3PEBA

The structure of a creatine_n superfamily domain of a dipeptidase from streptococcus thermophilus.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
b'AMSKLDRIRHFLNENKSGLAIVSDPVTVNYLTGFDCDPHERQMFLFVYENREPALFVPALEVARASSVLDFPVFGYVDSENPWQKIKAGLASTDIPIIYAEFDNLNVTKFQGLQTVFEGRFENLTPFIHKMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidase
publication title The Structure of a Creatine_N Superfamily domain of a dipeptidase from Streptococcus thermophilus.
rcsb
source organism Streptococcus thermophilus
molecule tags Hydrolase
total genus 41
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3pebA00
2BWUA 5FCHA 4RZZA 1N51A 1KP0A 5CIKA 3O5VA 1M35A 3L24A 2BH3A 1WL6A 2BWYA 4RGZ1 1WLRA 4RZYA 2OKNA 3IG4A 4S2TP 5CNXA 2BWVA 4ZNGA 4B28A 3I7MA 2V3ZA 2V3XA 3CB6A 1WBQA 3BIQA 5FCFA 3CB5A 3L7GA 5E5BA 5CE6A 1W2MA 1A16A 3IL0A 4ZWPA 2BHCA 2HOWA 3BITA 2BWTA 2BWWA 4ZWUA 1W7VA 2BN7A 1WN1A 3PN9A 1WL9A 2BWSA 2BHDA 2BWXA 4S01A 3BIPA 5E2CA 3OOOA 2IW2A 4R60A 2ZSGA 5CDVA 1PV9A 3PEBA 4S2RP 3OVKA 2BHBA 2V3YA 5CDEA 2BHAA 5CDLA 3Q6DA 4ZWOA 1CHMA 4QR8A 3CTZA 3RVAA 4FKCA 4EGEA 4PV4A 1JAWA 4S00A 1WY2A 3QOCA
chains in the Genus database with same CATH superfamily
2BWUA 5FCHA 4RZZA 1N51A 1KP0A 5CIKA 3O5VA 1M35A 3L24A 2BH3A 1WL6A 2BWYA 4RGZ1 1WLRA 4RZYA 2OKNA 3IG4A 4S2TP 5CNXA 2BWVA 4ZNGA 4B28A 3I7MA 2V3ZA 2V3XA 3CB6A 1WBQA 3BIQA 5FCFA 3CB5A 3L7GA 5E5BA 5CE6A 1W2MA 1A16A 3IL0A 4ZWPA 2BHCA 2HOWA 3BITA 2BWTA 2BWWA 4ZWUA 1W7VA 2BN7A 1WN1A 3PN9A 1WL9A 2BWSA 2BHDA 2BWXA 4S01A 3BIPA 5E2CA 3OOOA 2IW2A 4R60A 2ZSGA 5CDVA 1PV9A 3PEBA 4S2RP 3OVKA 2BHBA 2V3YA 5CDEA 2BHAA 5CDLA 3Q6DA 4ZWOA 1CHMA 4QR8A 3CTZA 3RVAA 4FKCA 4EGEA 4PV4A 1JAWA 4S00A 1WY2A 3QOCA
chains in the Genus database with same CATH topology
2BWUA 5FCHA 4RZZA 1N51A 1KP0A 5CIKA 3O5VA 1M35A 3L24A 2BH3A 1WL6A 2BWYA 4RGZ1 1WLRA 4RZYA 2OKNA 3IG4A 4S2TP 5CNXA 2BWVA 4ZNGA 4B28A 3I7MA 2V3ZA 2V3XA 3CB6A 1WBQA 3BIQA 5FCFA 3CB5A 3L7GA 5E5BA 5CE6A 1W2MA 1A16A 3IL0A 4ZWPA 2BHCA 2HOWA 3BITA 2BWTA 2BWWA 4ZWUA 1W7VA 2BN7A 1WN1A 3PN9A 1WL9A 2BWSA 2BHDA 2BWXA 4S01A 3BIPA 5E2CA 3OOOA 2IW2A 4R60A 2ZSGA 5CDVA 1PV9A 3PEBA 4S2RP 3OVKA 2BHBA 2V3YA 5CDEA 2BHAA 5CDLA 3Q6DA 4ZWOA 1CHMA 4QR8A 3CTZA 3RVAA 4FKCA 4EGEA 4PV4A 1JAWA 4S00A 1WY2A 3QOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWU A;  5FCH A;  4RZZ A;  1N51 A;  1KP0 A;  5CIK A;  3O5V A;  1M35 A;  3L24 A;  2BH3 A;  1WL6 A;  2BWY A;  4RGZ 1;  1WLR A;  4RZY A;  2OKN A;  3IG4 A;  4S2T P;  5CNX A;  2BWV A;  4ZNG A;  4B28 A;  3I7M A;  2V3Z A;  2V3X A;  3CB6 A;  1WBQ A;  3BIQ A;  5FCF A;  3CB5 A;  3L7G A;  5E5B A;  5CE6 A;  1W2M A;  1A16 A;  3IL0 A;  4ZWP A;  2BHC A;  2HOW A;  3BIT A;  2BWT A;  2BWW A;  4ZWU A;  1W7V A;  2BN7 A;  1WN1 A;  3PN9 A;  1WL9 A;  2BWS A;  2BHD A;  2BWX A;  4S01 A;  3BIP A;  5E2C A;  3OOO A;  2IW2 A;  4R60 A;  2ZSG A;  5CDV A;  1PV9 A;  3PEB A;  4S2R P;  3OVK A;  2BHB A;  2V3Y A;  5CDE A;  2BHA A;  5CDL A;  3Q6D A;  4ZWO A;  1CHM A;  4QR8 A;  3CTZ A;  3RVA A;  4FKC A;  4EGE A;  4PV4 A;  1JAW A;  4S00 A;  1WY2 A;  3QOC A; 
#chains in the Genus database with same CATH topology
 2BWU A;  5FCH A;  4RZZ A;  1N51 A;  1KP0 A;  5CIK A;  3O5V A;  1M35 A;  3L24 A;  2BH3 A;  1WL6 A;  2BWY A;  4RGZ 1;  1WLR A;  4RZY A;  2OKN A;  3IG4 A;  4S2T P;  5CNX A;  2BWV A;  4ZNG A;  4B28 A;  3I7M A;  2V3Z A;  2V3X A;  3CB6 A;  1WBQ A;  3BIQ A;  5FCF A;  3CB5 A;  3L7G A;  5E5B A;  5CE6 A;  1W2M A;  1A16 A;  3IL0 A;  4ZWP A;  2BHC A;  2HOW A;  3BIT A;  2BWT A;  2BWW A;  4ZWU A;  1W7V A;  2BN7 A;  1WN1 A;  3PN9 A;  1WL9 A;  2BWS A;  2BHD A;  2BWX A;  4S01 A;  3BIP A;  5E2C A;  3OOO A;  2IW2 A;  4R60 A;  2ZSG A;  5CDV A;  1PV9 A;  3PEB A;  4S2R P;  3OVK A;  2BHB A;  2V3Y A;  5CDE A;  2BHA A;  5CDL A;  3Q6D A;  4ZWO A;  1CHM A;  4QR8 A;  3CTZ A;  3RVA A;  4FKC A;  4EGE A;  4PV4 A;  1JAW A;  4S00 A;  1WY2 A;  3QOC A; 
#chains in the Genus database with same CATH homology
 2BWU A;  5FCH A;  4RZZ A;  1N51 A;  1KP0 A;  5CIK A;  3O5V A;  1M35 A;  3L24 A;  2BH3 A;  1WL6 A;  2BWY A;  4RGZ 1;  1WLR A;  4RZY A;  2OKN A;  3IG4 A;  4S2T P;  5CNX A;  2BWV A;  4ZNG A;  4B28 A;  3I7M A;  2V3Z A;  2V3X A;  3CB6 A;  1WBQ A;  3BIQ A;  5FCF A;  3CB5 A;  3L7G A;  5E5B A;  5CE6 A;  1W2M A;  1A16 A;  3IL0 A;  4ZWP A;  2BHC A;  2HOW A;  3BIT A;  2BWT A;  2BWW A;  4ZWU A;  1W7V A;  2BN7 A;  1WN1 A;  3PN9 A;  1WL9 A;  2BWS A;  2BHD A;  2BWX A;  4S01 A;  3BIP A;  5E2C A;  3OOO A;  2IW2 A;  4R60 A;  2ZSG A;  5CDV A;  1PV9 A;  3PEB A;  4S2R P;  3OVK A;  2BHB A;  2V3Y A;  5CDE A;  2BHA A;  5CDL A;  3Q6D A;  4ZWO A;  1CHM A;  4QR8 A;  3CTZ A;  3RVA A;  4FKC A;  4EGE A;  4PV4 A;  1JAW A;  4S00 A;  1WY2 A;  3QOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...