3BIPA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
444
structure length
444
Chain Sequence
LNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 158
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bipA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bipA02
4U6WA 3PN9A 2GG7A 3OOOA 3CB5A 3RORA 2G6PA 1C23A 3IU7A 4U75A 5JI6A 4B28A 3PKEA 5FCFA 4ZNGA 1M35A 2BWWA 2B3HA 4FLKA 1W7VA 2GGCA 2GU7A 4U6EA 5E5BA 1YJ3A 4ZWOA 2GG0A 2NQ7A 5E2CA 2GG2A 3FM3A 5FCHA 1WBQA 2BHAA 2EA2A 2Q96A 1C21A 2BB7A 4IKRA 4KM3A 4FLJA 4RZZA 4RGZ1 1YW9A 2DFIA 3MATA 4IPAA 3BITA 1QXZA 2Q93A 2Q8KA 4Z7MA 4JUQA 3PEBA 3CTZA 1MATA 2P99A 1XGNA 2V3ZA 4IKSA 5D6EA 1O0XA 4U70A 5CDEA 2Q92A 2P9AA 1R5GA 2EVCA 3FMQA 5CE6A 3IL0A 3IU9A 4OOKA 2GU6A 2Q95A 1XGMA 1WN1A 1WLRA 3QOCA 4R60A 4RZYA 1C22A 2GG8A 3IU8A 3L7GA 1WL6A 3IG4A 1BOAA 4U6ZA 3RVAA 2GU5A 4FO8A 2MATA 3MR1A 1R5HA 5CDVA 2V3XA 3OVKA 4QR8A 2B3KA 1N51A 1R58A 2IW2A 2GZ5A 3FMRA 3S6BA 1KP0A 3BIQA 4FLIA 4U69A 5JHUA 2HOWA 4IECA 4A6WA 3TB5A 2BWUA 4EGEA 2EVMA 3CB6A 3D27A 1W2MA 1CHMA 3Q6DA 2P98A 1C27A 4U71A 4IKTA 2GA2A 2BWYA 2GU4A 4U6JA 3L24A 2BWTA 4HXXA 1XGSA 5JFRA 1JAWA 2BH3A 1XGOA 5CNXA 4U76A 2GG3A 4A6VA 5CDLA 1Y1NA 2BHBA 4ZWPA 3PKBA 4FUKA 2GGBA 4IF7A 4IU6A 3MX6A 1B59A 2B3LA 4IDYA 4FKCA 2GG9A 3BIPA 4U6CA 1KQ0A 1C24A 2ADUA 1XNZA 1PV9A 2ZSGA 3PKDA 2EA4A 2EVOA 4S2RP 2BHDA 2NQ6A 4MATA 1QXYA 1YVMA 1WL9A 1YW8A 1QXWA 4PV4A 3TAVA 4PNCA 1WKMA 3PKCA 1YW7A 4U1BA 1B6AA 5D6FA 2Q94A 4FLLA 1WY2A 2OKNA 2V6CA 4FO7A 4ZWUA 2BWVA 1KQ9A 2BWXA 2BN7A 2BHCA 2BWSA 1QZYA 2GTXA 4U73A 1A16A 2OAZA 3O5VA 2V3YA 4S01A 4IKUA 3I7MA 4S00A 5CIKA 5CLSA 2GG5A 1BN5A 3PKAA 4S2TP
chains in the Genus database with same CATH superfamily
4U6WA 3PN9A 2GG7A 3OOOA 3CB5A 3RORA 2G6PA 1C23A 3IU7A 4U75A 5JI6A 4B28A 3PKEA 5FCFA 4ZNGA 1M35A 2BWWA 2B3HA 4FLKA 1W7VA 2GGCA 2GU7A 4U6EA 5E5BA 1YJ3A 4ZWOA 2GG0A 2NQ7A 5E2CA 2GG2A 3FM3A 5FCHA 1WBQA 2BHAA 2EA2A 2Q96A 1C21A 2BB7A 4IKRA 4KM3A 4FLJA 4RZZA 4RGZ1 1YW9A 2DFIA 3MATA 4IPAA 3BITA 1QXZA 2Q93A 2Q8KA 4Z7MA 4JUQA 3PEBA 3CTZA 1MATA 2P99A 1XGNA 2V3ZA 4IKSA 5D6EA 1O0XA 4U70A 5CDEA 2Q92A 2P9AA 1R5GA 2EVCA 3FMQA 5CE6A 3IL0A 3IU9A 4OOKA 2GU6A 2Q95A 1XGMA 1WN1A 1WLRA 3QOCA 4R60A 4RZYA 1C22A 2GG8A 3IU8A 3L7GA 1WL6A 3IG4A 1BOAA 4U6ZA 3RVAA 2GU5A 4FO8A 2MATA 3MR1A 1R5HA 5CDVA 2V3XA 3OVKA 4QR8A 2B3KA 1N51A 1R58A 2IW2A 2GZ5A 3FMRA 3S6BA 1KP0A 3BIQA 4FLIA 4U69A 5JHUA 2HOWA 4IECA 4A6WA 3TB5A 2BWUA 4EGEA 2EVMA 3CB6A 3D27A 1W2MA 1CHMA 3Q6DA 2P98A 1C27A 4U71A 4IKTA 2GA2A 2BWYA 2GU4A 4U6JA 3L24A 2BWTA 4HXXA 1XGSA 5JFRA 1JAWA 2BH3A 1XGOA 5CNXA 4U76A 2GG3A 4A6VA 5CDLA 1Y1NA 2BHBA 4ZWPA 3PKBA 4FUKA 2GGBA 4IF7A 4IU6A 3MX6A 1B59A 2B3LA 4IDYA 4FKCA 2GG9A 3BIPA 4U6CA 1KQ0A 1C24A 2ADUA 1XNZA 1PV9A 2ZSGA 3PKDA 2EA4A 2EVOA 4S2RP 2BHDA 2NQ6A 4MATA 1QXYA 1YVMA 1WL9A 1YW8A 1QXWA 4PV4A 3TAVA 4PNCA 1WKMA 3PKCA 1YW7A 4U1BA 1B6AA 5D6FA 2Q94A 4FLLA 1WY2A 2OKNA 2V6CA 4FO7A 4ZWUA 2BWVA 1KQ9A 2BWXA 2BN7A 2BHCA 2BWSA 1QZYA 2GTXA 4U73A 1A16A 2OAZA 3O5VA 2V3YA 4S01A 4IKUA 3I7MA 4S00A 5CIKA 5CLSA 2GG5A 1BN5A 3PKAA 4S2TP
chains in the Genus database with same CATH topology
4U6WA 3PN9A 2GG7A 3OOOA 3CB5A 3RORA 2G6PA 1C23A 3IU7A 4U75A 5JI6A 4B28A 3PKEA 5FCFA 4ZNGA 1M35A 2BWWA 2B3HA 4FLKA 1W7VA 2GGCA 2GU7A 4U6EA 5E5BA 1YJ3A 4ZWOA 2GG0A 2NQ7A 5E2CA 2GG2A 3FM3A 5FCHA 1WBQA 2BHAA 2EA2A 2Q96A 1C21A 2BB7A 4IKRA 4KM3A 4FLJA 4RZZA 4RGZ1 1YW9A 2DFIA 3MATA 4IPAA 3BITA 1QXZA 2Q93A 2Q8KA 4Z7MA 4JUQA 3PEBA 3CTZA 1MATA 2P99A 1XGNA 2V3ZA 4IKSA 5D6EA 1O0XA 4U70A 5CDEA 2Q92A 2P9AA 1R5GA 2EVCA 3FMQA 5CE6A 3IL0A 3IU9A 4OOKA 2GU6A 2Q95A 1XGMA 1WN1A 1WLRA 3QOCA 4R60A 4RZYA 1C22A 2GG8A 3IU8A 3L7GA 1WL6A 3IG4A 1BOAA 4U6ZA 3RVAA 2GU5A 4FO8A 2MATA 3MR1A 1R5HA 5CDVA 2V3XA 3OVKA 4QR8A 2B3KA 1N51A 1R58A 2IW2A 2GZ5A 3FMRA 3S6BA 1KP0A 3BIQA 4FLIA 4U69A 5JHUA 2HOWA 4IECA 4A6WA 3TB5A 2BWUA 4EGEA 2EVMA 3CB6A 3D27A 1W2MA 1CHMA 3Q6DA 2P98A 1C27A 4U71A 4IKTA 2GA2A 2BWYA 2GU4A 4U6JA 3L24A 2BWTA 4HXXA 1XGSA 5JFRA 1JAWA 2BH3A 1XGOA 5CNXA 4U76A 2GG3A 4A6VA 5CDLA 1Y1NA 2BHBA 4ZWPA 3PKBA 4FUKA 2GGBA 4IF7A 4IU6A 3MX6A 1B59A 2B3LA 4IDYA 4FKCA 2GG9A 3BIPA 4U6CA 1KQ0A 1C24A 2ADUA 1XNZA 1PV9A 2ZSGA 3PKDA 2EA4A 2EVOA 4S2RP 2BHDA 2NQ6A 4MATA 1QXYA 1YVMA 1WL9A 1YW8A 1QXWA 4PV4A 3TAVA 4PNCA 1WKMA 3PKCA 1YW7A 4U1BA 1B6AA 5D6FA 2Q94A 4FLLA 1WY2A 2OKNA 2V6CA 4FO7A 4ZWUA 2BWVA 1KQ9A 2BWXA 2BN7A 2BHCA 2BWSA 1QZYA 2GTXA 4U73A 1A16A 2OAZA 3O5VA 2V3YA 4S01A 4IKUA 3I7MA 4S00A 5CIKA 5CLSA 2GG5A 1BN5A 3PKAA 4S2TP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U6W A;  3PN9 A;  2GG7 A;  3OOO A;  3CB5 A;  3ROR A;  2G6P A;  1C23 A;  3IU7 A;  4U75 A;  5JI6 A;  4B28 A;  3PKE A;  5FCF A;  4ZNG A;  1M35 A;  2BWW A;  2B3H A;  4FLK A;  1W7V A;  2GGC A;  2GU7 A;  4U6E A;  5E5B A;  1YJ3 A;  4ZWO A;  2GG0 A;  2NQ7 A;  5E2C A;  2GG2 A;  3FM3 A;  5FCH A;  1WBQ A;  2BHA A;  2EA2 A;  2Q96 A;  1C21 A;  2BB7 A;  4IKR A;  4KM3 A;  4FLJ A;  4RZZ A;  4RGZ 1;  1YW9 A;  2DFI A;  3MAT A;  4IPA A;  3BIT A;  1QXZ A;  2Q93 A;  2Q8K A;  4Z7M A;  4JUQ A;  3PEB A;  3CTZ A;  1MAT A;  2P99 A;  1XGN A;  2V3Z A;  4IKS A;  5D6E A;  1O0X A;  4U70 A;  5CDE A;  2Q92 A;  2P9A A;  1R5G A;  2EVC A;  3FMQ A;  5CE6 A;  3IL0 A;  3IU9 A;  4OOK A;  2GU6 A;  2Q95 A;  1XGM A;  1WN1 A;  1WLR A;  3QOC A;  4R60 A;  4RZY A;  1C22 A;  2GG8 A;  3IU8 A;  3L7G A;  1WL6 A;  3IG4 A;  1BOA A;  4U6Z A;  3RVA A;  2GU5 A;  4FO8 A;  2MAT A;  3MR1 A;  1R5H A;  5CDV A;  2V3X A;  3OVK A;  4QR8 A;  2B3K A;  1N51 A;  1R58 A;  2IW2 A;  2GZ5 A;  3FMR A;  3S6B A;  1KP0 A;  3BIQ A;  4FLI A;  4U69 A;  5JHU A;  2HOW A;  4IEC A;  4A6W A;  3TB5 A;  2BWU A;  4EGE A;  2EVM A;  3CB6 A;  3D27 A;  1W2M A;  1CHM A;  3Q6D A;  2P98 A;  1C27 A;  4U71 A;  4IKT A;  2GA2 A;  2BWY A;  2GU4 A;  4U6J A;  3L24 A;  2BWT A;  4HXX A;  1XGS A;  5JFR A;  1JAW A;  2BH3 A;  1XGO A;  5CNX A;  4U76 A;  2GG3 A;  4A6V A;  5CDL A;  1Y1N A;  2BHB A;  4ZWP A;  3PKB A;  4FUK A;  2GGB A;  4IF7 A;  4IU6 A;  3MX6 A;  1B59 A;  2B3L A;  4IDY A;  4FKC A;  2GG9 A;  3BIP A;  4U6C A;  1KQ0 A;  1C24 A;  2ADU A;  1XNZ A;  1PV9 A;  2ZSG A;  3PKD A;  2EA4 A;  2EVO A;  4S2R P;  2BHD A;  2NQ6 A;  4MAT A;  1QXY A;  1YVM A;  1WL9 A;  1YW8 A;  1QXW A;  4PV4 A;  3TAV A;  4PNC A;  1WKM A;  3PKC A;  1YW7 A;  4U1B A;  1B6A A;  5D6F A;  2Q94 A;  4FLL A;  1WY2 A;  2OKN A;  2V6C A;  4FO7 A;  4ZWU A;  2BWV A;  1KQ9 A;  2BWX A;  2BN7 A;  2BHC A;  2BWS A;  1QZY A;  2GTX A;  4U73 A;  1A16 A;  2OAZ A;  3O5V A;  2V3Y A;  4S01 A;  4IKU A;  3I7M A;  4S00 A;  5CIK A;  5CLS A;  2GG5 A;  1BN5 A;  3PKA A;  4S2T P; 
#chains in the Genus database with same CATH topology
 4U6W A;  3PN9 A;  2GG7 A;  3OOO A;  3CB5 A;  3ROR A;  2G6P A;  1C23 A;  3IU7 A;  4U75 A;  5JI6 A;  4B28 A;  3PKE A;  5FCF A;  4ZNG A;  1M35 A;  2BWW A;  2B3H A;  4FLK A;  1W7V A;  2GGC A;  2GU7 A;  4U6E A;  5E5B A;  1YJ3 A;  4ZWO A;  2GG0 A;  2NQ7 A;  5E2C A;  2GG2 A;  3FM3 A;  5FCH A;  1WBQ A;  2BHA A;  2EA2 A;  2Q96 A;  1C21 A;  2BB7 A;  4IKR A;  4KM3 A;  4FLJ A;  4RZZ A;  4RGZ 1;  1YW9 A;  2DFI A;  3MAT A;  4IPA A;  3BIT A;  1QXZ A;  2Q93 A;  2Q8K A;  4Z7M A;  4JUQ A;  3PEB A;  3CTZ A;  1MAT A;  2P99 A;  1XGN A;  2V3Z A;  4IKS A;  5D6E A;  1O0X A;  4U70 A;  5CDE A;  2Q92 A;  2P9A A;  1R5G A;  2EVC A;  3FMQ A;  5CE6 A;  3IL0 A;  3IU9 A;  4OOK A;  2GU6 A;  2Q95 A;  1XGM A;  1WN1 A;  1WLR A;  3QOC A;  4R60 A;  4RZY A;  1C22 A;  2GG8 A;  3IU8 A;  3L7G A;  1WL6 A;  3IG4 A;  1BOA A;  4U6Z A;  3RVA A;  2GU5 A;  4FO8 A;  2MAT A;  3MR1 A;  1R5H A;  5CDV A;  2V3X A;  3OVK A;  4QR8 A;  2B3K A;  1N51 A;  1R58 A;  2IW2 A;  2GZ5 A;  3FMR A;  3S6B A;  1KP0 A;  3BIQ A;  4FLI A;  4U69 A;  5JHU A;  2HOW A;  4IEC A;  4A6W A;  3TB5 A;  2BWU A;  4EGE A;  2EVM A;  3CB6 A;  3D27 A;  1W2M A;  1CHM A;  3Q6D A;  2P98 A;  1C27 A;  4U71 A;  4IKT A;  2GA2 A;  2BWY A;  2GU4 A;  4U6J A;  3L24 A;  2BWT A;  4HXX A;  1XGS A;  5JFR A;  1JAW A;  2BH3 A;  1XGO A;  5CNX A;  4U76 A;  2GG3 A;  4A6V A;  5CDL A;  1Y1N A;  2BHB A;  4ZWP A;  3PKB A;  4FUK A;  2GGB A;  4IF7 A;  4IU6 A;  3MX6 A;  1B59 A;  2B3L A;  4IDY A;  4FKC A;  2GG9 A;  3BIP A;  4U6C A;  1KQ0 A;  1C24 A;  2ADU A;  1XNZ A;  1PV9 A;  2ZSG A;  3PKD A;  2EA4 A;  2EVO A;  4S2R P;  2BHD A;  2NQ6 A;  4MAT A;  1QXY A;  1YVM A;  1WL9 A;  1YW8 A;  1QXW A;  4PV4 A;  3TAV A;  4PNC A;  1WKM A;  3PKC A;  1YW7 A;  4U1B A;  1B6A A;  5D6F A;  2Q94 A;  4FLL A;  1WY2 A;  2OKN A;  2V6C A;  4FO7 A;  4ZWU A;  2BWV A;  1KQ9 A;  2BWX A;  2BN7 A;  2BHC A;  2BWS A;  1QZY A;  2GTX A;  4U73 A;  1A16 A;  2OAZ A;  3O5V A;  2V3Y A;  4S01 A;  4IKU A;  3I7M A;  4S00 A;  5CIK A;  5CLS A;  2GG5 A;  1BN5 A;  3PKA A;  4S2T P; 
#chains in the Genus database with same CATH homology
 4U6W A;  3PN9 A;  2GG7 A;  3OOO A;  3CB5 A;  3ROR A;  2G6P A;  1C23 A;  3IU7 A;  4U75 A;  5JI6 A;  4B28 A;  3PKE A;  5FCF A;  4ZNG A;  1M35 A;  2BWW A;  2B3H A;  4FLK A;  1W7V A;  2GGC A;  2GU7 A;  4U6E A;  5E5B A;  1YJ3 A;  4ZWO A;  2GG0 A;  2NQ7 A;  5E2C A;  2GG2 A;  3FM3 A;  5FCH A;  1WBQ A;  2BHA A;  2EA2 A;  2Q96 A;  1C21 A;  2BB7 A;  4IKR A;  4KM3 A;  4FLJ A;  4RZZ A;  4RGZ 1;  1YW9 A;  2DFI A;  3MAT A;  4IPA A;  3BIT A;  1QXZ A;  2Q93 A;  2Q8K A;  4Z7M A;  4JUQ A;  3PEB A;  3CTZ A;  1MAT A;  2P99 A;  1XGN A;  2V3Z A;  4IKS A;  5D6E A;  1O0X A;  4U70 A;  5CDE A;  2Q92 A;  2P9A A;  1R5G A;  2EVC A;  3FMQ A;  5CE6 A;  3IL0 A;  3IU9 A;  4OOK A;  2GU6 A;  2Q95 A;  1XGM A;  1WN1 A;  1WLR A;  3QOC A;  4R60 A;  4RZY A;  1C22 A;  2GG8 A;  3IU8 A;  3L7G A;  1WL6 A;  3IG4 A;  1BOA A;  4U6Z A;  3RVA A;  2GU5 A;  4FO8 A;  2MAT A;  3MR1 A;  1R5H A;  5CDV A;  2V3X A;  3OVK A;  4QR8 A;  2B3K A;  1N51 A;  1R58 A;  2IW2 A;  2GZ5 A;  3FMR A;  3S6B A;  1KP0 A;  3BIQ A;  4FLI A;  4U69 A;  5JHU A;  2HOW A;  4IEC A;  4A6W A;  3TB5 A;  2BWU A;  4EGE A;  2EVM A;  3CB6 A;  3D27 A;  1W2M A;  1CHM A;  3Q6D A;  2P98 A;  1C27 A;  4U71 A;  4IKT A;  2GA2 A;  2BWY A;  2GU4 A;  4U6J A;  3L24 A;  2BWT A;  4HXX A;  1XGS A;  5JFR A;  1JAW A;  2BH3 A;  1XGO A;  5CNX A;  4U76 A;  2GG3 A;  4A6V A;  5CDL A;  1Y1N A;  2BHB A;  4ZWP A;  3PKB A;  4FUK A;  2GGB A;  4IF7 A;  4IU6 A;  3MX6 A;  1B59 A;  2B3L A;  4IDY A;  4FKC A;  2GG9 A;  3BIP A;  4U6C A;  1KQ0 A;  1C24 A;  2ADU A;  1XNZ A;  1PV9 A;  2ZSG A;  3PKD A;  2EA4 A;  2EVO A;  4S2R P;  2BHD A;  2NQ6 A;  4MAT A;  1QXY A;  1YVM A;  1WL9 A;  1YW8 A;  1QXW A;  4PV4 A;  3TAV A;  4PNC A;  1WKM A;  3PKC A;  1YW7 A;  4U1B A;  1B6A A;  5D6F A;  2Q94 A;  4FLL A;  1WY2 A;  2OKN A;  2V6C A;  4FO7 A;  4ZWU A;  2BWV A;  1KQ9 A;  2BWX A;  2BN7 A;  2BHC A;  2BWS A;  1QZY A;  2GTX A;  4U73 A;  1A16 A;  2OAZ A;  3O5V A;  2V3Y A;  4S01 A;  4IKU A;  3I7M A;  4S00 A;  5CIK A;  5CLS A;  2GG5 A;  1BN5 A;  3PKA A;  4S2T P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...