3PEBA

The structure of a creatine_n superfamily domain of a dipeptidase from streptococcus thermophilus.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
132
structure length
132
Chain Sequence
AMSKLDRIRHFLNENKSGLAIVSDPVTVNYLTGFDCDPHERQMFLFVYENREPALFVPALEVARASSVLDFPVFGYVDSENPWQKIKAGLASTDIPIIYAEFDNLNVTKFQGLQTVFEGRFENLTPFIHKMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of a Creatine_N Superfamily domain of a dipeptidase from Streptococcus thermophilus.
rcsb
source organism Streptococcus thermophilus
molecule tags Hydrolase
molecule keywords Dipeptidase
total genus 41
structure length 132
sequence length 132
ec nomenclature
pdb deposition date 2010-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3pebA00
3I7MA 1JAWA 4ZWUA 2IW2A 3BIPA 2OKNA 4FKCA 2BH3A 3L24A 4S2TP 2BWUA 2V3XA 3BITA 4S2RP 4ZWPA 1W2MA 1WL6A 3BIQA 1PV9A 2BHAA 4RGZ1 4S00A 3O5VA 4QR8A 1W7VA 4ZNGA 2BWSA 1KP0A 3PEBA 2V3YA 3L7GA 2BWXA 5FCHA 3OVKA 1A16A 4S01A 1WY2A 5CE6A 3CTZA 3CB6A 4ZWOA 1CHMA 3Q6DA 5CDVA 3PN9A 4RZZA 1WL9A 5FCFA 2BWWA 4RZYA 5E5BA 1WBQA 1N51A 1WLRA 3CB5A 4PV4A 3IG4A 5CNXA 3OOOA 4R60A 4B28A 5CIKA 5CDLA 2BHBA 1M35A 5E2CA 2BWVA 3IL0A 1WN1A 2BWYA 5CDEA 2BN7A 3RVAA 2ZSGA 3QOCA 2BHCA 2V3ZA 2BWTA 4EGEA 2HOWA 2BHDA
chains in the Genus database with same CATH superfamily
3I7MA 1JAWA 4ZWUA 2IW2A 3BIPA 2OKNA 4FKCA 2BH3A 3L24A 4S2TP 2BWUA 2V3XA 3BITA 4S2RP 4ZWPA 1W2MA 1WL6A 3BIQA 1PV9A 2BHAA 4RGZ1 4S00A 3O5VA 4QR8A 1W7VA 4ZNGA 2BWSA 1KP0A 3PEBA 2V3YA 3L7GA 2BWXA 5FCHA 3OVKA 1A16A 4S01A 1WY2A 5CE6A 3CTZA 3CB6A 4ZWOA 1CHMA 3Q6DA 5CDVA 3PN9A 4RZZA 1WL9A 5FCFA 2BWWA 4RZYA 5E5BA 1WBQA 1N51A 1WLRA 3CB5A 4PV4A 3IG4A 5CNXA 3OOOA 4R60A 4B28A 5CIKA 5CDLA 2BHBA 1M35A 5E2CA 2BWVA 3IL0A 1WN1A 2BWYA 5CDEA 2BN7A 3RVAA 2ZSGA 3QOCA 2BHCA 2V3ZA 2BWTA 4EGEA 2HOWA 2BHDA
chains in the Genus database with same CATH topology
3I7MA 1JAWA 4ZWUA 2IW2A 3BIPA 2OKNA 4FKCA 2BH3A 3L24A 4S2TP 2BWUA 2V3XA 3BITA 4S2RP 4ZWPA 1W2MA 1WL6A 3BIQA 1PV9A 2BHAA 4RGZ1 4S00A 3O5VA 4QR8A 1W7VA 4ZNGA 2BWSA 1KP0A 3PEBA 2V3YA 3L7GA 2BWXA 5FCHA 3OVKA 1A16A 4S01A 1WY2A 5CE6A 3CTZA 3CB6A 4ZWOA 1CHMA 3Q6DA 5CDVA 3PN9A 4RZZA 1WL9A 5FCFA 2BWWA 4RZYA 5E5BA 1WBQA 1N51A 1WLRA 3CB5A 4PV4A 3IG4A 5CNXA 3OOOA 4R60A 4B28A 5CIKA 5CDLA 2BHBA 1M35A 5E2CA 2BWVA 3IL0A 1WN1A 2BWYA 5CDEA 2BN7A 3RVAA 2ZSGA 3QOCA 2BHCA 2V3ZA 2BWTA 4EGEA 2HOWA 2BHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I7M A;  1JAW A;  4ZWU A;  2IW2 A;  3BIP A;  2OKN A;  4FKC A;  2BH3 A;  3L24 A;  4S2T P;  2BWU A;  2V3X A;  3BIT A;  4S2R P;  4ZWP A;  1W2M A;  1WL6 A;  3BIQ A;  1PV9 A;  2BHA A;  4RGZ 1;  4S00 A;  3O5V A;  4QR8 A;  1W7V A;  4ZNG A;  2BWS A;  1KP0 A;  3PEB A;  2V3Y A;  3L7G A;  2BWX A;  5FCH A;  3OVK A;  1A16 A;  4S01 A;  1WY2 A;  5CE6 A;  3CTZ A;  3CB6 A;  4ZWO A;  1CHM A;  3Q6D A;  5CDV A;  3PN9 A;  4RZZ A;  1WL9 A;  5FCF A;  2BWW A;  4RZY A;  5E5B A;  1WBQ A;  1N51 A;  1WLR A;  3CB5 A;  4PV4 A;  3IG4 A;  5CNX A;  3OOO A;  4R60 A;  4B28 A;  5CIK A;  5CDL A;  2BHB A;  1M35 A;  5E2C A;  2BWV A;  3IL0 A;  1WN1 A;  2BWY A;  5CDE A;  2BN7 A;  3RVA A;  2ZSG A;  3QOC A;  2BHC A;  2V3Z A;  2BWT A;  4EGE A;  2HOW A;  2BHD A; 
#chains in the Genus database with same CATH topology
 3I7M A;  1JAW A;  4ZWU A;  2IW2 A;  3BIP A;  2OKN A;  4FKC A;  2BH3 A;  3L24 A;  4S2T P;  2BWU A;  2V3X A;  3BIT A;  4S2R P;  4ZWP A;  1W2M A;  1WL6 A;  3BIQ A;  1PV9 A;  2BHA A;  4RGZ 1;  4S00 A;  3O5V A;  4QR8 A;  1W7V A;  4ZNG A;  2BWS A;  1KP0 A;  3PEB A;  2V3Y A;  3L7G A;  2BWX A;  5FCH A;  3OVK A;  1A16 A;  4S01 A;  1WY2 A;  5CE6 A;  3CTZ A;  3CB6 A;  4ZWO A;  1CHM A;  3Q6D A;  5CDV A;  3PN9 A;  4RZZ A;  1WL9 A;  5FCF A;  2BWW A;  4RZY A;  5E5B A;  1WBQ A;  1N51 A;  1WLR A;  3CB5 A;  4PV4 A;  3IG4 A;  5CNX A;  3OOO A;  4R60 A;  4B28 A;  5CIK A;  5CDL A;  2BHB A;  1M35 A;  5E2C A;  2BWV A;  3IL0 A;  1WN1 A;  2BWY A;  5CDE A;  2BN7 A;  3RVA A;  2ZSG A;  3QOC A;  2BHC A;  2V3Z A;  2BWT A;  4EGE A;  2HOW A;  2BHD A; 
#chains in the Genus database with same CATH homology
 3I7M A;  1JAW A;  4ZWU A;  2IW2 A;  3BIP A;  2OKN A;  4FKC A;  2BH3 A;  3L24 A;  4S2T P;  2BWU A;  2V3X A;  3BIT A;  4S2R P;  4ZWP A;  1W2M A;  1WL6 A;  3BIQ A;  1PV9 A;  2BHA A;  4RGZ 1;  4S00 A;  3O5V A;  4QR8 A;  1W7V A;  4ZNG A;  2BWS A;  1KP0 A;  3PEB A;  2V3Y A;  3L7G A;  2BWX A;  5FCH A;  3OVK A;  1A16 A;  4S01 A;  1WY2 A;  5CE6 A;  3CTZ A;  3CB6 A;  4ZWO A;  1CHM A;  3Q6D A;  5CDV A;  3PN9 A;  4RZZ A;  1WL9 A;  5FCF A;  2BWW A;  4RZY A;  5E5B A;  1WBQ A;  1N51 A;  1WLR A;  3CB5 A;  4PV4 A;  3IG4 A;  5CNX A;  3OOO A;  4R60 A;  4B28 A;  5CIK A;  5CDL A;  2BHB A;  1M35 A;  5E2C A;  2BWV A;  3IL0 A;  1WN1 A;  2BWY A;  5CDE A;  2BN7 A;  3RVA A;  2ZSG A;  3QOC A;  2BHC A;  2V3Z A;  2BWT A;  4EGE A;  2HOW A;  2BHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...