3PEBA

The structure of a creatine_n superfamily domain of a dipeptidase from streptococcus thermophilus.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
AMSKLDRIRHFLNENKSGLAIVSDPVTVNYLTGFDCDPHERQMFLFVYENREPALFVPALEVARASSVLDFPVFGYVDSENPWQKIKAGLASTDIPIIYAEFDNLNVTKFQGLQTVFEGRFENLTPFIHKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Dipeptidase
publication title The Structure of a Creatine_N Superfamily domain of a dipeptidase from Streptococcus thermophilus.
rcsb
source organism Streptococcus thermophilus
total genus 41
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3pebA00
2BHDA 3QOCA 5E5BA 4ZWPA 1CHMA 2BWYA 4B28A 5E2CA 4S2TP 5CDLA 5CNXA 3L7GA 3Q6DA 3IL0A 4RZZA 5CDEA 2HOWA 2V3ZA 4FKCA 4RGZ1 3CB6A 1W2MA 4RZYA 2BWSA 3L24A 1WN1A 1JAWA 3RVAA 1N51A 1WBQA 2BWTA 1A16A 2BWXA 1WL9A 2BWVA 2V3YA 2BH3A 4QR8A 4R60A 2BHAA 4S2RP 1WL6A 5FCHA 1KP0A 2IW2A 4EGEA 5CIKA 3BIQA 4S01A 1W7VA 2ZSGA 3O5VA 3I7MA 4PV4A 1WY2A 3PN9A 4S00A 2BN7A 2BWWA 5CE6A 1M35A 3BITA 4ZWUA 2BHBA 4ZNGA 5CDVA 3CTZA 5FCFA 3CB5A 3IG4A 4ZWOA 2V3XA 3OVKA 2OKNA 3BIPA 3OOOA 3PEBA 2BHCA 2BWUA 1PV9A 1WLRA
chains in the Genus database with same CATH superfamily
2BHDA 3QOCA 5E5BA 4ZWPA 1CHMA 2BWYA 4B28A 5E2CA 4S2TP 5CDLA 5CNXA 3L7GA 3Q6DA 3IL0A 4RZZA 5CDEA 2HOWA 2V3ZA 4FKCA 4RGZ1 3CB6A 1W2MA 4RZYA 2BWSA 3L24A 1WN1A 1JAWA 3RVAA 1N51A 1WBQA 2BWTA 1A16A 2BWXA 1WL9A 2BWVA 2V3YA 2BH3A 4QR8A 4R60A 2BHAA 4S2RP 1WL6A 5FCHA 1KP0A 2IW2A 4EGEA 5CIKA 3BIQA 4S01A 1W7VA 2ZSGA 3O5VA 3I7MA 4PV4A 1WY2A 3PN9A 4S00A 2BN7A 2BWWA 5CE6A 1M35A 3BITA 4ZWUA 2BHBA 4ZNGA 5CDVA 3CTZA 5FCFA 3CB5A 3IG4A 4ZWOA 2V3XA 3OVKA 2OKNA 3BIPA 3OOOA 3PEBA 2BHCA 2BWUA 1PV9A 1WLRA
chains in the Genus database with same CATH topology
2BHDA 3QOCA 5E5BA 4ZWPA 1CHMA 2BWYA 4B28A 5E2CA 4S2TP 5CDLA 5CNXA 3L7GA 3Q6DA 3IL0A 4RZZA 5CDEA 2HOWA 2V3ZA 4FKCA 4RGZ1 3CB6A 1W2MA 4RZYA 2BWSA 3L24A 1WN1A 1JAWA 3RVAA 1N51A 1WBQA 2BWTA 1A16A 2BWXA 1WL9A 2BWVA 2V3YA 2BH3A 4QR8A 4R60A 2BHAA 4S2RP 1WL6A 5FCHA 1KP0A 2IW2A 4EGEA 5CIKA 3BIQA 4S01A 1W7VA 2ZSGA 3O5VA 3I7MA 4PV4A 1WY2A 3PN9A 4S00A 2BN7A 2BWWA 5CE6A 1M35A 3BITA 4ZWUA 2BHBA 4ZNGA 5CDVA 3CTZA 5FCFA 3CB5A 3IG4A 4ZWOA 2V3XA 3OVKA 2OKNA 3BIPA 3OOOA 3PEBA 2BHCA 2BWUA 1PV9A 1WLRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHD A;  3QOC A;  5E5B A;  4ZWP A;  1CHM A;  2BWY A;  4B28 A;  5E2C A;  4S2T P;  5CDL A;  5CNX A;  3L7G A;  3Q6D A;  3IL0 A;  4RZZ A;  5CDE A;  2HOW A;  2V3Z A;  4FKC A;  4RGZ 1;  3CB6 A;  1W2M A;  4RZY A;  2BWS A;  3L24 A;  1WN1 A;  1JAW A;  3RVA A;  1N51 A;  1WBQ A;  2BWT A;  1A16 A;  2BWX A;  1WL9 A;  2BWV A;  2V3Y A;  2BH3 A;  4QR8 A;  4R60 A;  2BHA A;  4S2R P;  1WL6 A;  5FCH A;  1KP0 A;  2IW2 A;  4EGE A;  5CIK A;  3BIQ A;  4S01 A;  1W7V A;  2ZSG A;  3O5V A;  3I7M A;  4PV4 A;  1WY2 A;  3PN9 A;  4S00 A;  2BN7 A;  2BWW A;  5CE6 A;  1M35 A;  3BIT A;  4ZWU A;  2BHB A;  4ZNG A;  5CDV A;  3CTZ A;  5FCF A;  3CB5 A;  3IG4 A;  4ZWO A;  2V3X A;  3OVK A;  2OKN A;  3BIP A;  3OOO A;  3PEB A;  2BHC A;  2BWU A;  1PV9 A;  1WLR A; 
#chains in the Genus database with same CATH topology
 2BHD A;  3QOC A;  5E5B A;  4ZWP A;  1CHM A;  2BWY A;  4B28 A;  5E2C A;  4S2T P;  5CDL A;  5CNX A;  3L7G A;  3Q6D A;  3IL0 A;  4RZZ A;  5CDE A;  2HOW A;  2V3Z A;  4FKC A;  4RGZ 1;  3CB6 A;  1W2M A;  4RZY A;  2BWS A;  3L24 A;  1WN1 A;  1JAW A;  3RVA A;  1N51 A;  1WBQ A;  2BWT A;  1A16 A;  2BWX A;  1WL9 A;  2BWV A;  2V3Y A;  2BH3 A;  4QR8 A;  4R60 A;  2BHA A;  4S2R P;  1WL6 A;  5FCH A;  1KP0 A;  2IW2 A;  4EGE A;  5CIK A;  3BIQ A;  4S01 A;  1W7V A;  2ZSG A;  3O5V A;  3I7M A;  4PV4 A;  1WY2 A;  3PN9 A;  4S00 A;  2BN7 A;  2BWW A;  5CE6 A;  1M35 A;  3BIT A;  4ZWU A;  2BHB A;  4ZNG A;  5CDV A;  3CTZ A;  5FCF A;  3CB5 A;  3IG4 A;  4ZWO A;  2V3X A;  3OVK A;  2OKN A;  3BIP A;  3OOO A;  3PEB A;  2BHC A;  2BWU A;  1PV9 A;  1WLR A; 
#chains in the Genus database with same CATH homology
 2BHD A;  3QOC A;  5E5B A;  4ZWP A;  1CHM A;  2BWY A;  4B28 A;  5E2C A;  4S2T P;  5CDL A;  5CNX A;  3L7G A;  3Q6D A;  3IL0 A;  4RZZ A;  5CDE A;  2HOW A;  2V3Z A;  4FKC A;  4RGZ 1;  3CB6 A;  1W2M A;  4RZY A;  2BWS A;  3L24 A;  1WN1 A;  1JAW A;  3RVA A;  1N51 A;  1WBQ A;  2BWT A;  1A16 A;  2BWX A;  1WL9 A;  2BWV A;  2V3Y A;  2BH3 A;  4QR8 A;  4R60 A;  2BHA A;  4S2R P;  1WL6 A;  5FCH A;  1KP0 A;  2IW2 A;  4EGE A;  5CIK A;  3BIQ A;  4S01 A;  1W7V A;  2ZSG A;  3O5V A;  3I7M A;  4PV4 A;  1WY2 A;  3PN9 A;  4S00 A;  2BN7 A;  2BWW A;  5CE6 A;  1M35 A;  3BIT A;  4ZWU A;  2BHB A;  4ZNG A;  5CDV A;  3CTZ A;  5FCF A;  3CB5 A;  3IG4 A;  4ZWO A;  2V3X A;  3OVK A;  2OKN A;  3BIP A;  3OOO A;  3PEB A;  2BHC A;  2BWU A;  1PV9 A;  1WLR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...