3PEBA 4IDYA 3BITA 5E2CA 1R5HA 3CB6A 1BOAA 4FLJA 1YW9A 1C24A 4A6WA 3PN9A 2GA2A 3D27A 4ZWPA 2BWUA 3L24A 1QZYA 1YW8A 2GU5A 2B3HA 3MX6A 3PKBA 2GG3A 2Q8KA 1WLRA 5CDEA 4OOKA 3IU8A 1W7VA 2B3KA 4A6VA 5D6FA 4IU6A 3TAVA 2BHCA 2ZSGA 5FCHA 2OAZA 3FMRA 2Q96A 4RZZA 3IG4A 4R60A 2Q94A 4FO8A 1QXWA 1BN5A 2EVOA 2BWXA 3PKCA 4RZYA 4ZNGA 1B59A 2B3LA 2GG9A 1O0XA 2OKNA 4U70A 3FM3A 1XNZA 2GG2A 3O5VA 4U73A 2GGBA 3I7MA 3PKAA 4FLKA 5JI6A 1WBQA 1B6AA 1C22A 4QR8A 2P98A 3BIQA 4IPAA 2GZ5A 3OVKA 3PKEA 4U6CA 2BHDA 4FLLA 2BB7A 2Q93A 3OOOA 4ZWOA 2GG7A 3FMQA 1YW7A 5JHUA 5CE6A 5CLSA 4IKTA 4U76A 2GG5A 4IKSA 5CIKA 4EGEA 2EA4A 1CHMA 2HOWA 2P99A 4FUKA 5JFRA 4U6ZA 5CDLA 1KQ9A 2GG0A 2BHBA 4HXXA 4RGZ1 1R5GA 2NQ6A 4MATA 4JUQA 2DFIA 2EA2A 1WN1A 2V6CA 2P9AA 4U69A 4U75A 1PV9A 3CTZA 4S2TP 2GU4A 5D6EA 2BH3A 4PNCA 1WL9A 2BWWA 1KQ0A 1XGSA 2Q95A 4KM3A 2ADUA 1QXZA 2BWSA 4ZWUA 3IU9A 4IF7A 2BWYA 4U6JA 5CDVA 1N51A 5FCFA 4U6WA 4U71A 2GTXA 4U1BA 4IKUA 3S6BA 1YVMA 2EVMA 2Q92A 3PKDA 3RORA 2GGCA 2V3YA 1Y1NA 1WY2A 3IL0A 3IU7A 3MATA 2G6PA 1W2MA 4PV4A 2GG8A 4IECA 1XGNA 2BN7A 1JAWA 4IKRA 2GU7A 2IW2A 2NQ7A 3TB5A 1M35A 3L7GA 1YJ3A 1XGOA 2BWVA 4FO7A 1C27A 2V3ZA 3Q6DA 1C23A 5CNXA 5E5BA 1MATA 1QXYA 1KP0A 3RVAA 4B28A 4S01A 3BIPA 3QOCA 3CB5A 2BWTA 1XGMA 2GU6A 2MATA 2EVCA 4FLIA 1WKMA 2BHAA 1A16A 3MR1A 4S2RP
chains in the Genus database with same CATH topology
4U6EA 1WL6A 4S00A 1C21A 1R58A 4FKCA 2V3XA 4Z7MA 3PEBA 4IDYA 3BITA 5E2CA 1R5HA 3CB6A 1BOAA 4FLJA 1YW9A 1C24A 4A6WA 3PN9A 2GA2A 3D27A 4ZWPA 2BWUA 3L24A 1QZYA 1YW8A 2GU5A 2B3HA 3MX6A 3PKBA 2GG3A 2Q8KA 1WLRA 5CDEA 4OOKA 3IU8A 1W7VA 2B3KA 4A6VA 5D6FA 4IU6A 3TAVA 2BHCA 2ZSGA 5FCHA 2OAZA 3FMRA 2Q96A 4RZZA 3IG4A 4R60A 2Q94A 4FO8A 1QXWA 1BN5A 2EVOA 2BWXA 3PKCA 4RZYA 4ZNGA 1B59A 2B3LA 2GG9A 1O0XA 2OKNA 4U70A 3FM3A 1XNZA 2GG2A 3O5VA 4U73A 2GGBA 3I7MA 3PKAA 4FLKA 5JI6A 1WBQA 1B6AA 1C22A 4QR8A 2P98A 3BIQA 4IPAA 2GZ5A 3OVKA 3PKEA 4U6CA 2BHDA 4FLLA 2BB7A 2Q93A 3OOOA 4ZWOA 2GG7A 3FMQA 1YW7A 5JHUA 5CE6A 5CLSA 4IKTA 4U76A 2GG5A 4IKSA 5CIKA 4EGEA 2EA4A 1CHMA 2HOWA 2P99A 4FUKA 5JFRA 4U6ZA 5CDLA 1KQ9A 2GG0A 2BHBA 4HXXA 4RGZ1 1R5GA 2NQ6A 4MATA 4JUQA 2DFIA 2EA2A 1WN1A 2V6CA 2P9AA 4U69A 4U75A 1PV9A 3CTZA 4S2TP 2GU4A 5D6EA 2BH3A 4PNCA 1WL9A 2BWWA 1KQ0A 1XGSA 2Q95A 4KM3A 2ADUA 1QXZA 2BWSA 4ZWUA 3IU9A 4IF7A 2BWYA 4U6JA 5CDVA 1N51A 5FCFA 4U6WA 4U71A 2GTXA 4U1BA 4IKUA 3S6BA 1YVMA 2EVMA 2Q92A 3PKDA 3RORA 2GGCA 2V3YA 1Y1NA 1WY2A 3IL0A 3IU7A 3MATA 2G6PA 1W2MA 4PV4A 2GG8A 4IECA 1XGNA 2BN7A 1JAWA 4IKRA 2GU7A 2IW2A 2NQ7A 3TB5A 1M35A 3L7GA 1YJ3A 1XGOA 2BWVA 4FO7A 1C27A 2V3ZA 3Q6DA 1C23A 5CNXA 5E5BA 1MATA 1QXYA 1KP0A 3RVAA 4B28A 4S01A 3BIPA 3QOCA 3CB5A 2BWTA 1XGMA 2GU6A 2MATA 2EVCA 4FLIA 1WKMA 2BHAA 1A16A 3MR1A 4S2RP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6E A;  1WL6 A;  4S00 A;  1C21 A;  1R58 A;  4FKC A;  2V3X A;  4Z7M A;  3PEB A;  4IDY A;  3BIT A;  5E2C A;  1R5H A;  3CB6 A;  1BOA A;  4FLJ A;  1YW9 A;  1C24 A;  4A6W A;  3PN9 A;  2GA2 A;  3D27 A;  4ZWP A;  2BWU A;  3L24 A;  1QZY A;  1YW8 A;  2GU5 A;  2B3H A;  3MX6 A;  3PKB A;  2GG3 A;  2Q8K A;  1WLR A;  5CDE A;  4OOK A;  3IU8 A;  1W7V A;  2B3K A;  4A6V A;  5D6F A;  4IU6 A;  3TAV A;  2BHC A;  2ZSG A;  5FCH A;  2OAZ A;  3FMR A;  2Q96 A;  4RZZ A;  3IG4 A;  4R60 A;  2Q94 A;  4FO8 A;  1QXW A;  1BN5 A;  2EVO A;  2BWX A;  3PKC A;  4RZY A;  4ZNG A;  1B59 A;  2B3L A;  2GG9 A;  1O0X A;  2OKN A;  4U70 A;  3FM3 A;  1XNZ A;  2GG2 A;  3O5V A;  4U73 A;  2GGB A;  3I7M A;  3PKA A;  4FLK A;  5JI6 A;  1WBQ A;  1B6A A;  1C22 A;  4QR8 A;  2P98 A;  3BIQ A;  4IPA A;  2GZ5 A;  3OVK A;  3PKE A;  4U6C A;  2BHD A;  4FLL A;  2BB7 A;  2Q93 A;  3OOO A;  4ZWO A;  2GG7 A;  3FMQ A;  1YW7 A;  5JHU A;  5CE6 A;  5CLS A;  4IKT A;  4U76 A;  2GG5 A;  4IKS A;  5CIK A;  4EGE A;  2EA4 A;  1CHM A;  2HOW A;  2P99 A;  4FUK A;  5JFR A;  4U6Z A;  5CDL A;  1KQ9 A;  2GG0 A;  2BHB A;  4HXX A;  4RGZ 1;  1R5G A;  2NQ6 A;  4MAT A;  4JUQ A;  2DFI A;  2EA2 A;  1WN1 A;  2V6C A;  2P9A A;  4U69 A;  4U75 A;  1PV9 A;  3CTZ A;  4S2T P;  2GU4 A;  5D6E A;  2BH3 A;  4PNC A;  1WL9 A;  2BWW A;  1KQ0 A;  1XGS A;  2Q95 A;  4KM3 A;  2ADU A;  1QXZ A;  2BWS A;  4ZWU A;  3IU9 A;  4IF7 A;  2BWY A;  4U6J A;  5CDV A;  1N51 A;  5FCF A;  4U6W A;  4U71 A;  2GTX A;  4U1B A;  4IKU A;  3S6B A;  1YVM A;  2EVM A;  2Q92 A;  3PKD A;  3ROR A;  2GGC A;  2V3Y A;  1Y1N A;  1WY2 A;  3IL0 A;  3IU7 A;  3MAT A;  2G6P A;  1W2M A;  4PV4 A;  2GG8 A;  4IEC A;  1XGN A;  2BN7 A;  1JAW A;  4IKR A;  2GU7 A;  2IW2 A;  2NQ7 A;  3TB5 A;  1M35 A;  3L7G A;  1YJ3 A;  1XGO A;  2BWV A;  4FO7 A;  1C27 A;  2V3Z A;  3Q6D A;  1C23 A;  5CNX A;  5E5B A;  1MAT A;  1QXY A;  1KP0 A;  3RVA A;  4B28 A;  4S01 A;  3BIP A;  3QOC A;  3CB5 A;  2BWT A;  1XGM A;  2GU6 A;  2MAT A;  2EVC A;  4FLI A;  1WKM A;  2BHA A;  1A16 A;  3MR1 A;  4S2R P; 
#chains in the Genus database with same CATH topology
 4U6E A;  1WL6 A;  4S00 A;  1C21 A;  1R58 A;  4FKC A;  2V3X A;  4Z7M A;  3PEB A;  4IDY A;  3BIT A;  5E2C A;  1R5H A;  3CB6 A;  1BOA A;  4FLJ A;  1YW9 A;  1C24 A;  4A6W A;  3PN9 A;  2GA2 A;  3D27 A;  4ZWP A;  2BWU A;  3L24 A;  1QZY A;  1YW8 A;  2GU5 A;  2B3H A;  3MX6 A;  3PKB A;  2GG3 A;  2Q8K A;  1WLR A;  5CDE A;  4OOK A;  3IU8 A;  1W7V A;  2B3K A;  4A6V A;  5D6F A;  4IU6 A;  3TAV A;  2BHC A;  2ZSG A;  5FCH A;  2OAZ A;  3FMR A;  2Q96 A;  4RZZ A;  3IG4 A;  4R60 A;  2Q94 A;  4FO8 A;  1QXW A;  1BN5 A;  2EVO A;  2BWX A;  3PKC A;  4RZY A;  4ZNG A;  1B59 A;  2B3L A;  2GG9 A;  1O0X A;  2OKN A;  4U70 A;  3FM3 A;  1XNZ A;  2GG2 A;  3O5V A;  4U73 A;  2GGB A;  3I7M A;  3PKA A;  4FLK A;  5JI6 A;  1WBQ A;  1B6A A;  1C22 A;  4QR8 A;  2P98 A;  3BIQ A;  4IPA A;  2GZ5 A;  3OVK A;  3PKE A;  4U6C A;  2BHD A;  4FLL A;  2BB7 A;  2Q93 A;  3OOO A;  4ZWO A;  2GG7 A;  3FMQ A;  1YW7 A;  5JHU A;  5CE6 A;  5CLS A;  4IKT A;  4U76 A;  2GG5 A;  4IKS A;  5CIK A;  4EGE A;  2EA4 A;  1CHM A;  2HOW A;  2P99 A;  4FUK A;  5JFR A;  4U6Z A;  5CDL A;  1KQ9 A;  2GG0 A;  2BHB A;  4HXX A;  4RGZ 1;  1R5G A;  2NQ6 A;  4MAT A;  4JUQ A;  2DFI A;  2EA2 A;  1WN1 A;  2V6C A;  2P9A A;  4U69 A;  4U75 A;  1PV9 A;  3CTZ A;  4S2T P;  2GU4 A;  5D6E A;  2BH3 A;  4PNC A;  1WL9 A;  2BWW A;  1KQ0 A;  1XGS A;  2Q95 A;  4KM3 A;  2ADU A;  1QXZ A;  2BWS A;  4ZWU A;  3IU9 A;  4IF7 A;  2BWY A;  4U6J A;  5CDV A;  1N51 A;  5FCF A;  4U6W A;  4U71 A;  2GTX A;  4U1B A;  4IKU A;  3S6B A;  1YVM A;  2EVM A;  2Q92 A;  3PKD A;  3ROR A;  2GGC A;  2V3Y A;  1Y1N A;  1WY2 A;  3IL0 A;  3IU7 A;  3MAT A;  2G6P A;  1W2M A;  4PV4 A;  2GG8 A;  4IEC A;  1XGN A;  2BN7 A;  1JAW A;  4IKR A;  2GU7 A;  2IW2 A;  2NQ7 A;  3TB5 A;  1M35 A;  3L7G A;  1YJ3 A;  1XGO A;  2BWV A;  4FO7 A;  1C27 A;  2V3Z A;  3Q6D A;  1C23 A;  5CNX A;  5E5B A;  1MAT A;  1QXY A;  1KP0 A;  3RVA A;  4B28 A;  4S01 A;  3BIP A;  3QOC A;  3CB5 A;  2BWT A;  1XGM A;  2GU6 A;  2MAT A;  2EVC A;  4FLI A;  1WKM A;  2BHA A;  1A16 A;  3MR1 A;  4S2R P; 
#chains in the Genus database with same CATH homology
 4U6E A;  1WL6 A;  4S00 A;  1C21 A;  1R58 A;  4FKC A;  2V3X A;  4Z7M A;  3PEB A;  4IDY A;  3BIT A;  5E2C A;  1R5H A;  3CB6 A;  1BOA A;  4FLJ A;  1YW9 A;  1C24 A;  4A6W A;  3PN9 A;  2GA2 A;  3D27 A;  4ZWP A;  2BWU A;  3L24 A;  1QZY A;  1YW8 A;  2GU5 A;  2B3H A;  3MX6 A;  3PKB A;  2GG3 A;  2Q8K A;  1WLR A;  5CDE A;  4OOK A;  3IU8 A;  1W7V A;  2B3K A;  4A6V A;  5D6F A;  4IU6 A;  3TAV A;  2BHC A;  2ZSG A;  5FCH A;  2OAZ A;  3FMR A;  2Q96 A;  4RZZ A;  3IG4 A;  4R60 A;  2Q94 A;  4FO8 A;  1QXW A;  1BN5 A;  2EVO A;  2BWX A;  3PKC A;  4RZY A;  4ZNG A;  1B59 A;  2B3L A;  2GG9 A;  1O0X A;  2OKN A;  4U70 A;  3FM3 A;  1XNZ A;  2GG2 A;  3O5V A;  4U73 A;  2GGB A;  3I7M A;  3PKA A;  4FLK A;  5JI6 A;  1WBQ A;  1B6A A;  1C22 A;  4QR8 A;  2P98 A;  3BIQ A;  4IPA A;  2GZ5 A;  3OVK A;  3PKE A;  4U6C A;  2BHD A;  4FLL A;  2BB7 A;  2Q93 A;  3OOO A;  4ZWO A;  2GG7 A;  3FMQ A;  1YW7 A;  5JHU A;  5CE6 A;  5CLS A;  4IKT A;  4U76 A;  2GG5 A;  4IKS A;  5CIK A;  4EGE A;  2EA4 A;  1CHM A;  2HOW A;  2P99 A;  4FUK A;  5JFR A;  4U6Z A;  5CDL A;  1KQ9 A;  2GG0 A;  2BHB A;  4HXX A;  4RGZ 1;  1R5G A;  2NQ6 A;  4MAT A;  4JUQ A;  2DFI A;  2EA2 A;  1WN1 A;  2V6C A;  2P9A A;  4U69 A;  4U75 A;  1PV9 A;  3CTZ A;  4S2T P;  2GU4 A;  5D6E A;  2BH3 A;  4PNC A;  1WL9 A;  2BWW A;  1KQ0 A;  1XGS A;  2Q95 A;  4KM3 A;  2ADU A;  1QXZ A;  2BWS A;  4ZWU A;  3IU9 A;  4IF7 A;  2BWY A;  4U6J A;  5CDV A;  1N51 A;  5FCF A;  4U6W A;  4U71 A;  2GTX A;  4U1B A;  4IKU A;  3S6B A;  1YVM A;  2EVM A;  2Q92 A;  3PKD A;  3ROR A;  2GGC A;  2V3Y A;  1Y1N A;  1WY2 A;  3IL0 A;  3IU7 A;  3MAT A;  2G6P A;  1W2M A;  4PV4 A;  2GG8 A;  4IEC A;  1XGN A;  2BN7 A;  1JAW A;  4IKR A;  2GU7 A;  2IW2 A;  2NQ7 A;  3TB5 A;  1M35 A;  3L7G A;  1YJ3 A;  1XGO A;  2BWV A;  4FO7 A;  1C27 A;  2V3Z A;  3Q6D A;  1C23 A;  5CNX A;  5E5B A;  1MAT A;  1QXY A;  1KP0 A;  3RVA A;  4B28 A;  4S01 A;  3BIP A;  3QOC A;  3CB5 A;  2BWT A;  1XGM A;  2GU6 A;  2MAT A;  2EVC A;  4FLI A;  1WKM A;  2BHA A;  1A16 A;  3MR1 A;  4S2R P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...