3BIPA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
444
structure length
444
Chain Sequence
LNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 158
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bipA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bipA02
1KQ9A 3QOCA 5FCFA 5CDEA 4IECA 1QXWA 3S6BA 4QR8A 1BN5A 2V6CA 4FO7A 3TAVA 3MATA 4IKSA 1WLRA 4IKTA 1N51A 2BHBA 4U73A 1WKMA 4MATA 2Q94A 2GU6A 1C21A 2Q92A 1JAWA 2HOWA 3PEBA 5CDVA 4IKUA 4ZWOA 4OOKA 3FMQA 3FM3A 4FKCA 1CHMA 2BH3A 1KP0A 1WBQA 4JUQA 2GG3A 1C22A 2G6PA 5CE6A 3L24A 1R58A 2Q8KA 4S2TP 4U70A 4FLKA 4KM3A 4RGZ1 5E5BA 3FMRA 2GG0A 5JI6A 3IG4A 5CNXA 4HXXA 3IU8A 2B3KA 2GG7A 4Z7MA 2NQ7A 3RVAA 1WN1A 2BWTA 3RORA 2GG2A 2B3HA 1C23A 1KQ0A 1R5GA 1W7VA 2GG8A 3TB5A 2GG9A 2IW2A 2V3ZA 2GG5A 2GTXA 3MR1A 5E2CA 5FCHA 4IF7A 3PKEA 4IKRA 4U1BA 2EVOA 4B28A 3CB6A 3IU7A 1W2MA 3PKAA 4RZZA 2DFIA 2EA2A 2V3XA 4FLIA 2BWYA 3O5VA 1YW8A 2GU4A 2Q93A 4S00A 2GA2A 4IU6A 1XGMA 1B6AA 2MATA 1YVMA 5CLSA 4FLJA 4PV4A 2NQ6A 4S01A 4IPAA 4U6EA 3BIQA 1C27A 3BIPA 4FUKA 5JFRA 4U6JA 3L7GA 2BB7A 3OVKA 1YW9A 1O0XA 1QXYA 2B3LA 2GGCA 2BN7A 1B59A 2BHCA 4FLLA 4U6ZA 2BWSA 5JHUA 3IL0A 4ZWUA 4EGEA 2P99A 1C24A 4A6WA 2P9AA 1Y1NA 3I7MA 2GGBA 3CTZA 3D27A 2Q96A 4U6WA 2EA4A 2V3YA 5D6FA 2EVMA 1R5HA 4FO8A 2GU7A 1XGSA 3OOOA 2Q95A 3IU9A 2BWXA 2GU5A 4ZNGA 5CDLA 4U75A 1A16A 1WY2A 2BHDA 4ZWPA 2P98A 4U71A 4A6VA 4U76A 1YW7A 2BHAA 2GZ5A 3Q6DA 2EVCA 3PN9A 3PKDA 1XGOA 1BOAA 1XNZA 1WL9A 1MATA 2BWVA 2BWWA 2ZSGA 4PNCA 1XGNA 2OAZA 1PV9A 4S2RP 4U69A 5D6EA 3PKBA 1M35A 5CIKA 3BITA 3MX6A 3PKCA 4RZYA 1YJ3A 3CB5A 2ADUA 4U6CA 2BWUA 1WL6A 4IDYA 2OKNA 4R60A 1QZYA 1QXZA
chains in the Genus database with same CATH superfamily
1KQ9A 3QOCA 5FCFA 5CDEA 4IECA 1QXWA 3S6BA 4QR8A 1BN5A 2V6CA 4FO7A 3TAVA 3MATA 4IKSA 1WLRA 4IKTA 1N51A 2BHBA 4U73A 1WKMA 4MATA 2Q94A 2GU6A 1C21A 2Q92A 1JAWA 2HOWA 3PEBA 5CDVA 4IKUA 4ZWOA 4OOKA 3FMQA 3FM3A 4FKCA 1CHMA 2BH3A 1KP0A 1WBQA 4JUQA 2GG3A 1C22A 2G6PA 5CE6A 3L24A 1R58A 2Q8KA 4S2TP 4U70A 4FLKA 4KM3A 4RGZ1 5E5BA 3FMRA 2GG0A 5JI6A 3IG4A 5CNXA 4HXXA 3IU8A 2B3KA 2GG7A 4Z7MA 2NQ7A 3RVAA 1WN1A 2BWTA 3RORA 2GG2A 2B3HA 1C23A 1KQ0A 1R5GA 1W7VA 2GG8A 3TB5A 2GG9A 2IW2A 2V3ZA 2GG5A 2GTXA 3MR1A 5E2CA 5FCHA 4IF7A 3PKEA 4IKRA 4U1BA 2EVOA 4B28A 3CB6A 3IU7A 1W2MA 3PKAA 4RZZA 2DFIA 2EA2A 2V3XA 4FLIA 2BWYA 3O5VA 1YW8A 2GU4A 2Q93A 4S00A 2GA2A 4IU6A 1XGMA 1B6AA 2MATA 1YVMA 5CLSA 4FLJA 4PV4A 2NQ6A 4S01A 4IPAA 4U6EA 3BIQA 1C27A 3BIPA 4FUKA 5JFRA 4U6JA 3L7GA 2BB7A 3OVKA 1YW9A 1O0XA 1QXYA 2B3LA 2GGCA 2BN7A 1B59A 2BHCA 4FLLA 4U6ZA 2BWSA 5JHUA 3IL0A 4ZWUA 4EGEA 2P99A 1C24A 4A6WA 2P9AA 1Y1NA 3I7MA 2GGBA 3CTZA 3D27A 2Q96A 4U6WA 2EA4A 2V3YA 5D6FA 2EVMA 1R5HA 4FO8A 2GU7A 1XGSA 3OOOA 2Q95A 3IU9A 2BWXA 2GU5A 4ZNGA 5CDLA 4U75A 1A16A 1WY2A 2BHDA 4ZWPA 2P98A 4U71A 4A6VA 4U76A 1YW7A 2BHAA 2GZ5A 3Q6DA 2EVCA 3PN9A 3PKDA 1XGOA 1BOAA 1XNZA 1WL9A 1MATA 2BWVA 2BWWA 2ZSGA 4PNCA 1XGNA 2OAZA 1PV9A 4S2RP 4U69A 5D6EA 3PKBA 1M35A 5CIKA 3BITA 3MX6A 3PKCA 4RZYA 1YJ3A 3CB5A 2ADUA 4U6CA 2BWUA 1WL6A 4IDYA 2OKNA 4R60A 1QZYA 1QXZA
chains in the Genus database with same CATH topology
1KQ9A 3QOCA 5FCFA 5CDEA 4IECA 1QXWA 3S6BA 4QR8A 1BN5A 2V6CA 4FO7A 3TAVA 3MATA 4IKSA 1WLRA 4IKTA 1N51A 2BHBA 4U73A 1WKMA 4MATA 2Q94A 2GU6A 1C21A 2Q92A 1JAWA 2HOWA 3PEBA 5CDVA 4IKUA 4ZWOA 4OOKA 3FMQA 3FM3A 4FKCA 1CHMA 2BH3A 1KP0A 1WBQA 4JUQA 2GG3A 1C22A 2G6PA 5CE6A 3L24A 1R58A 2Q8KA 4S2TP 4U70A 4FLKA 4KM3A 4RGZ1 5E5BA 3FMRA 2GG0A 5JI6A 3IG4A 5CNXA 4HXXA 3IU8A 2B3KA 2GG7A 4Z7MA 2NQ7A 3RVAA 1WN1A 2BWTA 3RORA 2GG2A 2B3HA 1C23A 1KQ0A 1R5GA 1W7VA 2GG8A 3TB5A 2GG9A 2IW2A 2V3ZA 2GG5A 2GTXA 3MR1A 5E2CA 5FCHA 4IF7A 3PKEA 4IKRA 4U1BA 2EVOA 4B28A 3CB6A 3IU7A 1W2MA 3PKAA 4RZZA 2DFIA 2EA2A 2V3XA 4FLIA 2BWYA 3O5VA 1YW8A 2GU4A 2Q93A 4S00A 2GA2A 4IU6A 1XGMA 1B6AA 2MATA 1YVMA 5CLSA 4FLJA 4PV4A 2NQ6A 4S01A 4IPAA 4U6EA 3BIQA 1C27A 3BIPA 4FUKA 5JFRA 4U6JA 3L7GA 2BB7A 3OVKA 1YW9A 1O0XA 1QXYA 2B3LA 2GGCA 2BN7A 1B59A 2BHCA 4FLLA 4U6ZA 2BWSA 5JHUA 3IL0A 4ZWUA 4EGEA 2P99A 1C24A 4A6WA 2P9AA 1Y1NA 3I7MA 2GGBA 3CTZA 3D27A 2Q96A 4U6WA 2EA4A 2V3YA 5D6FA 2EVMA 1R5HA 4FO8A 2GU7A 1XGSA 3OOOA 2Q95A 3IU9A 2BWXA 2GU5A 4ZNGA 5CDLA 4U75A 1A16A 1WY2A 2BHDA 4ZWPA 2P98A 4U71A 4A6VA 4U76A 1YW7A 2BHAA 2GZ5A 3Q6DA 2EVCA 3PN9A 3PKDA 1XGOA 1BOAA 1XNZA 1WL9A 1MATA 2BWVA 2BWWA 2ZSGA 4PNCA 1XGNA 2OAZA 1PV9A 4S2RP 4U69A 5D6EA 3PKBA 1M35A 5CIKA 3BITA 3MX6A 3PKCA 4RZYA 1YJ3A 3CB5A 2ADUA 4U6CA 2BWUA 1WL6A 4IDYA 2OKNA 4R60A 1QZYA 1QXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KQ9 A;  3QOC A;  5FCF A;  5CDE A;  4IEC A;  1QXW A;  3S6B A;  4QR8 A;  1BN5 A;  2V6C A;  4FO7 A;  3TAV A;  3MAT A;  4IKS A;  1WLR A;  4IKT A;  1N51 A;  2BHB A;  4U73 A;  1WKM A;  4MAT A;  2Q94 A;  2GU6 A;  1C21 A;  2Q92 A;  1JAW A;  2HOW A;  3PEB A;  5CDV A;  4IKU A;  4ZWO A;  4OOK A;  3FMQ A;  3FM3 A;  4FKC A;  1CHM A;  2BH3 A;  1KP0 A;  1WBQ A;  4JUQ A;  2GG3 A;  1C22 A;  2G6P A;  5CE6 A;  3L24 A;  1R58 A;  2Q8K A;  4S2T P;  4U70 A;  4FLK A;  4KM3 A;  4RGZ 1;  5E5B A;  3FMR A;  2GG0 A;  5JI6 A;  3IG4 A;  5CNX A;  4HXX A;  3IU8 A;  2B3K A;  2GG7 A;  4Z7M A;  2NQ7 A;  3RVA A;  1WN1 A;  2BWT A;  3ROR A;  2GG2 A;  2B3H A;  1C23 A;  1KQ0 A;  1R5G A;  1W7V A;  2GG8 A;  3TB5 A;  2GG9 A;  2IW2 A;  2V3Z A;  2GG5 A;  2GTX A;  3MR1 A;  5E2C A;  5FCH A;  4IF7 A;  3PKE A;  4IKR A;  4U1B A;  2EVO A;  4B28 A;  3CB6 A;  3IU7 A;  1W2M A;  3PKA A;  4RZZ A;  2DFI A;  2EA2 A;  2V3X A;  4FLI A;  2BWY A;  3O5V A;  1YW8 A;  2GU4 A;  2Q93 A;  4S00 A;  2GA2 A;  4IU6 A;  1XGM A;  1B6A A;  2MAT A;  1YVM A;  5CLS A;  4FLJ A;  4PV4 A;  2NQ6 A;  4S01 A;  4IPA A;  4U6E A;  3BIQ A;  1C27 A;  3BIP A;  4FUK A;  5JFR A;  4U6J A;  3L7G A;  2BB7 A;  3OVK A;  1YW9 A;  1O0X A;  1QXY A;  2B3L A;  2GGC A;  2BN7 A;  1B59 A;  2BHC A;  4FLL A;  4U6Z A;  2BWS A;  5JHU A;  3IL0 A;  4ZWU A;  4EGE A;  2P99 A;  1C24 A;  4A6W A;  2P9A A;  1Y1N A;  3I7M A;  2GGB A;  3CTZ A;  3D27 A;  2Q96 A;  4U6W A;  2EA4 A;  2V3Y A;  5D6F A;  2EVM A;  1R5H A;  4FO8 A;  2GU7 A;  1XGS A;  3OOO A;  2Q95 A;  3IU9 A;  2BWX A;  2GU5 A;  4ZNG A;  5CDL A;  4U75 A;  1A16 A;  1WY2 A;  2BHD A;  4ZWP A;  2P98 A;  4U71 A;  4A6V A;  4U76 A;  1YW7 A;  2BHA A;  2GZ5 A;  3Q6D A;  2EVC A;  3PN9 A;  3PKD A;  1XGO A;  1BOA A;  1XNZ A;  1WL9 A;  1MAT A;  2BWV A;  2BWW A;  2ZSG A;  4PNC A;  1XGN A;  2OAZ A;  1PV9 A;  4S2R P;  4U69 A;  5D6E A;  3PKB A;  1M35 A;  5CIK A;  3BIT A;  3MX6 A;  3PKC A;  4RZY A;  1YJ3 A;  3CB5 A;  2ADU A;  4U6C A;  2BWU A;  1WL6 A;  4IDY A;  2OKN A;  4R60 A;  1QZY A;  1QXZ A; 
#chains in the Genus database with same CATH topology
 1KQ9 A;  3QOC A;  5FCF A;  5CDE A;  4IEC A;  1QXW A;  3S6B A;  4QR8 A;  1BN5 A;  2V6C A;  4FO7 A;  3TAV A;  3MAT A;  4IKS A;  1WLR A;  4IKT A;  1N51 A;  2BHB A;  4U73 A;  1WKM A;  4MAT A;  2Q94 A;  2GU6 A;  1C21 A;  2Q92 A;  1JAW A;  2HOW A;  3PEB A;  5CDV A;  4IKU A;  4ZWO A;  4OOK A;  3FMQ A;  3FM3 A;  4FKC A;  1CHM A;  2BH3 A;  1KP0 A;  1WBQ A;  4JUQ A;  2GG3 A;  1C22 A;  2G6P A;  5CE6 A;  3L24 A;  1R58 A;  2Q8K A;  4S2T P;  4U70 A;  4FLK A;  4KM3 A;  4RGZ 1;  5E5B A;  3FMR A;  2GG0 A;  5JI6 A;  3IG4 A;  5CNX A;  4HXX A;  3IU8 A;  2B3K A;  2GG7 A;  4Z7M A;  2NQ7 A;  3RVA A;  1WN1 A;  2BWT A;  3ROR A;  2GG2 A;  2B3H A;  1C23 A;  1KQ0 A;  1R5G A;  1W7V A;  2GG8 A;  3TB5 A;  2GG9 A;  2IW2 A;  2V3Z A;  2GG5 A;  2GTX A;  3MR1 A;  5E2C A;  5FCH A;  4IF7 A;  3PKE A;  4IKR A;  4U1B A;  2EVO A;  4B28 A;  3CB6 A;  3IU7 A;  1W2M A;  3PKA A;  4RZZ A;  2DFI A;  2EA2 A;  2V3X A;  4FLI A;  2BWY A;  3O5V A;  1YW8 A;  2GU4 A;  2Q93 A;  4S00 A;  2GA2 A;  4IU6 A;  1XGM A;  1B6A A;  2MAT A;  1YVM A;  5CLS A;  4FLJ A;  4PV4 A;  2NQ6 A;  4S01 A;  4IPA A;  4U6E A;  3BIQ A;  1C27 A;  3BIP A;  4FUK A;  5JFR A;  4U6J A;  3L7G A;  2BB7 A;  3OVK A;  1YW9 A;  1O0X A;  1QXY A;  2B3L A;  2GGC A;  2BN7 A;  1B59 A;  2BHC A;  4FLL A;  4U6Z A;  2BWS A;  5JHU A;  3IL0 A;  4ZWU A;  4EGE A;  2P99 A;  1C24 A;  4A6W A;  2P9A A;  1Y1N A;  3I7M A;  2GGB A;  3CTZ A;  3D27 A;  2Q96 A;  4U6W A;  2EA4 A;  2V3Y A;  5D6F A;  2EVM A;  1R5H A;  4FO8 A;  2GU7 A;  1XGS A;  3OOO A;  2Q95 A;  3IU9 A;  2BWX A;  2GU5 A;  4ZNG A;  5CDL A;  4U75 A;  1A16 A;  1WY2 A;  2BHD A;  4ZWP A;  2P98 A;  4U71 A;  4A6V A;  4U76 A;  1YW7 A;  2BHA A;  2GZ5 A;  3Q6D A;  2EVC A;  3PN9 A;  3PKD A;  1XGO A;  1BOA A;  1XNZ A;  1WL9 A;  1MAT A;  2BWV A;  2BWW A;  2ZSG A;  4PNC A;  1XGN A;  2OAZ A;  1PV9 A;  4S2R P;  4U69 A;  5D6E A;  3PKB A;  1M35 A;  5CIK A;  3BIT A;  3MX6 A;  3PKC A;  4RZY A;  1YJ3 A;  3CB5 A;  2ADU A;  4U6C A;  2BWU A;  1WL6 A;  4IDY A;  2OKN A;  4R60 A;  1QZY A;  1QXZ A; 
#chains in the Genus database with same CATH homology
 1KQ9 A;  3QOC A;  5FCF A;  5CDE A;  4IEC A;  1QXW A;  3S6B A;  4QR8 A;  1BN5 A;  2V6C A;  4FO7 A;  3TAV A;  3MAT A;  4IKS A;  1WLR A;  4IKT A;  1N51 A;  2BHB A;  4U73 A;  1WKM A;  4MAT A;  2Q94 A;  2GU6 A;  1C21 A;  2Q92 A;  1JAW A;  2HOW A;  3PEB A;  5CDV A;  4IKU A;  4ZWO A;  4OOK A;  3FMQ A;  3FM3 A;  4FKC A;  1CHM A;  2BH3 A;  1KP0 A;  1WBQ A;  4JUQ A;  2GG3 A;  1C22 A;  2G6P A;  5CE6 A;  3L24 A;  1R58 A;  2Q8K A;  4S2T P;  4U70 A;  4FLK A;  4KM3 A;  4RGZ 1;  5E5B A;  3FMR A;  2GG0 A;  5JI6 A;  3IG4 A;  5CNX A;  4HXX A;  3IU8 A;  2B3K A;  2GG7 A;  4Z7M A;  2NQ7 A;  3RVA A;  1WN1 A;  2BWT A;  3ROR A;  2GG2 A;  2B3H A;  1C23 A;  1KQ0 A;  1R5G A;  1W7V A;  2GG8 A;  3TB5 A;  2GG9 A;  2IW2 A;  2V3Z A;  2GG5 A;  2GTX A;  3MR1 A;  5E2C A;  5FCH A;  4IF7 A;  3PKE A;  4IKR A;  4U1B A;  2EVO A;  4B28 A;  3CB6 A;  3IU7 A;  1W2M A;  3PKA A;  4RZZ A;  2DFI A;  2EA2 A;  2V3X A;  4FLI A;  2BWY A;  3O5V A;  1YW8 A;  2GU4 A;  2Q93 A;  4S00 A;  2GA2 A;  4IU6 A;  1XGM A;  1B6A A;  2MAT A;  1YVM A;  5CLS A;  4FLJ A;  4PV4 A;  2NQ6 A;  4S01 A;  4IPA A;  4U6E A;  3BIQ A;  1C27 A;  3BIP A;  4FUK A;  5JFR A;  4U6J A;  3L7G A;  2BB7 A;  3OVK A;  1YW9 A;  1O0X A;  1QXY A;  2B3L A;  2GGC A;  2BN7 A;  1B59 A;  2BHC A;  4FLL A;  4U6Z A;  2BWS A;  5JHU A;  3IL0 A;  4ZWU A;  4EGE A;  2P99 A;  1C24 A;  4A6W A;  2P9A A;  1Y1N A;  3I7M A;  2GGB A;  3CTZ A;  3D27 A;  2Q96 A;  4U6W A;  2EA4 A;  2V3Y A;  5D6F A;  2EVM A;  1R5H A;  4FO8 A;  2GU7 A;  1XGS A;  3OOO A;  2Q95 A;  3IU9 A;  2BWX A;  2GU5 A;  4ZNG A;  5CDL A;  4U75 A;  1A16 A;  1WY2 A;  2BHD A;  4ZWP A;  2P98 A;  4U71 A;  4A6V A;  4U76 A;  1YW7 A;  2BHA A;  2GZ5 A;  3Q6D A;  2EVC A;  3PN9 A;  3PKD A;  1XGO A;  1BOA A;  1XNZ A;  1WL9 A;  1MAT A;  2BWV A;  2BWW A;  2ZSG A;  4PNC A;  1XGN A;  2OAZ A;  1PV9 A;  4S2R P;  4U69 A;  5D6E A;  3PKB A;  1M35 A;  5CIK A;  3BIT A;  3MX6 A;  3PKC A;  4RZY A;  1YJ3 A;  3CB5 A;  2ADU A;  4U6C A;  2BWU A;  1WL6 A;  4IDY A;  2OKN A;  4R60 A;  1QZY A;  1QXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...