5CDVA

Proline dipeptidase from deinococcus radiodurans r1
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
349
structure length
349
Chain Sequence
b'SSKMDQLRPVLGRAGVDALWVSAPANVRWLSGFTSAEDGKVLVSPDGATLYTDARYTVQAQEESSLPQYIARPPATYEHAADTVRGLRVGFEAESLTVAELEDLRQAWPNSTLVALRGTLGGLRAVKTPEEIGAIRAAQDLADRVYTEVRPMIRAGVRELDVAVEIETRLRRAGGESAFELIVASGPNGAKPHGHASKRVIEDGDLVTIDMGARLGGYNSDMTRTVAVGTPSAEMKRVYDAVLEAEEAAIAAIRPGVRAADLDKLARDLLTRHGLGEAFAHSLGHGVGLEVHEGPGLRGTSQDVLEAGMVITIEPGAYLPGVGGVRIEDLILVTEDGYEVLSHSAKESV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proline dipeptidase
publication title Proline dipeptidase from Deinococcus radiodurans R1 at 1.45 Angstrom resolution
rcsb
source organism Deinococcus radiodurans (strain atcc 13939 / dsm 20539 / jcm 16871 / lmg 4051 /
molecule tags Hydrolase
total genus 110
structure length 349
sequence length 349
ec nomenclature
pdb deposition date 2015-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 5cdvA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 5cdvA02
4U73A 3IG4A 3PKCA 2BHBA 2P99A 2ZSGA 5FCHA 1YW7A 4FLIA 1R5GA 2GU7A 3IL0A 4U76A 3MR1A 2BWTA 3TAVA 3BITA 2BB7A 2GG2A 3CB5A 4B28A 3BIPA 2Q95A 1C22A 4IU6A 5CLSA 2OKNA 3CB6A 1XGOA 5CDLA 2G6PA 1QXWA 1W7VA 2B3KA 4FUKA 4IKRA 2Q96A 2P98A 4S01A 1BOAA 4PV4A 4EGEA 1BN5A 2Q93A 2V6CA 3RORA 1YJ3A 2EA2A 2NQ7A 1KP0A 5E2CA 3O5VA 4RGZ1 2BH3A 1WL9A 4PNCA 4ZWUA 3RVAA 2ADUA 2DFIA 4U1BA 1QXZA 2BWUA 4ZWPA 2B3LA 3MATA 3PN9A 3D27A 1YW8A 2GG3A 3PEBA 4U6WA 4U69A 1WBQA 5JFRA 2GG0A 4Z7MA 2P9AA 1W2MA 2BWXA 1WLRA 3I7MA 1WY2A 5JI6A 1R5HA 2GG9A 4ZNGA 2Q92A 4U6ZA 4FKCA 3IU8A 3MX6A 4IDYA 4OOKA 1WKMA 2BWSA 4HXXA 2GG8A 2GA2A 4KM3A 2EVCA 3S6BA 2GU4A 4FLKA 2Q94A 3CTZA 1M35A 4IKSA 1C21A 1KQ9A 2NQ6A 4S2TP 3FMRA 4U71A 2GTXA 2GU5A 4RZZA 1YVMA 3PKDA 2GGCA 2V3YA 1C27A 1A16A 1N51A 3L7GA 4FO8A 4IKUA 1JAWA 1B6AA 2EVMA 3QOCA 2BWWA 1B59A 5CNXA 2OAZA 1C23A 4JUQA 1YW9A 2EVOA 5E5BA 2GU6A 5CDEA 2BHCA 2HOWA 4U6EA 1XGMA 1PV9A 1R58A 4FLJA 2GZ5A 4MATA 4IF7A 4RZYA 1XGNA 4S2RP 2BHAA 3PKEA 1QXYA 5CE6A 2GG7A 4U70A 1QZYA 2BWVA 1O0XA 4IKTA 5D6FA 5D6EA 1C24A 3PKBA 5CDVA 1WN1A 3TB5A 5FCFA 1WL6A 1XGSA 5JHUA 1Y1NA 2BN7A 4R60A 2BWYA 2V3XA 2GGBA 3Q6DA 2Q8KA 4U6CA 4A6WA 4S00A 1MATA 3OVKA 2B3HA 4U6JA 2BHDA 4ZWOA 4FO7A 3L24A 3FM3A 4QR8A 2GG5A 1CHMA 3IU7A 3BIQA 5CIKA 4U75A 3PKAA 2V3ZA 3OOOA 2MATA 4FLLA 4IPAA 3FMQA 1XNZA 2IW2A 1KQ0A 4IECA 3IU9A 4A6VA 2EA4A
chains in the Genus database with same CATH superfamily
4U73A 3IG4A 3PKCA 2BHBA 2P99A 2ZSGA 5FCHA 1YW7A 4FLIA 1R5GA 2GU7A 3IL0A 4U76A 3MR1A 2BWTA 3TAVA 3BITA 2BB7A 2GG2A 3CB5A 4B28A 3BIPA 2Q95A 1C22A 4IU6A 5CLSA 2OKNA 3CB6A 1XGOA 5CDLA 2G6PA 1QXWA 1W7VA 2B3KA 4FUKA 4IKRA 2Q96A 2P98A 4S01A 1BOAA 4PV4A 4EGEA 1BN5A 2Q93A 2V6CA 3RORA 1YJ3A 2EA2A 2NQ7A 1KP0A 5E2CA 3O5VA 4RGZ1 2BH3A 1WL9A 4PNCA 4ZWUA 3RVAA 2ADUA 2DFIA 4U1BA 1QXZA 2BWUA 4ZWPA 2B3LA 3MATA 3PN9A 3D27A 1YW8A 2GG3A 3PEBA 4U6WA 4U69A 1WBQA 5JFRA 2GG0A 4Z7MA 2P9AA 1W2MA 2BWXA 1WLRA 3I7MA 1WY2A 5JI6A 1R5HA 2GG9A 4ZNGA 2Q92A 4U6ZA 4FKCA 3IU8A 3MX6A 4IDYA 4OOKA 1WKMA 2BWSA 4HXXA 2GG8A 2GA2A 4KM3A 2EVCA 3S6BA 2GU4A 4FLKA 2Q94A 3CTZA 1M35A 4IKSA 1C21A 1KQ9A 2NQ6A 4S2TP 3FMRA 4U71A 2GTXA 2GU5A 4RZZA 1YVMA 3PKDA 2GGCA 2V3YA 1C27A 1A16A 1N51A 3L7GA 4FO8A 4IKUA 1JAWA 1B6AA 2EVMA 3QOCA 2BWWA 1B59A 5CNXA 2OAZA 1C23A 4JUQA 1YW9A 2EVOA 5E5BA 2GU6A 5CDEA 2BHCA 2HOWA 4U6EA 1XGMA 1PV9A 1R58A 4FLJA 2GZ5A 4MATA 4IF7A 4RZYA 1XGNA 4S2RP 2BHAA 3PKEA 1QXYA 5CE6A 2GG7A 4U70A 1QZYA 2BWVA 1O0XA 4IKTA 5D6FA 5D6EA 1C24A 3PKBA 5CDVA 1WN1A 3TB5A 5FCFA 1WL6A 1XGSA 5JHUA 1Y1NA 2BN7A 4R60A 2BWYA 2V3XA 2GGBA 3Q6DA 2Q8KA 4U6CA 4A6WA 4S00A 1MATA 3OVKA 2B3HA 4U6JA 2BHDA 4ZWOA 4FO7A 3L24A 3FM3A 4QR8A 2GG5A 1CHMA 3IU7A 3BIQA 5CIKA 4U75A 3PKAA 2V3ZA 3OOOA 2MATA 4FLLA 4IPAA 3FMQA 1XNZA 2IW2A 1KQ0A 4IECA 3IU9A 4A6VA 2EA4A
chains in the Genus database with same CATH topology
4U73A 3IG4A 3PKCA 2BHBA 2P99A 2ZSGA 5FCHA 1YW7A 4FLIA 1R5GA 2GU7A 3IL0A 4U76A 3MR1A 2BWTA 3TAVA 3BITA 2BB7A 2GG2A 3CB5A 4B28A 3BIPA 2Q95A 1C22A 4IU6A 5CLSA 2OKNA 3CB6A 1XGOA 5CDLA 2G6PA 1QXWA 1W7VA 2B3KA 4FUKA 4IKRA 2Q96A 2P98A 4S01A 1BOAA 4PV4A 4EGEA 1BN5A 2Q93A 2V6CA 3RORA 1YJ3A 2EA2A 2NQ7A 1KP0A 5E2CA 3O5VA 4RGZ1 2BH3A 1WL9A 4PNCA 4ZWUA 3RVAA 2ADUA 2DFIA 4U1BA 1QXZA 2BWUA 4ZWPA 2B3LA 3MATA 3PN9A 3D27A 1YW8A 2GG3A 3PEBA 4U6WA 4U69A 1WBQA 5JFRA 2GG0A 4Z7MA 2P9AA 1W2MA 2BWXA 1WLRA 3I7MA 1WY2A 5JI6A 1R5HA 2GG9A 4ZNGA 2Q92A 4U6ZA 4FKCA 3IU8A 3MX6A 4IDYA 4OOKA 1WKMA 2BWSA 4HXXA 2GG8A 2GA2A 4KM3A 2EVCA 3S6BA 2GU4A 4FLKA 2Q94A 3CTZA 1M35A 4IKSA 1C21A 1KQ9A 2NQ6A 4S2TP 3FMRA 4U71A 2GTXA 2GU5A 4RZZA 1YVMA 3PKDA 2GGCA 2V3YA 1C27A 1A16A 1N51A 3L7GA 4FO8A 4IKUA 1JAWA 1B6AA 2EVMA 3QOCA 2BWWA 1B59A 5CNXA 2OAZA 1C23A 4JUQA 1YW9A 2EVOA 5E5BA 2GU6A 5CDEA 2BHCA 2HOWA 4U6EA 1XGMA 1PV9A 1R58A 4FLJA 2GZ5A 4MATA 4IF7A 4RZYA 1XGNA 4S2RP 2BHAA 3PKEA 1QXYA 5CE6A 2GG7A 4U70A 1QZYA 2BWVA 1O0XA 4IKTA 5D6FA 5D6EA 1C24A 3PKBA 5CDVA 1WN1A 3TB5A 5FCFA 1WL6A 1XGSA 5JHUA 1Y1NA 2BN7A 4R60A 2BWYA 2V3XA 2GGBA 3Q6DA 2Q8KA 4U6CA 4A6WA 4S00A 1MATA 3OVKA 2B3HA 4U6JA 2BHDA 4ZWOA 4FO7A 3L24A 3FM3A 4QR8A 2GG5A 1CHMA 3IU7A 3BIQA 5CIKA 4U75A 3PKAA 2V3ZA 3OOOA 2MATA 4FLLA 4IPAA 3FMQA 1XNZA 2IW2A 1KQ0A 4IECA 3IU9A 4A6VA 2EA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U73 A;  3IG4 A;  3PKC A;  2BHB A;  2P99 A;  2ZSG A;  5FCH A;  1YW7 A;  4FLI A;  1R5G A;  2GU7 A;  3IL0 A;  4U76 A;  3MR1 A;  2BWT A;  3TAV A;  3BIT A;  2BB7 A;  2GG2 A;  3CB5 A;  4B28 A;  3BIP A;  2Q95 A;  1C22 A;  4IU6 A;  5CLS A;  2OKN A;  3CB6 A;  1XGO A;  5CDL A;  2G6P A;  1QXW A;  1W7V A;  2B3K A;  4FUK A;  4IKR A;  2Q96 A;  2P98 A;  4S01 A;  1BOA A;  4PV4 A;  4EGE A;  1BN5 A;  2Q93 A;  2V6C A;  3ROR A;  1YJ3 A;  2EA2 A;  2NQ7 A;  1KP0 A;  5E2C A;  3O5V A;  4RGZ 1;  2BH3 A;  1WL9 A;  4PNC A;  4ZWU A;  3RVA A;  2ADU A;  2DFI A;  4U1B A;  1QXZ A;  2BWU A;  4ZWP A;  2B3L A;  3MAT A;  3PN9 A;  3D27 A;  1YW8 A;  2GG3 A;  3PEB A;  4U6W A;  4U69 A;  1WBQ A;  5JFR A;  2GG0 A;  4Z7M A;  2P9A A;  1W2M A;  2BWX A;  1WLR A;  3I7M A;  1WY2 A;  5JI6 A;  1R5H A;  2GG9 A;  4ZNG A;  2Q92 A;  4U6Z A;  4FKC A;  3IU8 A;  3MX6 A;  4IDY A;  4OOK A;  1WKM A;  2BWS A;  4HXX A;  2GG8 A;  2GA2 A;  4KM3 A;  2EVC A;  3S6B A;  2GU4 A;  4FLK A;  2Q94 A;  3CTZ A;  1M35 A;  4IKS A;  1C21 A;  1KQ9 A;  2NQ6 A;  4S2T P;  3FMR A;  4U71 A;  2GTX A;  2GU5 A;  4RZZ A;  1YVM A;  3PKD A;  2GGC A;  2V3Y A;  1C27 A;  1A16 A;  1N51 A;  3L7G A;  4FO8 A;  4IKU A;  1JAW A;  1B6A A;  2EVM A;  3QOC A;  2BWW A;  1B59 A;  5CNX A;  2OAZ A;  1C23 A;  4JUQ A;  1YW9 A;  2EVO A;  5E5B A;  2GU6 A;  5CDE A;  2BHC A;  2HOW A;  4U6E A;  1XGM A;  1PV9 A;  1R58 A;  4FLJ A;  2GZ5 A;  4MAT A;  4IF7 A;  4RZY A;  1XGN A;  4S2R P;  2BHA A;  3PKE A;  1QXY A;  5CE6 A;  2GG7 A;  4U70 A;  1QZY A;  2BWV A;  1O0X A;  4IKT A;  5D6F A;  5D6E A;  1C24 A;  3PKB A;  5CDV A;  1WN1 A;  3TB5 A;  5FCF A;  1WL6 A;  1XGS A;  5JHU A;  1Y1N A;  2BN7 A;  4R60 A;  2BWY A;  2V3X A;  2GGB A;  3Q6D A;  2Q8K A;  4U6C A;  4A6W A;  4S00 A;  1MAT A;  3OVK A;  2B3H A;  4U6J A;  2BHD A;  4ZWO A;  4FO7 A;  3L24 A;  3FM3 A;  4QR8 A;  2GG5 A;  1CHM A;  3IU7 A;  3BIQ A;  5CIK A;  4U75 A;  3PKA A;  2V3Z A;  3OOO A;  2MAT A;  4FLL A;  4IPA A;  3FMQ A;  1XNZ A;  2IW2 A;  1KQ0 A;  4IEC A;  3IU9 A;  4A6V A;  2EA4 A; 
#chains in the Genus database with same CATH topology
 4U73 A;  3IG4 A;  3PKC A;  2BHB A;  2P99 A;  2ZSG A;  5FCH A;  1YW7 A;  4FLI A;  1R5G A;  2GU7 A;  3IL0 A;  4U76 A;  3MR1 A;  2BWT A;  3TAV A;  3BIT A;  2BB7 A;  2GG2 A;  3CB5 A;  4B28 A;  3BIP A;  2Q95 A;  1C22 A;  4IU6 A;  5CLS A;  2OKN A;  3CB6 A;  1XGO A;  5CDL A;  2G6P A;  1QXW A;  1W7V A;  2B3K A;  4FUK A;  4IKR A;  2Q96 A;  2P98 A;  4S01 A;  1BOA A;  4PV4 A;  4EGE A;  1BN5 A;  2Q93 A;  2V6C A;  3ROR A;  1YJ3 A;  2EA2 A;  2NQ7 A;  1KP0 A;  5E2C A;  3O5V A;  4RGZ 1;  2BH3 A;  1WL9 A;  4PNC A;  4ZWU A;  3RVA A;  2ADU A;  2DFI A;  4U1B A;  1QXZ A;  2BWU A;  4ZWP A;  2B3L A;  3MAT A;  3PN9 A;  3D27 A;  1YW8 A;  2GG3 A;  3PEB A;  4U6W A;  4U69 A;  1WBQ A;  5JFR A;  2GG0 A;  4Z7M A;  2P9A A;  1W2M A;  2BWX A;  1WLR A;  3I7M A;  1WY2 A;  5JI6 A;  1R5H A;  2GG9 A;  4ZNG A;  2Q92 A;  4U6Z A;  4FKC A;  3IU8 A;  3MX6 A;  4IDY A;  4OOK A;  1WKM A;  2BWS A;  4HXX A;  2GG8 A;  2GA2 A;  4KM3 A;  2EVC A;  3S6B A;  2GU4 A;  4FLK A;  2Q94 A;  3CTZ A;  1M35 A;  4IKS A;  1C21 A;  1KQ9 A;  2NQ6 A;  4S2T P;  3FMR A;  4U71 A;  2GTX A;  2GU5 A;  4RZZ A;  1YVM A;  3PKD A;  2GGC A;  2V3Y A;  1C27 A;  1A16 A;  1N51 A;  3L7G A;  4FO8 A;  4IKU A;  1JAW A;  1B6A A;  2EVM A;  3QOC A;  2BWW A;  1B59 A;  5CNX A;  2OAZ A;  1C23 A;  4JUQ A;  1YW9 A;  2EVO A;  5E5B A;  2GU6 A;  5CDE A;  2BHC A;  2HOW A;  4U6E A;  1XGM A;  1PV9 A;  1R58 A;  4FLJ A;  2GZ5 A;  4MAT A;  4IF7 A;  4RZY A;  1XGN A;  4S2R P;  2BHA A;  3PKE A;  1QXY A;  5CE6 A;  2GG7 A;  4U70 A;  1QZY A;  2BWV A;  1O0X A;  4IKT A;  5D6F A;  5D6E A;  1C24 A;  3PKB A;  5CDV A;  1WN1 A;  3TB5 A;  5FCF A;  1WL6 A;  1XGS A;  5JHU A;  1Y1N A;  2BN7 A;  4R60 A;  2BWY A;  2V3X A;  2GGB A;  3Q6D A;  2Q8K A;  4U6C A;  4A6W A;  4S00 A;  1MAT A;  3OVK A;  2B3H A;  4U6J A;  2BHD A;  4ZWO A;  4FO7 A;  3L24 A;  3FM3 A;  4QR8 A;  2GG5 A;  1CHM A;  3IU7 A;  3BIQ A;  5CIK A;  4U75 A;  3PKA A;  2V3Z A;  3OOO A;  2MAT A;  4FLL A;  4IPA A;  3FMQ A;  1XNZ A;  2IW2 A;  1KQ0 A;  4IEC A;  3IU9 A;  4A6V A;  2EA4 A; 
#chains in the Genus database with same CATH homology
 4U73 A;  3IG4 A;  3PKC A;  2BHB A;  2P99 A;  2ZSG A;  5FCH A;  1YW7 A;  4FLI A;  1R5G A;  2GU7 A;  3IL0 A;  4U76 A;  3MR1 A;  2BWT A;  3TAV A;  3BIT A;  2BB7 A;  2GG2 A;  3CB5 A;  4B28 A;  3BIP A;  2Q95 A;  1C22 A;  4IU6 A;  5CLS A;  2OKN A;  3CB6 A;  1XGO A;  5CDL A;  2G6P A;  1QXW A;  1W7V A;  2B3K A;  4FUK A;  4IKR A;  2Q96 A;  2P98 A;  4S01 A;  1BOA A;  4PV4 A;  4EGE A;  1BN5 A;  2Q93 A;  2V6C A;  3ROR A;  1YJ3 A;  2EA2 A;  2NQ7 A;  1KP0 A;  5E2C A;  3O5V A;  4RGZ 1;  2BH3 A;  1WL9 A;  4PNC A;  4ZWU A;  3RVA A;  2ADU A;  2DFI A;  4U1B A;  1QXZ A;  2BWU A;  4ZWP A;  2B3L A;  3MAT A;  3PN9 A;  3D27 A;  1YW8 A;  2GG3 A;  3PEB A;  4U6W A;  4U69 A;  1WBQ A;  5JFR A;  2GG0 A;  4Z7M A;  2P9A A;  1W2M A;  2BWX A;  1WLR A;  3I7M A;  1WY2 A;  5JI6 A;  1R5H A;  2GG9 A;  4ZNG A;  2Q92 A;  4U6Z A;  4FKC A;  3IU8 A;  3MX6 A;  4IDY A;  4OOK A;  1WKM A;  2BWS A;  4HXX A;  2GG8 A;  2GA2 A;  4KM3 A;  2EVC A;  3S6B A;  2GU4 A;  4FLK A;  2Q94 A;  3CTZ A;  1M35 A;  4IKS A;  1C21 A;  1KQ9 A;  2NQ6 A;  4S2T P;  3FMR A;  4U71 A;  2GTX A;  2GU5 A;  4RZZ A;  1YVM A;  3PKD A;  2GGC A;  2V3Y A;  1C27 A;  1A16 A;  1N51 A;  3L7G A;  4FO8 A;  4IKU A;  1JAW A;  1B6A A;  2EVM A;  3QOC A;  2BWW A;  1B59 A;  5CNX A;  2OAZ A;  1C23 A;  4JUQ A;  1YW9 A;  2EVO A;  5E5B A;  2GU6 A;  5CDE A;  2BHC A;  2HOW A;  4U6E A;  1XGM A;  1PV9 A;  1R58 A;  4FLJ A;  2GZ5 A;  4MAT A;  4IF7 A;  4RZY A;  1XGN A;  4S2R P;  2BHA A;  3PKE A;  1QXY A;  5CE6 A;  2GG7 A;  4U70 A;  1QZY A;  2BWV A;  1O0X A;  4IKT A;  5D6F A;  5D6E A;  1C24 A;  3PKB A;  5CDV A;  1WN1 A;  3TB5 A;  5FCF A;  1WL6 A;  1XGS A;  5JHU A;  1Y1N A;  2BN7 A;  4R60 A;  2BWY A;  2V3X A;  2GGB A;  3Q6D A;  2Q8K A;  4U6C A;  4A6W A;  4S00 A;  1MAT A;  3OVK A;  2B3H A;  4U6J A;  2BHD A;  4ZWO A;  4FO7 A;  3L24 A;  3FM3 A;  4QR8 A;  2GG5 A;  1CHM A;  3IU7 A;  3BIQ A;  5CIK A;  4U75 A;  3PKA A;  2V3Z A;  3OOO A;  2MAT A;  4FLL A;  4IPA A;  3FMQ A;  1XNZ A;  2IW2 A;  1KQ0 A;  4IEC A;  3IU9 A;  4A6V A;  2EA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...