3BIPA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
444
structure length
444
Chain Sequence
LNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 158
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bipA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bipA02
2Q8KA 1YVMA 3TB5A 3BIPA 2EVMA 2GTXA 5CNXA 2HOWA 2P98A 2ZSGA 1JAWA 2B3KA 1W7VA 4JUQA 3QOCA 2BB7A 1R58A 5CDEA 4IPAA 4RZYA 1XGOA 5D6FA 3FM3A 1C22A 3PKDA 3FMQA 2B3LA 5FCHA 5E5BA 1KQ0A 1YW8A 2GG3A 1N51A 1QXZA 1QXYA 4MATA 4U76A 4U75A 3PKBA 2BWYA 2G6PA 2GU5A 2BHBA 2BWVA 1BOAA 2Q93A 2Q92A 3RVAA 1PV9A 4IECA 2GA2A 1C27A 3IU8A 3CB6A 2BWTA 4U1BA 5FCFA 3Q6DA 4ZWPA 1XGMA 1YW9A 4PNCA 2NQ6A 3OVKA 3CB5A 4A6WA 4FKCA 4S01A 3MX6A 2GG2A 3PEBA 2Q95A 1XGNA 4R60A 3IU7A 4QR8A 1CHMA 1W2MA 4FO7A 4HXXA 1MATA 2BWUA 1C21A 4RZZA 4S2RP 3O5VA 2GG9A 2GGBA 1WL9A 4FLJA 4IKTA 4S2TP 2BHDA 5CIKA 4U6JA 1C24A 4ZWOA 3PKAA 4U73A 5CDVA 2B3HA 5CDLA 1WN1A 2V3XA 2OKNA 1O0XA 1XGSA 2EA2A 4U6ZA 2GG8A 4IF7A 2BHAA 1WY2A 2Q94A 1KP0A 2NQ7A 4IDYA 5CE6A 5JFRA 2IW2A 4IKRA 3PN9A 2GU4A 2BWSA 2EA4A 2GG7A 1QXWA 2ADUA 5CLSA 3IL0A 3S6BA 4FLIA 4U6EA 3OOOA 2EVOA 4FLKA 1Y1NA 2BN7A 4S00A 1C23A 2BHCA 2P99A 4FO8A 1KQ9A 4A6VA 2EVCA 3PKEA 4U6CA 4U69A 3FMRA 4OOKA 2P9AA 4PV4A 1R5GA 2GU6A 2Q96A 1QZYA 2DFIA 4FLLA 1R5HA 3MATA 3I7MA 4ZNGA 3L24A 1WLRA 3IU9A 1BN5A 3TAVA 3IG4A 2BH3A 4U6WA 3RORA 2GG5A 3L7GA 4IKSA 5D6EA 4KM3A 1WBQA 2GGCA 2MATA 4EGEA 2V6CA 5JHUA 4FUKA 3CTZA 2BWXA 2GG0A 2BWWA 5JI6A 2GU7A 3D27A 1M35A 1XNZA 3PKCA 3BITA 1B59A 2GZ5A 3BIQA 1WKMA 4B28A 2OAZA 1YW7A 5E2CA 1YJ3A 4U70A 4IU6A 4ZWUA 1B6AA 2V3YA 1A16A 1WL6A 4IKUA 3MR1A 4Z7MA 4U71A 2V3ZA 4RGZ1
chains in the Genus database with same CATH superfamily
2Q8KA 1YVMA 3TB5A 3BIPA 2EVMA 2GTXA 5CNXA 2HOWA 2P98A 2ZSGA 1JAWA 2B3KA 1W7VA 4JUQA 3QOCA 2BB7A 1R58A 5CDEA 4IPAA 4RZYA 1XGOA 5D6FA 3FM3A 1C22A 3PKDA 3FMQA 2B3LA 5FCHA 5E5BA 1KQ0A 1YW8A 2GG3A 1N51A 1QXZA 1QXYA 4MATA 4U76A 4U75A 3PKBA 2BWYA 2G6PA 2GU5A 2BHBA 2BWVA 1BOAA 2Q93A 2Q92A 3RVAA 1PV9A 4IECA 2GA2A 1C27A 3IU8A 3CB6A 2BWTA 4U1BA 5FCFA 3Q6DA 4ZWPA 1XGMA 1YW9A 4PNCA 2NQ6A 3OVKA 3CB5A 4A6WA 4FKCA 4S01A 3MX6A 2GG2A 3PEBA 2Q95A 1XGNA 4R60A 3IU7A 4QR8A 1CHMA 1W2MA 4FO7A 4HXXA 1MATA 2BWUA 1C21A 4RZZA 4S2RP 3O5VA 2GG9A 2GGBA 1WL9A 4FLJA 4IKTA 4S2TP 2BHDA 5CIKA 4U6JA 1C24A 4ZWOA 3PKAA 4U73A 5CDVA 2B3HA 5CDLA 1WN1A 2V3XA 2OKNA 1O0XA 1XGSA 2EA2A 4U6ZA 2GG8A 4IF7A 2BHAA 1WY2A 2Q94A 1KP0A 2NQ7A 4IDYA 5CE6A 5JFRA 2IW2A 4IKRA 3PN9A 2GU4A 2BWSA 2EA4A 2GG7A 1QXWA 2ADUA 5CLSA 3IL0A 3S6BA 4FLIA 4U6EA 3OOOA 2EVOA 4FLKA 1Y1NA 2BN7A 4S00A 1C23A 2BHCA 2P99A 4FO8A 1KQ9A 4A6VA 2EVCA 3PKEA 4U6CA 4U69A 3FMRA 4OOKA 2P9AA 4PV4A 1R5GA 2GU6A 2Q96A 1QZYA 2DFIA 4FLLA 1R5HA 3MATA 3I7MA 4ZNGA 3L24A 1WLRA 3IU9A 1BN5A 3TAVA 3IG4A 2BH3A 4U6WA 3RORA 2GG5A 3L7GA 4IKSA 5D6EA 4KM3A 1WBQA 2GGCA 2MATA 4EGEA 2V6CA 5JHUA 4FUKA 3CTZA 2BWXA 2GG0A 2BWWA 5JI6A 2GU7A 3D27A 1M35A 1XNZA 3PKCA 3BITA 1B59A 2GZ5A 3BIQA 1WKMA 4B28A 2OAZA 1YW7A 5E2CA 1YJ3A 4U70A 4IU6A 4ZWUA 1B6AA 2V3YA 1A16A 1WL6A 4IKUA 3MR1A 4Z7MA 4U71A 2V3ZA 4RGZ1
chains in the Genus database with same CATH topology
2Q8KA 1YVMA 3TB5A 3BIPA 2EVMA 2GTXA 5CNXA 2HOWA 2P98A 2ZSGA 1JAWA 2B3KA 1W7VA 4JUQA 3QOCA 2BB7A 1R58A 5CDEA 4IPAA 4RZYA 1XGOA 5D6FA 3FM3A 1C22A 3PKDA 3FMQA 2B3LA 5FCHA 5E5BA 1KQ0A 1YW8A 2GG3A 1N51A 1QXZA 1QXYA 4MATA 4U76A 4U75A 3PKBA 2BWYA 2G6PA 2GU5A 2BHBA 2BWVA 1BOAA 2Q93A 2Q92A 3RVAA 1PV9A 4IECA 2GA2A 1C27A 3IU8A 3CB6A 2BWTA 4U1BA 5FCFA 3Q6DA 4ZWPA 1XGMA 1YW9A 4PNCA 2NQ6A 3OVKA 3CB5A 4A6WA 4FKCA 4S01A 3MX6A 2GG2A 3PEBA 2Q95A 1XGNA 4R60A 3IU7A 4QR8A 1CHMA 1W2MA 4FO7A 4HXXA 1MATA 2BWUA 1C21A 4RZZA 4S2RP 3O5VA 2GG9A 2GGBA 1WL9A 4FLJA 4IKTA 4S2TP 2BHDA 5CIKA 4U6JA 1C24A 4ZWOA 3PKAA 4U73A 5CDVA 2B3HA 5CDLA 1WN1A 2V3XA 2OKNA 1O0XA 1XGSA 2EA2A 4U6ZA 2GG8A 4IF7A 2BHAA 1WY2A 2Q94A 1KP0A 2NQ7A 4IDYA 5CE6A 5JFRA 2IW2A 4IKRA 3PN9A 2GU4A 2BWSA 2EA4A 2GG7A 1QXWA 2ADUA 5CLSA 3IL0A 3S6BA 4FLIA 4U6EA 3OOOA 2EVOA 4FLKA 1Y1NA 2BN7A 4S00A 1C23A 2BHCA 2P99A 4FO8A 1KQ9A 4A6VA 2EVCA 3PKEA 4U6CA 4U69A 3FMRA 4OOKA 2P9AA 4PV4A 1R5GA 2GU6A 2Q96A 1QZYA 2DFIA 4FLLA 1R5HA 3MATA 3I7MA 4ZNGA 3L24A 1WLRA 3IU9A 1BN5A 3TAVA 3IG4A 2BH3A 4U6WA 3RORA 2GG5A 3L7GA 4IKSA 5D6EA 4KM3A 1WBQA 2GGCA 2MATA 4EGEA 2V6CA 5JHUA 4FUKA 3CTZA 2BWXA 2GG0A 2BWWA 5JI6A 2GU7A 3D27A 1M35A 1XNZA 3PKCA 3BITA 1B59A 2GZ5A 3BIQA 1WKMA 4B28A 2OAZA 1YW7A 5E2CA 1YJ3A 4U70A 4IU6A 4ZWUA 1B6AA 2V3YA 1A16A 1WL6A 4IKUA 3MR1A 4Z7MA 4U71A 2V3ZA 4RGZ1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8K A;  1YVM A;  3TB5 A;  3BIP A;  2EVM A;  2GTX A;  5CNX A;  2HOW A;  2P98 A;  2ZSG A;  1JAW A;  2B3K A;  1W7V A;  4JUQ A;  3QOC A;  2BB7 A;  1R58 A;  5CDE A;  4IPA A;  4RZY A;  1XGO A;  5D6F A;  3FM3 A;  1C22 A;  3PKD A;  3FMQ A;  2B3L A;  5FCH A;  5E5B A;  1KQ0 A;  1YW8 A;  2GG3 A;  1N51 A;  1QXZ A;  1QXY A;  4MAT A;  4U76 A;  4U75 A;  3PKB A;  2BWY A;  2G6P A;  2GU5 A;  2BHB A;  2BWV A;  1BOA A;  2Q93 A;  2Q92 A;  3RVA A;  1PV9 A;  4IEC A;  2GA2 A;  1C27 A;  3IU8 A;  3CB6 A;  2BWT A;  4U1B A;  5FCF A;  3Q6D A;  4ZWP A;  1XGM A;  1YW9 A;  4PNC A;  2NQ6 A;  3OVK A;  3CB5 A;  4A6W A;  4FKC A;  4S01 A;  3MX6 A;  2GG2 A;  3PEB A;  2Q95 A;  1XGN A;  4R60 A;  3IU7 A;  4QR8 A;  1CHM A;  1W2M A;  4FO7 A;  4HXX A;  1MAT A;  2BWU A;  1C21 A;  4RZZ A;  4S2R P;  3O5V A;  2GG9 A;  2GGB A;  1WL9 A;  4FLJ A;  4IKT A;  4S2T P;  2BHD A;  5CIK A;  4U6J A;  1C24 A;  4ZWO A;  3PKA A;  4U73 A;  5CDV A;  2B3H A;  5CDL A;  1WN1 A;  2V3X A;  2OKN A;  1O0X A;  1XGS A;  2EA2 A;  4U6Z A;  2GG8 A;  4IF7 A;  2BHA A;  1WY2 A;  2Q94 A;  1KP0 A;  2NQ7 A;  4IDY A;  5CE6 A;  5JFR A;  2IW2 A;  4IKR A;  3PN9 A;  2GU4 A;  2BWS A;  2EA4 A;  2GG7 A;  1QXW A;  2ADU A;  5CLS A;  3IL0 A;  3S6B A;  4FLI A;  4U6E A;  3OOO A;  2EVO A;  4FLK A;  1Y1N A;  2BN7 A;  4S00 A;  1C23 A;  2BHC A;  2P99 A;  4FO8 A;  1KQ9 A;  4A6V A;  2EVC A;  3PKE A;  4U6C A;  4U69 A;  3FMR A;  4OOK A;  2P9A A;  4PV4 A;  1R5G A;  2GU6 A;  2Q96 A;  1QZY A;  2DFI A;  4FLL A;  1R5H A;  3MAT A;  3I7M A;  4ZNG A;  3L24 A;  1WLR A;  3IU9 A;  1BN5 A;  3TAV A;  3IG4 A;  2BH3 A;  4U6W A;  3ROR A;  2GG5 A;  3L7G A;  4IKS A;  5D6E A;  4KM3 A;  1WBQ A;  2GGC A;  2MAT A;  4EGE A;  2V6C A;  5JHU A;  4FUK A;  3CTZ A;  2BWX A;  2GG0 A;  2BWW A;  5JI6 A;  2GU7 A;  3D27 A;  1M35 A;  1XNZ A;  3PKC A;  3BIT A;  1B59 A;  2GZ5 A;  3BIQ A;  1WKM A;  4B28 A;  2OAZ A;  1YW7 A;  5E2C A;  1YJ3 A;  4U70 A;  4IU6 A;  4ZWU A;  1B6A A;  2V3Y A;  1A16 A;  1WL6 A;  4IKU A;  3MR1 A;  4Z7M A;  4U71 A;  2V3Z A;  4RGZ 1; 
#chains in the Genus database with same CATH topology
 2Q8K A;  1YVM A;  3TB5 A;  3BIP A;  2EVM A;  2GTX A;  5CNX A;  2HOW A;  2P98 A;  2ZSG A;  1JAW A;  2B3K A;  1W7V A;  4JUQ A;  3QOC A;  2BB7 A;  1R58 A;  5CDE A;  4IPA A;  4RZY A;  1XGO A;  5D6F A;  3FM3 A;  1C22 A;  3PKD A;  3FMQ A;  2B3L A;  5FCH A;  5E5B A;  1KQ0 A;  1YW8 A;  2GG3 A;  1N51 A;  1QXZ A;  1QXY A;  4MAT A;  4U76 A;  4U75 A;  3PKB A;  2BWY A;  2G6P A;  2GU5 A;  2BHB A;  2BWV A;  1BOA A;  2Q93 A;  2Q92 A;  3RVA A;  1PV9 A;  4IEC A;  2GA2 A;  1C27 A;  3IU8 A;  3CB6 A;  2BWT A;  4U1B A;  5FCF A;  3Q6D A;  4ZWP A;  1XGM A;  1YW9 A;  4PNC A;  2NQ6 A;  3OVK A;  3CB5 A;  4A6W A;  4FKC A;  4S01 A;  3MX6 A;  2GG2 A;  3PEB A;  2Q95 A;  1XGN A;  4R60 A;  3IU7 A;  4QR8 A;  1CHM A;  1W2M A;  4FO7 A;  4HXX A;  1MAT A;  2BWU A;  1C21 A;  4RZZ A;  4S2R P;  3O5V A;  2GG9 A;  2GGB A;  1WL9 A;  4FLJ A;  4IKT A;  4S2T P;  2BHD A;  5CIK A;  4U6J A;  1C24 A;  4ZWO A;  3PKA A;  4U73 A;  5CDV A;  2B3H A;  5CDL A;  1WN1 A;  2V3X A;  2OKN A;  1O0X A;  1XGS A;  2EA2 A;  4U6Z A;  2GG8 A;  4IF7 A;  2BHA A;  1WY2 A;  2Q94 A;  1KP0 A;  2NQ7 A;  4IDY A;  5CE6 A;  5JFR A;  2IW2 A;  4IKR A;  3PN9 A;  2GU4 A;  2BWS A;  2EA4 A;  2GG7 A;  1QXW A;  2ADU A;  5CLS A;  3IL0 A;  3S6B A;  4FLI A;  4U6E A;  3OOO A;  2EVO A;  4FLK A;  1Y1N A;  2BN7 A;  4S00 A;  1C23 A;  2BHC A;  2P99 A;  4FO8 A;  1KQ9 A;  4A6V A;  2EVC A;  3PKE A;  4U6C A;  4U69 A;  3FMR A;  4OOK A;  2P9A A;  4PV4 A;  1R5G A;  2GU6 A;  2Q96 A;  1QZY A;  2DFI A;  4FLL A;  1R5H A;  3MAT A;  3I7M A;  4ZNG A;  3L24 A;  1WLR A;  3IU9 A;  1BN5 A;  3TAV A;  3IG4 A;  2BH3 A;  4U6W A;  3ROR A;  2GG5 A;  3L7G A;  4IKS A;  5D6E A;  4KM3 A;  1WBQ A;  2GGC A;  2MAT A;  4EGE A;  2V6C A;  5JHU A;  4FUK A;  3CTZ A;  2BWX A;  2GG0 A;  2BWW A;  5JI6 A;  2GU7 A;  3D27 A;  1M35 A;  1XNZ A;  3PKC A;  3BIT A;  1B59 A;  2GZ5 A;  3BIQ A;  1WKM A;  4B28 A;  2OAZ A;  1YW7 A;  5E2C A;  1YJ3 A;  4U70 A;  4IU6 A;  4ZWU A;  1B6A A;  2V3Y A;  1A16 A;  1WL6 A;  4IKU A;  3MR1 A;  4Z7M A;  4U71 A;  2V3Z A;  4RGZ 1; 
#chains in the Genus database with same CATH homology
 2Q8K A;  1YVM A;  3TB5 A;  3BIP A;  2EVM A;  2GTX A;  5CNX A;  2HOW A;  2P98 A;  2ZSG A;  1JAW A;  2B3K A;  1W7V A;  4JUQ A;  3QOC A;  2BB7 A;  1R58 A;  5CDE A;  4IPA A;  4RZY A;  1XGO A;  5D6F A;  3FM3 A;  1C22 A;  3PKD A;  3FMQ A;  2B3L A;  5FCH A;  5E5B A;  1KQ0 A;  1YW8 A;  2GG3 A;  1N51 A;  1QXZ A;  1QXY A;  4MAT A;  4U76 A;  4U75 A;  3PKB A;  2BWY A;  2G6P A;  2GU5 A;  2BHB A;  2BWV A;  1BOA A;  2Q93 A;  2Q92 A;  3RVA A;  1PV9 A;  4IEC A;  2GA2 A;  1C27 A;  3IU8 A;  3CB6 A;  2BWT A;  4U1B A;  5FCF A;  3Q6D A;  4ZWP A;  1XGM A;  1YW9 A;  4PNC A;  2NQ6 A;  3OVK A;  3CB5 A;  4A6W A;  4FKC A;  4S01 A;  3MX6 A;  2GG2 A;  3PEB A;  2Q95 A;  1XGN A;  4R60 A;  3IU7 A;  4QR8 A;  1CHM A;  1W2M A;  4FO7 A;  4HXX A;  1MAT A;  2BWU A;  1C21 A;  4RZZ A;  4S2R P;  3O5V A;  2GG9 A;  2GGB A;  1WL9 A;  4FLJ A;  4IKT A;  4S2T P;  2BHD A;  5CIK A;  4U6J A;  1C24 A;  4ZWO A;  3PKA A;  4U73 A;  5CDV A;  2B3H A;  5CDL A;  1WN1 A;  2V3X A;  2OKN A;  1O0X A;  1XGS A;  2EA2 A;  4U6Z A;  2GG8 A;  4IF7 A;  2BHA A;  1WY2 A;  2Q94 A;  1KP0 A;  2NQ7 A;  4IDY A;  5CE6 A;  5JFR A;  2IW2 A;  4IKR A;  3PN9 A;  2GU4 A;  2BWS A;  2EA4 A;  2GG7 A;  1QXW A;  2ADU A;  5CLS A;  3IL0 A;  3S6B A;  4FLI A;  4U6E A;  3OOO A;  2EVO A;  4FLK A;  1Y1N A;  2BN7 A;  4S00 A;  1C23 A;  2BHC A;  2P99 A;  4FO8 A;  1KQ9 A;  4A6V A;  2EVC A;  3PKE A;  4U6C A;  4U69 A;  3FMR A;  4OOK A;  2P9A A;  4PV4 A;  1R5G A;  2GU6 A;  2Q96 A;  1QZY A;  2DFI A;  4FLL A;  1R5H A;  3MAT A;  3I7M A;  4ZNG A;  3L24 A;  1WLR A;  3IU9 A;  1BN5 A;  3TAV A;  3IG4 A;  2BH3 A;  4U6W A;  3ROR A;  2GG5 A;  3L7G A;  4IKS A;  5D6E A;  4KM3 A;  1WBQ A;  2GGC A;  2MAT A;  4EGE A;  2V6C A;  5JHU A;  4FUK A;  3CTZ A;  2BWX A;  2GG0 A;  2BWW A;  5JI6 A;  2GU7 A;  3D27 A;  1M35 A;  1XNZ A;  3PKC A;  3BIT A;  1B59 A;  2GZ5 A;  3BIQ A;  1WKM A;  4B28 A;  2OAZ A;  1YW7 A;  5E2C A;  1YJ3 A;  4U70 A;  4IU6 A;  4ZWU A;  1B6A A;  2V3Y A;  1A16 A;  1WL6 A;  4IKU A;  3MR1 A;  4Z7M A;  4U71 A;  2V3Z A;  4RGZ 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...