3BIPA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
444
structure length
444
Chain Sequence
LNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords FACT complex subunit SPT16
total genus 158
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bipA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bipA02
2GG0A 2GG9A 1QXZA 1XGOA 5D6FA 2P9AA 1WN1A 1C27A 5CLSA 2BHDA 2BWYA 4U70A 2BHCA 3PKCA 2GG2A 4IKRA 4IU6A 2GA2A 3MATA 5JFRA 3L24A 2EA2A 4U6EA 1W7VA 5CE6A 2EA4A 1B6AA 1QZYA 2GU4A 2Q94A 4IKTA 4S00A 2P98A 3PKEA 4JUQA 1R58A 2Q8KA 4S2RP 2Q92A 2Q96A 3IG4A 5JHUA 4FKCA 3FM3A 4U6WA 3PN9A 5FCHA 4U6JA 2V3YA 4U69A 2NQ7A 4IDYA 3PKBA 1YW7A 4S2TP 5D6EA 3L7GA 3FMRA 2G6PA 4B28A 2BHAA 1A16A 2ADUA 2EVMA 4ZNGA 1B59A 4PV4A 5JI6A 4A6VA 3PKAA 5CDVA 1WY2A 1BOAA 2ZSGA 3CB5A 1KP0A 3BITA 4KM3A 3OVKA 2BWXA 2GZ5A 1MATA 1C22A 1C24A 4U1BA 3BIQA 2GG8A 1WBQA 4ZWPA 4FO7A 3QOCA 3MX6A 2BN7A 3CB6A 3IL0A 1M35A 2OKNA 4QR8A 2GG7A 1YW8A 3MR1A 2OAZA 2GU7A 3TB5A 4FO8A 4IF7A 1C21A 3PEBA 2BHBA 2GU5A 4U6CA 5CNXA 2V3XA 1N51A 1Y1NA 3IU8A 3OOOA 4FLLA 3Q6DA 1WL6A 4IKUA 2Q93A 5CDLA 1W2MA 2V3ZA 4FLKA 3IU9A 2GU6A 1WKMA 1JAWA 4IECA 4S01A 2BWWA 5CIKA 4U6ZA 4FUKA 4U76A 3O5VA 2GG3A 4U71A 1PV9A 4ZWOA 1YW9A 5E5BA 3BIPA 3RORA 2GGBA 2GTXA 2B3KA 3S6BA 4R60A 3PKDA 4MATA 2GG5A 4RZYA 4A6WA 4RGZ1 4FLJA 4IKSA 2BWSA 2BWTA 2MATA 2V6CA 2HOWA 1KQ9A 5E2CA 2GGCA 4U75A 2BH3A 1KQ0A 1XNZA 1YVMA 1QXYA 3CTZA 2BB7A 1QXWA 1YJ3A 3TAVA 3I7MA 5FCFA 4HXXA 4PNCA 4OOKA 2P99A 1R5HA 4FLIA 1WLRA 2BWUA 3D27A 2BWVA 1BN5A 1WL9A 4IPAA 2DFIA 1C23A 2EVCA 2NQ6A 3RVAA 1R5GA 1XGNA 2B3HA 3FMQA 3IU7A 4U73A 4Z7MA 1XGSA 2IW2A 2EVOA 4RZZA 1O0XA 2Q95A 1CHMA 4EGEA 5CDEA 2B3LA 1XGMA 4ZWUA
chains in the Genus database with same CATH superfamily
2GG0A 2GG9A 1QXZA 1XGOA 5D6FA 2P9AA 1WN1A 1C27A 5CLSA 2BHDA 2BWYA 4U70A 2BHCA 3PKCA 2GG2A 4IKRA 4IU6A 2GA2A 3MATA 5JFRA 3L24A 2EA2A 4U6EA 1W7VA 5CE6A 2EA4A 1B6AA 1QZYA 2GU4A 2Q94A 4IKTA 4S00A 2P98A 3PKEA 4JUQA 1R58A 2Q8KA 4S2RP 2Q92A 2Q96A 3IG4A 5JHUA 4FKCA 3FM3A 4U6WA 3PN9A 5FCHA 4U6JA 2V3YA 4U69A 2NQ7A 4IDYA 3PKBA 1YW7A 4S2TP 5D6EA 3L7GA 3FMRA 2G6PA 4B28A 2BHAA 1A16A 2ADUA 2EVMA 4ZNGA 1B59A 4PV4A 5JI6A 4A6VA 3PKAA 5CDVA 1WY2A 1BOAA 2ZSGA 3CB5A 1KP0A 3BITA 4KM3A 3OVKA 2BWXA 2GZ5A 1MATA 1C22A 1C24A 4U1BA 3BIQA 2GG8A 1WBQA 4ZWPA 4FO7A 3QOCA 3MX6A 2BN7A 3CB6A 3IL0A 1M35A 2OKNA 4QR8A 2GG7A 1YW8A 3MR1A 2OAZA 2GU7A 3TB5A 4FO8A 4IF7A 1C21A 3PEBA 2BHBA 2GU5A 4U6CA 5CNXA 2V3XA 1N51A 1Y1NA 3IU8A 3OOOA 4FLLA 3Q6DA 1WL6A 4IKUA 2Q93A 5CDLA 1W2MA 2V3ZA 4FLKA 3IU9A 2GU6A 1WKMA 1JAWA 4IECA 4S01A 2BWWA 5CIKA 4U6ZA 4FUKA 4U76A 3O5VA 2GG3A 4U71A 1PV9A 4ZWOA 1YW9A 5E5BA 3BIPA 3RORA 2GGBA 2GTXA 2B3KA 3S6BA 4R60A 3PKDA 4MATA 2GG5A 4RZYA 4A6WA 4RGZ1 4FLJA 4IKSA 2BWSA 2BWTA 2MATA 2V6CA 2HOWA 1KQ9A 5E2CA 2GGCA 4U75A 2BH3A 1KQ0A 1XNZA 1YVMA 1QXYA 3CTZA 2BB7A 1QXWA 1YJ3A 3TAVA 3I7MA 5FCFA 4HXXA 4PNCA 4OOKA 2P99A 1R5HA 4FLIA 1WLRA 2BWUA 3D27A 2BWVA 1BN5A 1WL9A 4IPAA 2DFIA 1C23A 2EVCA 2NQ6A 3RVAA 1R5GA 1XGNA 2B3HA 3FMQA 3IU7A 4U73A 4Z7MA 1XGSA 2IW2A 2EVOA 4RZZA 1O0XA 2Q95A 1CHMA 4EGEA 5CDEA 2B3LA 1XGMA 4ZWUA
chains in the Genus database with same CATH topology
2GG0A 2GG9A 1QXZA 1XGOA 5D6FA 2P9AA 1WN1A 1C27A 5CLSA 2BHDA 2BWYA 4U70A 2BHCA 3PKCA 2GG2A 4IKRA 4IU6A 2GA2A 3MATA 5JFRA 3L24A 2EA2A 4U6EA 1W7VA 5CE6A 2EA4A 1B6AA 1QZYA 2GU4A 2Q94A 4IKTA 4S00A 2P98A 3PKEA 4JUQA 1R58A 2Q8KA 4S2RP 2Q92A 2Q96A 3IG4A 5JHUA 4FKCA 3FM3A 4U6WA 3PN9A 5FCHA 4U6JA 2V3YA 4U69A 2NQ7A 4IDYA 3PKBA 1YW7A 4S2TP 5D6EA 3L7GA 3FMRA 2G6PA 4B28A 2BHAA 1A16A 2ADUA 2EVMA 4ZNGA 1B59A 4PV4A 5JI6A 4A6VA 3PKAA 5CDVA 1WY2A 1BOAA 2ZSGA 3CB5A 1KP0A 3BITA 4KM3A 3OVKA 2BWXA 2GZ5A 1MATA 1C22A 1C24A 4U1BA 3BIQA 2GG8A 1WBQA 4ZWPA 4FO7A 3QOCA 3MX6A 2BN7A 3CB6A 3IL0A 1M35A 2OKNA 4QR8A 2GG7A 1YW8A 3MR1A 2OAZA 2GU7A 3TB5A 4FO8A 4IF7A 1C21A 3PEBA 2BHBA 2GU5A 4U6CA 5CNXA 2V3XA 1N51A 1Y1NA 3IU8A 3OOOA 4FLLA 3Q6DA 1WL6A 4IKUA 2Q93A 5CDLA 1W2MA 2V3ZA 4FLKA 3IU9A 2GU6A 1WKMA 1JAWA 4IECA 4S01A 2BWWA 5CIKA 4U6ZA 4FUKA 4U76A 3O5VA 2GG3A 4U71A 1PV9A 4ZWOA 1YW9A 5E5BA 3BIPA 3RORA 2GGBA 2GTXA 2B3KA 3S6BA 4R60A 3PKDA 4MATA 2GG5A 4RZYA 4A6WA 4RGZ1 4FLJA 4IKSA 2BWSA 2BWTA 2MATA 2V6CA 2HOWA 1KQ9A 5E2CA 2GGCA 4U75A 2BH3A 1KQ0A 1XNZA 1YVMA 1QXYA 3CTZA 2BB7A 1QXWA 1YJ3A 3TAVA 3I7MA 5FCFA 4HXXA 4PNCA 4OOKA 2P99A 1R5HA 4FLIA 1WLRA 2BWUA 3D27A 2BWVA 1BN5A 1WL9A 4IPAA 2DFIA 1C23A 2EVCA 2NQ6A 3RVAA 1R5GA 1XGNA 2B3HA 3FMQA 3IU7A 4U73A 4Z7MA 1XGSA 2IW2A 2EVOA 4RZZA 1O0XA 2Q95A 1CHMA 4EGEA 5CDEA 2B3LA 1XGMA 4ZWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG0 A;  2GG9 A;  1QXZ A;  1XGO A;  5D6F A;  2P9A A;  1WN1 A;  1C27 A;  5CLS A;  2BHD A;  2BWY A;  4U70 A;  2BHC A;  3PKC A;  2GG2 A;  4IKR A;  4IU6 A;  2GA2 A;  3MAT A;  5JFR A;  3L24 A;  2EA2 A;  4U6E A;  1W7V A;  5CE6 A;  2EA4 A;  1B6A A;  1QZY A;  2GU4 A;  2Q94 A;  4IKT A;  4S00 A;  2P98 A;  3PKE A;  4JUQ A;  1R58 A;  2Q8K A;  4S2R P;  2Q92 A;  2Q96 A;  3IG4 A;  5JHU A;  4FKC A;  3FM3 A;  4U6W A;  3PN9 A;  5FCH A;  4U6J A;  2V3Y A;  4U69 A;  2NQ7 A;  4IDY A;  3PKB A;  1YW7 A;  4S2T P;  5D6E A;  3L7G A;  3FMR A;  2G6P A;  4B28 A;  2BHA A;  1A16 A;  2ADU A;  2EVM A;  4ZNG A;  1B59 A;  4PV4 A;  5JI6 A;  4A6V A;  3PKA A;  5CDV A;  1WY2 A;  1BOA A;  2ZSG A;  3CB5 A;  1KP0 A;  3BIT A;  4KM3 A;  3OVK A;  2BWX A;  2GZ5 A;  1MAT A;  1C22 A;  1C24 A;  4U1B A;  3BIQ A;  2GG8 A;  1WBQ A;  4ZWP A;  4FO7 A;  3QOC A;  3MX6 A;  2BN7 A;  3CB6 A;  3IL0 A;  1M35 A;  2OKN A;  4QR8 A;  2GG7 A;  1YW8 A;  3MR1 A;  2OAZ A;  2GU7 A;  3TB5 A;  4FO8 A;  4IF7 A;  1C21 A;  3PEB A;  2BHB A;  2GU5 A;  4U6C A;  5CNX A;  2V3X A;  1N51 A;  1Y1N A;  3IU8 A;  3OOO A;  4FLL A;  3Q6D A;  1WL6 A;  4IKU A;  2Q93 A;  5CDL A;  1W2M A;  2V3Z A;  4FLK A;  3IU9 A;  2GU6 A;  1WKM A;  1JAW A;  4IEC A;  4S01 A;  2BWW A;  5CIK A;  4U6Z A;  4FUK A;  4U76 A;  3O5V A;  2GG3 A;  4U71 A;  1PV9 A;  4ZWO A;  1YW9 A;  5E5B A;  3BIP A;  3ROR A;  2GGB A;  2GTX A;  2B3K A;  3S6B A;  4R60 A;  3PKD A;  4MAT A;  2GG5 A;  4RZY A;  4A6W A;  4RGZ 1;  4FLJ A;  4IKS A;  2BWS A;  2BWT A;  2MAT A;  2V6C A;  2HOW A;  1KQ9 A;  5E2C A;  2GGC A;  4U75 A;  2BH3 A;  1KQ0 A;  1XNZ A;  1YVM A;  1QXY A;  3CTZ A;  2BB7 A;  1QXW A;  1YJ3 A;  3TAV A;  3I7M A;  5FCF A;  4HXX A;  4PNC A;  4OOK A;  2P99 A;  1R5H A;  4FLI A;  1WLR A;  2BWU A;  3D27 A;  2BWV A;  1BN5 A;  1WL9 A;  4IPA A;  2DFI A;  1C23 A;  2EVC A;  2NQ6 A;  3RVA A;  1R5G A;  1XGN A;  2B3H A;  3FMQ A;  3IU7 A;  4U73 A;  4Z7M A;  1XGS A;  2IW2 A;  2EVO A;  4RZZ A;  1O0X A;  2Q95 A;  1CHM A;  4EGE A;  5CDE A;  2B3L A;  1XGM A;  4ZWU A; 
#chains in the Genus database with same CATH topology
 2GG0 A;  2GG9 A;  1QXZ A;  1XGO A;  5D6F A;  2P9A A;  1WN1 A;  1C27 A;  5CLS A;  2BHD A;  2BWY A;  4U70 A;  2BHC A;  3PKC A;  2GG2 A;  4IKR A;  4IU6 A;  2GA2 A;  3MAT A;  5JFR A;  3L24 A;  2EA2 A;  4U6E A;  1W7V A;  5CE6 A;  2EA4 A;  1B6A A;  1QZY A;  2GU4 A;  2Q94 A;  4IKT A;  4S00 A;  2P98 A;  3PKE A;  4JUQ A;  1R58 A;  2Q8K A;  4S2R P;  2Q92 A;  2Q96 A;  3IG4 A;  5JHU A;  4FKC A;  3FM3 A;  4U6W A;  3PN9 A;  5FCH A;  4U6J A;  2V3Y A;  4U69 A;  2NQ7 A;  4IDY A;  3PKB A;  1YW7 A;  4S2T P;  5D6E A;  3L7G A;  3FMR A;  2G6P A;  4B28 A;  2BHA A;  1A16 A;  2ADU A;  2EVM A;  4ZNG A;  1B59 A;  4PV4 A;  5JI6 A;  4A6V A;  3PKA A;  5CDV A;  1WY2 A;  1BOA A;  2ZSG A;  3CB5 A;  1KP0 A;  3BIT A;  4KM3 A;  3OVK A;  2BWX A;  2GZ5 A;  1MAT A;  1C22 A;  1C24 A;  4U1B A;  3BIQ A;  2GG8 A;  1WBQ A;  4ZWP A;  4FO7 A;  3QOC A;  3MX6 A;  2BN7 A;  3CB6 A;  3IL0 A;  1M35 A;  2OKN A;  4QR8 A;  2GG7 A;  1YW8 A;  3MR1 A;  2OAZ A;  2GU7 A;  3TB5 A;  4FO8 A;  4IF7 A;  1C21 A;  3PEB A;  2BHB A;  2GU5 A;  4U6C A;  5CNX A;  2V3X A;  1N51 A;  1Y1N A;  3IU8 A;  3OOO A;  4FLL A;  3Q6D A;  1WL6 A;  4IKU A;  2Q93 A;  5CDL A;  1W2M A;  2V3Z A;  4FLK A;  3IU9 A;  2GU6 A;  1WKM A;  1JAW A;  4IEC A;  4S01 A;  2BWW A;  5CIK A;  4U6Z A;  4FUK A;  4U76 A;  3O5V A;  2GG3 A;  4U71 A;  1PV9 A;  4ZWO A;  1YW9 A;  5E5B A;  3BIP A;  3ROR A;  2GGB A;  2GTX A;  2B3K A;  3S6B A;  4R60 A;  3PKD A;  4MAT A;  2GG5 A;  4RZY A;  4A6W A;  4RGZ 1;  4FLJ A;  4IKS A;  2BWS A;  2BWT A;  2MAT A;  2V6C A;  2HOW A;  1KQ9 A;  5E2C A;  2GGC A;  4U75 A;  2BH3 A;  1KQ0 A;  1XNZ A;  1YVM A;  1QXY A;  3CTZ A;  2BB7 A;  1QXW A;  1YJ3 A;  3TAV A;  3I7M A;  5FCF A;  4HXX A;  4PNC A;  4OOK A;  2P99 A;  1R5H A;  4FLI A;  1WLR A;  2BWU A;  3D27 A;  2BWV A;  1BN5 A;  1WL9 A;  4IPA A;  2DFI A;  1C23 A;  2EVC A;  2NQ6 A;  3RVA A;  1R5G A;  1XGN A;  2B3H A;  3FMQ A;  3IU7 A;  4U73 A;  4Z7M A;  1XGS A;  2IW2 A;  2EVO A;  4RZZ A;  1O0X A;  2Q95 A;  1CHM A;  4EGE A;  5CDE A;  2B3L A;  1XGM A;  4ZWU A; 
#chains in the Genus database with same CATH homology
 2GG0 A;  2GG9 A;  1QXZ A;  1XGO A;  5D6F A;  2P9A A;  1WN1 A;  1C27 A;  5CLS A;  2BHD A;  2BWY A;  4U70 A;  2BHC A;  3PKC A;  2GG2 A;  4IKR A;  4IU6 A;  2GA2 A;  3MAT A;  5JFR A;  3L24 A;  2EA2 A;  4U6E A;  1W7V A;  5CE6 A;  2EA4 A;  1B6A A;  1QZY A;  2GU4 A;  2Q94 A;  4IKT A;  4S00 A;  2P98 A;  3PKE A;  4JUQ A;  1R58 A;  2Q8K A;  4S2R P;  2Q92 A;  2Q96 A;  3IG4 A;  5JHU A;  4FKC A;  3FM3 A;  4U6W A;  3PN9 A;  5FCH A;  4U6J A;  2V3Y A;  4U69 A;  2NQ7 A;  4IDY A;  3PKB A;  1YW7 A;  4S2T P;  5D6E A;  3L7G A;  3FMR A;  2G6P A;  4B28 A;  2BHA A;  1A16 A;  2ADU A;  2EVM A;  4ZNG A;  1B59 A;  4PV4 A;  5JI6 A;  4A6V A;  3PKA A;  5CDV A;  1WY2 A;  1BOA A;  2ZSG A;  3CB5 A;  1KP0 A;  3BIT A;  4KM3 A;  3OVK A;  2BWX A;  2GZ5 A;  1MAT A;  1C22 A;  1C24 A;  4U1B A;  3BIQ A;  2GG8 A;  1WBQ A;  4ZWP A;  4FO7 A;  3QOC A;  3MX6 A;  2BN7 A;  3CB6 A;  3IL0 A;  1M35 A;  2OKN A;  4QR8 A;  2GG7 A;  1YW8 A;  3MR1 A;  2OAZ A;  2GU7 A;  3TB5 A;  4FO8 A;  4IF7 A;  1C21 A;  3PEB A;  2BHB A;  2GU5 A;  4U6C A;  5CNX A;  2V3X A;  1N51 A;  1Y1N A;  3IU8 A;  3OOO A;  4FLL A;  3Q6D A;  1WL6 A;  4IKU A;  2Q93 A;  5CDL A;  1W2M A;  2V3Z A;  4FLK A;  3IU9 A;  2GU6 A;  1WKM A;  1JAW A;  4IEC A;  4S01 A;  2BWW A;  5CIK A;  4U6Z A;  4FUK A;  4U76 A;  3O5V A;  2GG3 A;  4U71 A;  1PV9 A;  4ZWO A;  1YW9 A;  5E5B A;  3BIP A;  3ROR A;  2GGB A;  2GTX A;  2B3K A;  3S6B A;  4R60 A;  3PKD A;  4MAT A;  2GG5 A;  4RZY A;  4A6W A;  4RGZ 1;  4FLJ A;  4IKS A;  2BWS A;  2BWT A;  2MAT A;  2V6C A;  2HOW A;  1KQ9 A;  5E2C A;  2GGC A;  4U75 A;  2BH3 A;  1KQ0 A;  1XNZ A;  1YVM A;  1QXY A;  3CTZ A;  2BB7 A;  1QXW A;  1YJ3 A;  3TAV A;  3I7M A;  5FCF A;  4HXX A;  4PNC A;  4OOK A;  2P99 A;  1R5H A;  4FLI A;  1WLR A;  2BWU A;  3D27 A;  2BWV A;  1BN5 A;  1WL9 A;  4IPA A;  2DFI A;  1C23 A;  2EVC A;  2NQ6 A;  3RVA A;  1R5G A;  1XGN A;  2B3H A;  3FMQ A;  3IU7 A;  4U73 A;  4Z7M A;  1XGS A;  2IW2 A;  2EVO A;  4RZZ A;  1O0X A;  2Q95 A;  1CHM A;  4EGE A;  5CDE A;  2B3L A;  1XGM A;  4ZWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...