3BIPA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
444
structure length
444
Chain Sequence
b'LNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FACT complex subunit SPT16
publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 158
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bipA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bipA02
2BWUA 4ZWPA 1QZYA 2V6CA 4FUKA 2B3LA 2IW2A 5CIKA 3RVAA 2BN7A 4U6WA 2ADUA 2ZSGA 4RZZA 2GG9A 2GG7A 2GU4A 3Q6DA 4RZYA 3BIPA 2Q96A 1QXYA 4KM3A 3PN9A 4S2RP 1C22A 2EVCA 2GTXA 3OOOA 1YVMA 4A6VA 4RGZ1 1WBQA 3TB5A 2MATA 2BH3A 1W2MA 5FCHA 4HXXA 5CLSA 1WKMA 4U73A 4S00A 2GG8A 2GU7A 2P99A 1CHMA 3S6BA 3D27A 3I7MA 1R58A 2B3HA 2BWYA 5CDEA 3FM3A 5D6EA 1M35A 4FLLA 3FMQA 3RORA 1BN5A 2BWXA 2NQ6A 1WY2A 4U76A 2BWSA 4PV4A 5FCFA 2EA2A 4ZWUA 5CE6A 5D6FA 4U71A 3OVKA 1W7VA 1KQ9A 2HOWA 3MR1A 4FO7A 4A6WA 1YW9A 5JFRA 4B28A 2BHAA 2EVOA 2Q94A 3L7GA 3CTZA 1N51A 1WL9A 2GG2A 1WN1A 5E2CA 1R5HA 5E5BA 1B6AA 2Q95A 4IECA 1YW8A 3PKCA 2P9AA 2BHDA 2GGBA 3IU9A 4IDYA 4FKCA 2BHBA 4S01A 4U75A 4R60A 4U6JA 4U70A 4IU6A 2B3KA 3MATA 2P98A 4OOKA 1C23A 2DFIA 2GU5A 4IKTA 3CB5A 2BWWA 2GZ5A 2NQ7A 3QOCA 5CNXA 1C24A 2GU6A 1B59A 3L24A 4EGEA 4JUQA 2Q93A 3FMRA 2GG0A 2G6PA 2V3ZA 4Z7MA 1C21A 1PV9A 3CB6A 1BOAA 2OAZA 3BITA 3MX6A 4FLKA 4U6EA 2OKNA 3TAVA 4MATA 4IKUA 4U69A 4U6CA 3PEBA 4IPAA 2Q8KA 1A16A 2GA2A 1QXWA 1XGSA 2EVMA 3PKAA 5CDLA 1WL6A 4QR8A 1XGOA 2GG3A 3IU8A 4U1BA 5CDVA 4S2TP 3O5VA 4IF7A 2BWTA 4ZWOA 5JI6A 2BB7A 2GG5A 4FO8A 1QXZA 1XGNA 1MATA 4FLIA 2Q92A 4FLJA 1KP0A 1YJ3A 1XGMA 2BWVA 1XNZA 1YW7A 3IU7A 4IKRA 4PNCA 2V3XA 3IL0A 4ZNGA 4IKSA 3PKDA 2GGCA 4U6ZA 1C27A 1JAWA 1R5GA 2BHCA 3IG4A 1Y1NA 2V3YA 2EA4A 3BIQA 1O0XA 1KQ0A 3PKBA 1WLRA 3PKEA 5JHUA
chains in the Genus database with same CATH superfamily
2BWUA 4ZWPA 1QZYA 2V6CA 4FUKA 2B3LA 2IW2A 5CIKA 3RVAA 2BN7A 4U6WA 2ADUA 2ZSGA 4RZZA 2GG9A 2GG7A 2GU4A 3Q6DA 4RZYA 3BIPA 2Q96A 1QXYA 4KM3A 3PN9A 4S2RP 1C22A 2EVCA 2GTXA 3OOOA 1YVMA 4A6VA 4RGZ1 1WBQA 3TB5A 2MATA 2BH3A 1W2MA 5FCHA 4HXXA 5CLSA 1WKMA 4U73A 4S00A 2GG8A 2GU7A 2P99A 1CHMA 3S6BA 3D27A 3I7MA 1R58A 2B3HA 2BWYA 5CDEA 3FM3A 5D6EA 1M35A 4FLLA 3FMQA 3RORA 1BN5A 2BWXA 2NQ6A 1WY2A 4U76A 2BWSA 4PV4A 5FCFA 2EA2A 4ZWUA 5CE6A 5D6FA 4U71A 3OVKA 1W7VA 1KQ9A 2HOWA 3MR1A 4FO7A 4A6WA 1YW9A 5JFRA 4B28A 2BHAA 2EVOA 2Q94A 3L7GA 3CTZA 1N51A 1WL9A 2GG2A 1WN1A 5E2CA 1R5HA 5E5BA 1B6AA 2Q95A 4IECA 1YW8A 3PKCA 2P9AA 2BHDA 2GGBA 3IU9A 4IDYA 4FKCA 2BHBA 4S01A 4U75A 4R60A 4U6JA 4U70A 4IU6A 2B3KA 3MATA 2P98A 4OOKA 1C23A 2DFIA 2GU5A 4IKTA 3CB5A 2BWWA 2GZ5A 2NQ7A 3QOCA 5CNXA 1C24A 2GU6A 1B59A 3L24A 4EGEA 4JUQA 2Q93A 3FMRA 2GG0A 2G6PA 2V3ZA 4Z7MA 1C21A 1PV9A 3CB6A 1BOAA 2OAZA 3BITA 3MX6A 4FLKA 4U6EA 2OKNA 3TAVA 4MATA 4IKUA 4U69A 4U6CA 3PEBA 4IPAA 2Q8KA 1A16A 2GA2A 1QXWA 1XGSA 2EVMA 3PKAA 5CDLA 1WL6A 4QR8A 1XGOA 2GG3A 3IU8A 4U1BA 5CDVA 4S2TP 3O5VA 4IF7A 2BWTA 4ZWOA 5JI6A 2BB7A 2GG5A 4FO8A 1QXZA 1XGNA 1MATA 4FLIA 2Q92A 4FLJA 1KP0A 1YJ3A 1XGMA 2BWVA 1XNZA 1YW7A 3IU7A 4IKRA 4PNCA 2V3XA 3IL0A 4ZNGA 4IKSA 3PKDA 2GGCA 4U6ZA 1C27A 1JAWA 1R5GA 2BHCA 3IG4A 1Y1NA 2V3YA 2EA4A 3BIQA 1O0XA 1KQ0A 3PKBA 1WLRA 3PKEA 5JHUA
chains in the Genus database with same CATH topology
2BWUA 4ZWPA 1QZYA 2V6CA 4FUKA 2B3LA 2IW2A 5CIKA 3RVAA 2BN7A 4U6WA 2ADUA 2ZSGA 4RZZA 2GG9A 2GG7A 2GU4A 3Q6DA 4RZYA 3BIPA 2Q96A 1QXYA 4KM3A 3PN9A 4S2RP 1C22A 2EVCA 2GTXA 3OOOA 1YVMA 4A6VA 4RGZ1 1WBQA 3TB5A 2MATA 2BH3A 1W2MA 5FCHA 4HXXA 5CLSA 1WKMA 4U73A 4S00A 2GG8A 2GU7A 2P99A 1CHMA 3S6BA 3D27A 3I7MA 1R58A 2B3HA 2BWYA 5CDEA 3FM3A 5D6EA 1M35A 4FLLA 3FMQA 3RORA 1BN5A 2BWXA 2NQ6A 1WY2A 4U76A 2BWSA 4PV4A 5FCFA 2EA2A 4ZWUA 5CE6A 5D6FA 4U71A 3OVKA 1W7VA 1KQ9A 2HOWA 3MR1A 4FO7A 4A6WA 1YW9A 5JFRA 4B28A 2BHAA 2EVOA 2Q94A 3L7GA 3CTZA 1N51A 1WL9A 2GG2A 1WN1A 5E2CA 1R5HA 5E5BA 1B6AA 2Q95A 4IECA 1YW8A 3PKCA 2P9AA 2BHDA 2GGBA 3IU9A 4IDYA 4FKCA 2BHBA 4S01A 4U75A 4R60A 4U6JA 4U70A 4IU6A 2B3KA 3MATA 2P98A 4OOKA 1C23A 2DFIA 2GU5A 4IKTA 3CB5A 2BWWA 2GZ5A 2NQ7A 3QOCA 5CNXA 1C24A 2GU6A 1B59A 3L24A 4EGEA 4JUQA 2Q93A 3FMRA 2GG0A 2G6PA 2V3ZA 4Z7MA 1C21A 1PV9A 3CB6A 1BOAA 2OAZA 3BITA 3MX6A 4FLKA 4U6EA 2OKNA 3TAVA 4MATA 4IKUA 4U69A 4U6CA 3PEBA 4IPAA 2Q8KA 1A16A 2GA2A 1QXWA 1XGSA 2EVMA 3PKAA 5CDLA 1WL6A 4QR8A 1XGOA 2GG3A 3IU8A 4U1BA 5CDVA 4S2TP 3O5VA 4IF7A 2BWTA 4ZWOA 5JI6A 2BB7A 2GG5A 4FO8A 1QXZA 1XGNA 1MATA 4FLIA 2Q92A 4FLJA 1KP0A 1YJ3A 1XGMA 2BWVA 1XNZA 1YW7A 3IU7A 4IKRA 4PNCA 2V3XA 3IL0A 4ZNGA 4IKSA 3PKDA 2GGCA 4U6ZA 1C27A 1JAWA 1R5GA 2BHCA 3IG4A 1Y1NA 2V3YA 2EA4A 3BIQA 1O0XA 1KQ0A 3PKBA 1WLRA 3PKEA 5JHUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWU A;  4ZWP A;  1QZY A;  2V6C A;  4FUK A;  2B3L A;  2IW2 A;  5CIK A;  3RVA A;  2BN7 A;  4U6W A;  2ADU A;  2ZSG A;  4RZZ A;  2GG9 A;  2GG7 A;  2GU4 A;  3Q6D A;  4RZY A;  3BIP A;  2Q96 A;  1QXY A;  4KM3 A;  3PN9 A;  4S2R P;  1C22 A;  2EVC A;  2GTX A;  3OOO A;  1YVM A;  4A6V A;  4RGZ 1;  1WBQ A;  3TB5 A;  2MAT A;  2BH3 A;  1W2M A;  5FCH A;  4HXX A;  5CLS A;  1WKM A;  4U73 A;  4S00 A;  2GG8 A;  2GU7 A;  2P99 A;  1CHM A;  3S6B A;  3D27 A;  3I7M A;  1R58 A;  2B3H A;  2BWY A;  5CDE A;  3FM3 A;  5D6E A;  1M35 A;  4FLL A;  3FMQ A;  3ROR A;  1BN5 A;  2BWX A;  2NQ6 A;  1WY2 A;  4U76 A;  2BWS A;  4PV4 A;  5FCF A;  2EA2 A;  4ZWU A;  5CE6 A;  5D6F A;  4U71 A;  3OVK A;  1W7V A;  1KQ9 A;  2HOW A;  3MR1 A;  4FO7 A;  4A6W A;  1YW9 A;  5JFR A;  4B28 A;  2BHA A;  2EVO A;  2Q94 A;  3L7G A;  3CTZ A;  1N51 A;  1WL9 A;  2GG2 A;  1WN1 A;  5E2C A;  1R5H A;  5E5B A;  1B6A A;  2Q95 A;  4IEC A;  1YW8 A;  3PKC A;  2P9A A;  2BHD A;  2GGB A;  3IU9 A;  4IDY A;  4FKC A;  2BHB A;  4S01 A;  4U75 A;  4R60 A;  4U6J A;  4U70 A;  4IU6 A;  2B3K A;  3MAT A;  2P98 A;  4OOK A;  1C23 A;  2DFI A;  2GU5 A;  4IKT A;  3CB5 A;  2BWW A;  2GZ5 A;  2NQ7 A;  3QOC A;  5CNX A;  1C24 A;  2GU6 A;  1B59 A;  3L24 A;  4EGE A;  4JUQ A;  2Q93 A;  3FMR A;  2GG0 A;  2G6P A;  2V3Z A;  4Z7M A;  1C21 A;  1PV9 A;  3CB6 A;  1BOA A;  2OAZ A;  3BIT A;  3MX6 A;  4FLK A;  4U6E A;  2OKN A;  3TAV A;  4MAT A;  4IKU A;  4U69 A;  4U6C A;  3PEB A;  4IPA A;  2Q8K A;  1A16 A;  2GA2 A;  1QXW A;  1XGS A;  2EVM A;  3PKA A;  5CDL A;  1WL6 A;  4QR8 A;  1XGO A;  2GG3 A;  3IU8 A;  4U1B A;  5CDV A;  4S2T P;  3O5V A;  4IF7 A;  2BWT A;  4ZWO A;  5JI6 A;  2BB7 A;  2GG5 A;  4FO8 A;  1QXZ A;  1XGN A;  1MAT A;  4FLI A;  2Q92 A;  4FLJ A;  1KP0 A;  1YJ3 A;  1XGM A;  2BWV A;  1XNZ A;  1YW7 A;  3IU7 A;  4IKR A;  4PNC A;  2V3X A;  3IL0 A;  4ZNG A;  4IKS A;  3PKD A;  2GGC A;  4U6Z A;  1C27 A;  1JAW A;  1R5G A;  2BHC A;  3IG4 A;  1Y1N A;  2V3Y A;  2EA4 A;  3BIQ A;  1O0X A;  1KQ0 A;  3PKB A;  1WLR A;  3PKE A;  5JHU A; 
#chains in the Genus database with same CATH topology
 2BWU A;  4ZWP A;  1QZY A;  2V6C A;  4FUK A;  2B3L A;  2IW2 A;  5CIK A;  3RVA A;  2BN7 A;  4U6W A;  2ADU A;  2ZSG A;  4RZZ A;  2GG9 A;  2GG7 A;  2GU4 A;  3Q6D A;  4RZY A;  3BIP A;  2Q96 A;  1QXY A;  4KM3 A;  3PN9 A;  4S2R P;  1C22 A;  2EVC A;  2GTX A;  3OOO A;  1YVM A;  4A6V A;  4RGZ 1;  1WBQ A;  3TB5 A;  2MAT A;  2BH3 A;  1W2M A;  5FCH A;  4HXX A;  5CLS A;  1WKM A;  4U73 A;  4S00 A;  2GG8 A;  2GU7 A;  2P99 A;  1CHM A;  3S6B A;  3D27 A;  3I7M A;  1R58 A;  2B3H A;  2BWY A;  5CDE A;  3FM3 A;  5D6E A;  1M35 A;  4FLL A;  3FMQ A;  3ROR A;  1BN5 A;  2BWX A;  2NQ6 A;  1WY2 A;  4U76 A;  2BWS A;  4PV4 A;  5FCF A;  2EA2 A;  4ZWU A;  5CE6 A;  5D6F A;  4U71 A;  3OVK A;  1W7V A;  1KQ9 A;  2HOW A;  3MR1 A;  4FO7 A;  4A6W A;  1YW9 A;  5JFR A;  4B28 A;  2BHA A;  2EVO A;  2Q94 A;  3L7G A;  3CTZ A;  1N51 A;  1WL9 A;  2GG2 A;  1WN1 A;  5E2C A;  1R5H A;  5E5B A;  1B6A A;  2Q95 A;  4IEC A;  1YW8 A;  3PKC A;  2P9A A;  2BHD A;  2GGB A;  3IU9 A;  4IDY A;  4FKC A;  2BHB A;  4S01 A;  4U75 A;  4R60 A;  4U6J A;  4U70 A;  4IU6 A;  2B3K A;  3MAT A;  2P98 A;  4OOK A;  1C23 A;  2DFI A;  2GU5 A;  4IKT A;  3CB5 A;  2BWW A;  2GZ5 A;  2NQ7 A;  3QOC A;  5CNX A;  1C24 A;  2GU6 A;  1B59 A;  3L24 A;  4EGE A;  4JUQ A;  2Q93 A;  3FMR A;  2GG0 A;  2G6P A;  2V3Z A;  4Z7M A;  1C21 A;  1PV9 A;  3CB6 A;  1BOA A;  2OAZ A;  3BIT A;  3MX6 A;  4FLK A;  4U6E A;  2OKN A;  3TAV A;  4MAT A;  4IKU A;  4U69 A;  4U6C A;  3PEB A;  4IPA A;  2Q8K A;  1A16 A;  2GA2 A;  1QXW A;  1XGS A;  2EVM A;  3PKA A;  5CDL A;  1WL6 A;  4QR8 A;  1XGO A;  2GG3 A;  3IU8 A;  4U1B A;  5CDV A;  4S2T P;  3O5V A;  4IF7 A;  2BWT A;  4ZWO A;  5JI6 A;  2BB7 A;  2GG5 A;  4FO8 A;  1QXZ A;  1XGN A;  1MAT A;  4FLI A;  2Q92 A;  4FLJ A;  1KP0 A;  1YJ3 A;  1XGM A;  2BWV A;  1XNZ A;  1YW7 A;  3IU7 A;  4IKR A;  4PNC A;  2V3X A;  3IL0 A;  4ZNG A;  4IKS A;  3PKD A;  2GGC A;  4U6Z A;  1C27 A;  1JAW A;  1R5G A;  2BHC A;  3IG4 A;  1Y1N A;  2V3Y A;  2EA4 A;  3BIQ A;  1O0X A;  1KQ0 A;  3PKB A;  1WLR A;  3PKE A;  5JHU A; 
#chains in the Genus database with same CATH homology
 2BWU A;  4ZWP A;  1QZY A;  2V6C A;  4FUK A;  2B3L A;  2IW2 A;  5CIK A;  3RVA A;  2BN7 A;  4U6W A;  2ADU A;  2ZSG A;  4RZZ A;  2GG9 A;  2GG7 A;  2GU4 A;  3Q6D A;  4RZY A;  3BIP A;  2Q96 A;  1QXY A;  4KM3 A;  3PN9 A;  4S2R P;  1C22 A;  2EVC A;  2GTX A;  3OOO A;  1YVM A;  4A6V A;  4RGZ 1;  1WBQ A;  3TB5 A;  2MAT A;  2BH3 A;  1W2M A;  5FCH A;  4HXX A;  5CLS A;  1WKM A;  4U73 A;  4S00 A;  2GG8 A;  2GU7 A;  2P99 A;  1CHM A;  3S6B A;  3D27 A;  3I7M A;  1R58 A;  2B3H A;  2BWY A;  5CDE A;  3FM3 A;  5D6E A;  1M35 A;  4FLL A;  3FMQ A;  3ROR A;  1BN5 A;  2BWX A;  2NQ6 A;  1WY2 A;  4U76 A;  2BWS A;  4PV4 A;  5FCF A;  2EA2 A;  4ZWU A;  5CE6 A;  5D6F A;  4U71 A;  3OVK A;  1W7V A;  1KQ9 A;  2HOW A;  3MR1 A;  4FO7 A;  4A6W A;  1YW9 A;  5JFR A;  4B28 A;  2BHA A;  2EVO A;  2Q94 A;  3L7G A;  3CTZ A;  1N51 A;  1WL9 A;  2GG2 A;  1WN1 A;  5E2C A;  1R5H A;  5E5B A;  1B6A A;  2Q95 A;  4IEC A;  1YW8 A;  3PKC A;  2P9A A;  2BHD A;  2GGB A;  3IU9 A;  4IDY A;  4FKC A;  2BHB A;  4S01 A;  4U75 A;  4R60 A;  4U6J A;  4U70 A;  4IU6 A;  2B3K A;  3MAT A;  2P98 A;  4OOK A;  1C23 A;  2DFI A;  2GU5 A;  4IKT A;  3CB5 A;  2BWW A;  2GZ5 A;  2NQ7 A;  3QOC A;  5CNX A;  1C24 A;  2GU6 A;  1B59 A;  3L24 A;  4EGE A;  4JUQ A;  2Q93 A;  3FMR A;  2GG0 A;  2G6P A;  2V3Z A;  4Z7M A;  1C21 A;  1PV9 A;  3CB6 A;  1BOA A;  2OAZ A;  3BIT A;  3MX6 A;  4FLK A;  4U6E A;  2OKN A;  3TAV A;  4MAT A;  4IKU A;  4U69 A;  4U6C A;  3PEB A;  4IPA A;  2Q8K A;  1A16 A;  2GA2 A;  1QXW A;  1XGS A;  2EVM A;  3PKA A;  5CDL A;  1WL6 A;  4QR8 A;  1XGO A;  2GG3 A;  3IU8 A;  4U1B A;  5CDV A;  4S2T P;  3O5V A;  4IF7 A;  2BWT A;  4ZWO A;  5JI6 A;  2BB7 A;  2GG5 A;  4FO8 A;  1QXZ A;  1XGN A;  1MAT A;  4FLI A;  2Q92 A;  4FLJ A;  1KP0 A;  1YJ3 A;  1XGM A;  2BWV A;  1XNZ A;  1YW7 A;  3IU7 A;  4IKR A;  4PNC A;  2V3X A;  3IL0 A;  4ZNG A;  4IKS A;  3PKD A;  2GGC A;  4U6Z A;  1C27 A;  1JAW A;  1R5G A;  2BHC A;  3IG4 A;  1Y1N A;  2V3Y A;  2EA4 A;  3BIQ A;  1O0X A;  1KQ0 A;  3PKB A;  1WLR A;  3PKE A;  5JHU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...