3PEBA

The structure of a creatine_n superfamily domain of a dipeptidase from streptococcus thermophilus.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
AMSKLDRIRHFLNENKSGLAIVSDPVTVNYLTGFDCDPHERQMFLFVYENREPALFVPALEVARASSVLDFPVFGYVDSENPWQKIKAGLASTDIPIIYAEFDNLNVTKFQGLQTVFEGRFENLTPFIHKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidase
publication title The Structure of a Creatine_N Superfamily domain of a dipeptidase from Streptococcus thermophilus.
rcsb
source organism Streptococcus thermophilus
molecule tags Hydrolase
total genus 41
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3pebA00
2OKNA 4R60A 4FKCA 4ZWOA 2BWYA 4ZWPA 1WLRA 2BWTA 3BITA 4EGEA 3CB5A 4RZZA 5CDVA 3IL0A 1M35A 4S2RP 1PV9A 2BWVA 3Q6DA 5E5BA 2BN7A 1W2MA 5CE6A 4RZYA 4S2TP 4B28A 4ZNGA 4PV4A 3CTZA 1WL6A 3BIPA 5FCFA 3QOCA 2BH3A 1N51A 3O5VA 5CDLA 1KP0A 3IG4A 3PEBA 1WBQA 1CHMA 2IW2A 2BHDA 5CNXA 4QR8A 5CIKA 3L24A 3PN9A 2BHCA 5CDEA 2BWSA 5E2CA 1WL9A 2BWXA 3L7GA 4S01A 3BIQA 2BWUA 4S00A 2BWWA 3OVKA 3OOOA 2BHAA 1W7VA 1JAWA 2HOWA 2V3XA 5FCHA 1WN1A 3CB6A 3I7MA 4ZWUA 2V3YA 1A16A 4RGZ1 2BHBA 2ZSGA 1WY2A 2V3ZA 3RVAA
chains in the Genus database with same CATH superfamily
2OKNA 4R60A 4FKCA 4ZWOA 2BWYA 4ZWPA 1WLRA 2BWTA 3BITA 4EGEA 3CB5A 4RZZA 5CDVA 3IL0A 1M35A 4S2RP 1PV9A 2BWVA 3Q6DA 5E5BA 2BN7A 1W2MA 5CE6A 4RZYA 4S2TP 4B28A 4ZNGA 4PV4A 3CTZA 1WL6A 3BIPA 5FCFA 3QOCA 2BH3A 1N51A 3O5VA 5CDLA 1KP0A 3IG4A 3PEBA 1WBQA 1CHMA 2IW2A 2BHDA 5CNXA 4QR8A 5CIKA 3L24A 3PN9A 2BHCA 5CDEA 2BWSA 5E2CA 1WL9A 2BWXA 3L7GA 4S01A 3BIQA 2BWUA 4S00A 2BWWA 3OVKA 3OOOA 2BHAA 1W7VA 1JAWA 2HOWA 2V3XA 5FCHA 1WN1A 3CB6A 3I7MA 4ZWUA 2V3YA 1A16A 4RGZ1 2BHBA 2ZSGA 1WY2A 2V3ZA 3RVAA
chains in the Genus database with same CATH topology
2OKNA 4R60A 4FKCA 4ZWOA 2BWYA 4ZWPA 1WLRA 2BWTA 3BITA 4EGEA 3CB5A 4RZZA 5CDVA 3IL0A 1M35A 4S2RP 1PV9A 2BWVA 3Q6DA 5E5BA 2BN7A 1W2MA 5CE6A 4RZYA 4S2TP 4B28A 4ZNGA 4PV4A 3CTZA 1WL6A 3BIPA 5FCFA 3QOCA 2BH3A 1N51A 3O5VA 5CDLA 1KP0A 3IG4A 3PEBA 1WBQA 1CHMA 2IW2A 2BHDA 5CNXA 4QR8A 5CIKA 3L24A 3PN9A 2BHCA 5CDEA 2BWSA 5E2CA 1WL9A 2BWXA 3L7GA 4S01A 3BIQA 2BWUA 4S00A 2BWWA 3OVKA 3OOOA 2BHAA 1W7VA 1JAWA 2HOWA 2V3XA 5FCHA 1WN1A 3CB6A 3I7MA 4ZWUA 2V3YA 1A16A 4RGZ1 2BHBA 2ZSGA 1WY2A 2V3ZA 3RVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OKN A;  4R60 A;  4FKC A;  4ZWO A;  2BWY A;  4ZWP A;  1WLR A;  2BWT A;  3BIT A;  4EGE A;  3CB5 A;  4RZZ A;  5CDV A;  3IL0 A;  1M35 A;  4S2R P;  1PV9 A;  2BWV A;  3Q6D A;  5E5B A;  2BN7 A;  1W2M A;  5CE6 A;  4RZY A;  4S2T P;  4B28 A;  4ZNG A;  4PV4 A;  3CTZ A;  1WL6 A;  3BIP A;  5FCF A;  3QOC A;  2BH3 A;  1N51 A;  3O5V A;  5CDL A;  1KP0 A;  3IG4 A;  3PEB A;  1WBQ A;  1CHM A;  2IW2 A;  2BHD A;  5CNX A;  4QR8 A;  5CIK A;  3L24 A;  3PN9 A;  2BHC A;  5CDE A;  2BWS A;  5E2C A;  1WL9 A;  2BWX A;  3L7G A;  4S01 A;  3BIQ A;  2BWU A;  4S00 A;  2BWW A;  3OVK A;  3OOO A;  2BHA A;  1W7V A;  1JAW A;  2HOW A;  2V3X A;  5FCH A;  1WN1 A;  3CB6 A;  3I7M A;  4ZWU A;  2V3Y A;  1A16 A;  4RGZ 1;  2BHB A;  2ZSG A;  1WY2 A;  2V3Z A;  3RVA A; 
#chains in the Genus database with same CATH topology
 2OKN A;  4R60 A;  4FKC A;  4ZWO A;  2BWY A;  4ZWP A;  1WLR A;  2BWT A;  3BIT A;  4EGE A;  3CB5 A;  4RZZ A;  5CDV A;  3IL0 A;  1M35 A;  4S2R P;  1PV9 A;  2BWV A;  3Q6D A;  5E5B A;  2BN7 A;  1W2M A;  5CE6 A;  4RZY A;  4S2T P;  4B28 A;  4ZNG A;  4PV4 A;  3CTZ A;  1WL6 A;  3BIP A;  5FCF A;  3QOC A;  2BH3 A;  1N51 A;  3O5V A;  5CDL A;  1KP0 A;  3IG4 A;  3PEB A;  1WBQ A;  1CHM A;  2IW2 A;  2BHD A;  5CNX A;  4QR8 A;  5CIK A;  3L24 A;  3PN9 A;  2BHC A;  5CDE A;  2BWS A;  5E2C A;  1WL9 A;  2BWX A;  3L7G A;  4S01 A;  3BIQ A;  2BWU A;  4S00 A;  2BWW A;  3OVK A;  3OOO A;  2BHA A;  1W7V A;  1JAW A;  2HOW A;  2V3X A;  5FCH A;  1WN1 A;  3CB6 A;  3I7M A;  4ZWU A;  2V3Y A;  1A16 A;  4RGZ 1;  2BHB A;  2ZSG A;  1WY2 A;  2V3Z A;  3RVA A; 
#chains in the Genus database with same CATH homology
 2OKN A;  4R60 A;  4FKC A;  4ZWO A;  2BWY A;  4ZWP A;  1WLR A;  2BWT A;  3BIT A;  4EGE A;  3CB5 A;  4RZZ A;  5CDV A;  3IL0 A;  1M35 A;  4S2R P;  1PV9 A;  2BWV A;  3Q6D A;  5E5B A;  2BN7 A;  1W2M A;  5CE6 A;  4RZY A;  4S2T P;  4B28 A;  4ZNG A;  4PV4 A;  3CTZ A;  1WL6 A;  3BIP A;  5FCF A;  3QOC A;  2BH3 A;  1N51 A;  3O5V A;  5CDL A;  1KP0 A;  3IG4 A;  3PEB A;  1WBQ A;  1CHM A;  2IW2 A;  2BHD A;  5CNX A;  4QR8 A;  5CIK A;  3L24 A;  3PN9 A;  2BHC A;  5CDE A;  2BWS A;  5E2C A;  1WL9 A;  2BWX A;  3L7G A;  4S01 A;  3BIQ A;  2BWU A;  4S00 A;  2BWW A;  3OVK A;  3OOO A;  2BHA A;  1W7V A;  1JAW A;  2HOW A;  2V3X A;  5FCH A;  1WN1 A;  3CB6 A;  3I7M A;  4ZWU A;  2V3Y A;  1A16 A;  4RGZ 1;  2BHB A;  2ZSG A;  1WY2 A;  2V3Z A;  3RVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...