3BIPA

Crystal structure of yeast spt16 n-terminal domain
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
444
structure length
444
Chain Sequence
LNIDFDVFKKRIELLYSKYNEFEGSPNSLLFVLGSSNAENPYQKTTILHNWLLSYEFPATLIALVPGKVIIITSSAKAKHLQKAIDLFKDPESKITLELWQRNNKEPELNKKLFDDVIALINSAGKTVGIPEKDSYQGKFMTEWNPVWEAAVKENEFNVIDISLGLSKVWEVKDVNEQAFLSVSSKGSDKFMDLLSNEMVRAVDEELKITNAKLSDKIENKIDDVKFLKQLSPDLSALCPPNYKFNFDLLDWTYSPIIQSGKKFDLRVSARSTNDQLYGNGCILASCGIRYNNYCSNITRTFLIDPSEEMANNYDFLLTLQKEIVTNILKPGRTPKEVYESVIEYIEKTKPELVPNFTKNIGSLIGLEFRDSNFILNVKNDYRKIQRGDCFNISFGFNNLKDSQSANNYALQLADTVQIPLDETEPPRFLTNYTKAKSQISFYF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and functional analysis of the Spt16p N-terminal domain reveals overlapping roles of yFACT subunits.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords FACT complex subunit SPT16
total genus 158
structure length 444
sequence length 444
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF14826 FACT-Spt16_Nlob FACT complex subunit SPT16 N-terminal lobe domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3bipA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 3bipA02
4ZWPA 3O5VA 1WL6A 2ADUA 5JFRA 5JHUA 3BIPA 2GU7A 2GG8A 3PKCA 1M35A 3D27A 5JI6A 5CIKA 4FUKA 3S6BA 4QR8A 2GGBA 2BWVA 3L24A 1WL9A 3PEBA 5CE6A 5E5BA 2BWWA 3IG4A 4ZNGA 2BH3A 2IW2A 2GG2A 1A16A 2P99A 2BWUA 3RORA 2EVOA 4IECA 5E2CA 3MX6A 3CB5A 1C23A 1YJ3A 2Q95A 2BN7A 2BWSA 2B3KA 3BIQA 4JUQA 2BHDA 3BITA 1B6AA 4ZWUA 1C22A 2NQ6A 2OAZA 4IKUA 4U6ZA 4U73A 1BOAA 2BHCA 3FMQA 3CB6A 4OOKA 4MATA 4B28A 5CDVA 2GA2A 4U6CA 4U6EA 4S2TP 4FLJA 2P9AA 3CTZA 1C27A 2MATA 1R5GA 5D6EA 4RGZ1 1W7VA 5CLSA 3IU9A 4U71A 3IU7A 4U1BA 2V3XA 4U75A 4FO7A 3IU8A 4S00A 2Q94A 3PKEA 1B59A 3OOOA 3MR1A 4R60A 1W2MA 3PKBA 3I7MA 4FLIA 4RZYA 4U69A 1JAWA 3IL0A 2BHBA 4S01A 1WLRA 2BWTA 3RVAA 1KP0A 2BB7A 3QOCA 4U6WA 1WY2A 2GU5A 1N51A 2GG7A 4PNCA 1QZYA 3PKDA 4FKCA 2BHAA 2EVMA 1XGOA 5CNXA 2GG0A 1PV9A 2HOWA 2GU6A 5FCFA 2Q96A 5CDLA 1R5HA 4U76A 2BWYA 3L7GA 1XGMA 2NQ7A 2EA2A 4FLKA 2GG9A 2Q93A 1C21A 4HXXA 3TB5A 5D6FA 2EA4A 1QXZA 3FM3A 2Q92A 4ZWOA 4PV4A 4U6JA 3OVKA 4S2RP 2EVCA 2GZ5A 1XGSA 2GTXA 2Q8KA 1O0XA 4A6VA 1CHMA 2DFIA 1WBQA 4RZZA 2GG5A 4FO8A 4EGEA 2B3LA 2BWXA 1WKMA 1YVMA 4IKSA 3Q6DA 4IF7A 4IU6A 1WN1A 2V3YA 2V3ZA 1Y1NA 2B3HA 3FMRA 3MATA 4A6WA 1XNZA 1XGNA 3PKAA 1YW9A 1YW7A 2P98A 3TAVA 1MATA 1C24A 2ZSGA 4IPAA 1R58A 2GGCA 2GU4A 1KQ0A 1YW8A 2G6PA 4U70A 4IKRA 5CDEA 4KM3A 4FLLA 2GG3A 1QXYA 1KQ9A 2V6CA 4Z7MA 4IDYA 3PN9A 2OKNA 5FCHA 1BN5A 4IKTA 1QXWA
chains in the Genus database with same CATH superfamily
4ZWPA 3O5VA 1WL6A 2ADUA 5JFRA 5JHUA 3BIPA 2GU7A 2GG8A 3PKCA 1M35A 3D27A 5JI6A 5CIKA 4FUKA 3S6BA 4QR8A 2GGBA 2BWVA 3L24A 1WL9A 3PEBA 5CE6A 5E5BA 2BWWA 3IG4A 4ZNGA 2BH3A 2IW2A 2GG2A 1A16A 2P99A 2BWUA 3RORA 2EVOA 4IECA 5E2CA 3MX6A 3CB5A 1C23A 1YJ3A 2Q95A 2BN7A 2BWSA 2B3KA 3BIQA 4JUQA 2BHDA 3BITA 1B6AA 4ZWUA 1C22A 2NQ6A 2OAZA 4IKUA 4U6ZA 4U73A 1BOAA 2BHCA 3FMQA 3CB6A 4OOKA 4MATA 4B28A 5CDVA 2GA2A 4U6CA 4U6EA 4S2TP 4FLJA 2P9AA 3CTZA 1C27A 2MATA 1R5GA 5D6EA 4RGZ1 1W7VA 5CLSA 3IU9A 4U71A 3IU7A 4U1BA 2V3XA 4U75A 4FO7A 3IU8A 4S00A 2Q94A 3PKEA 1B59A 3OOOA 3MR1A 4R60A 1W2MA 3PKBA 3I7MA 4FLIA 4RZYA 4U69A 1JAWA 3IL0A 2BHBA 4S01A 1WLRA 2BWTA 3RVAA 1KP0A 2BB7A 3QOCA 4U6WA 1WY2A 2GU5A 1N51A 2GG7A 4PNCA 1QZYA 3PKDA 4FKCA 2BHAA 2EVMA 1XGOA 5CNXA 2GG0A 1PV9A 2HOWA 2GU6A 5FCFA 2Q96A 5CDLA 1R5HA 4U76A 2BWYA 3L7GA 1XGMA 2NQ7A 2EA2A 4FLKA 2GG9A 2Q93A 1C21A 4HXXA 3TB5A 5D6FA 2EA4A 1QXZA 3FM3A 2Q92A 4ZWOA 4PV4A 4U6JA 3OVKA 4S2RP 2EVCA 2GZ5A 1XGSA 2GTXA 2Q8KA 1O0XA 4A6VA 1CHMA 2DFIA 1WBQA 4RZZA 2GG5A 4FO8A 4EGEA 2B3LA 2BWXA 1WKMA 1YVMA 4IKSA 3Q6DA 4IF7A 4IU6A 1WN1A 2V3YA 2V3ZA 1Y1NA 2B3HA 3FMRA 3MATA 4A6WA 1XNZA 1XGNA 3PKAA 1YW9A 1YW7A 2P98A 3TAVA 1MATA 1C24A 2ZSGA 4IPAA 1R58A 2GGCA 2GU4A 1KQ0A 1YW8A 2G6PA 4U70A 4IKRA 5CDEA 4KM3A 4FLLA 2GG3A 1QXYA 1KQ9A 2V6CA 4Z7MA 4IDYA 3PN9A 2OKNA 5FCHA 1BN5A 4IKTA 1QXWA
chains in the Genus database with same CATH topology
4ZWPA 3O5VA 1WL6A 2ADUA 5JFRA 5JHUA 3BIPA 2GU7A 2GG8A 3PKCA 1M35A 3D27A 5JI6A 5CIKA 4FUKA 3S6BA 4QR8A 2GGBA 2BWVA 3L24A 1WL9A 3PEBA 5CE6A 5E5BA 2BWWA 3IG4A 4ZNGA 2BH3A 2IW2A 2GG2A 1A16A 2P99A 2BWUA 3RORA 2EVOA 4IECA 5E2CA 3MX6A 3CB5A 1C23A 1YJ3A 2Q95A 2BN7A 2BWSA 2B3KA 3BIQA 4JUQA 2BHDA 3BITA 1B6AA 4ZWUA 1C22A 2NQ6A 2OAZA 4IKUA 4U6ZA 4U73A 1BOAA 2BHCA 3FMQA 3CB6A 4OOKA 4MATA 4B28A 5CDVA 2GA2A 4U6CA 4U6EA 4S2TP 4FLJA 2P9AA 3CTZA 1C27A 2MATA 1R5GA 5D6EA 4RGZ1 1W7VA 5CLSA 3IU9A 4U71A 3IU7A 4U1BA 2V3XA 4U75A 4FO7A 3IU8A 4S00A 2Q94A 3PKEA 1B59A 3OOOA 3MR1A 4R60A 1W2MA 3PKBA 3I7MA 4FLIA 4RZYA 4U69A 1JAWA 3IL0A 2BHBA 4S01A 1WLRA 2BWTA 3RVAA 1KP0A 2BB7A 3QOCA 4U6WA 1WY2A 2GU5A 1N51A 2GG7A 4PNCA 1QZYA 3PKDA 4FKCA 2BHAA 2EVMA 1XGOA 5CNXA 2GG0A 1PV9A 2HOWA 2GU6A 5FCFA 2Q96A 5CDLA 1R5HA 4U76A 2BWYA 3L7GA 1XGMA 2NQ7A 2EA2A 4FLKA 2GG9A 2Q93A 1C21A 4HXXA 3TB5A 5D6FA 2EA4A 1QXZA 3FM3A 2Q92A 4ZWOA 4PV4A 4U6JA 3OVKA 4S2RP 2EVCA 2GZ5A 1XGSA 2GTXA 2Q8KA 1O0XA 4A6VA 1CHMA 2DFIA 1WBQA 4RZZA 2GG5A 4FO8A 4EGEA 2B3LA 2BWXA 1WKMA 1YVMA 4IKSA 3Q6DA 4IF7A 4IU6A 1WN1A 2V3YA 2V3ZA 1Y1NA 2B3HA 3FMRA 3MATA 4A6WA 1XNZA 1XGNA 3PKAA 1YW9A 1YW7A 2P98A 3TAVA 1MATA 1C24A 2ZSGA 4IPAA 1R58A 2GGCA 2GU4A 1KQ0A 1YW8A 2G6PA 4U70A 4IKRA 5CDEA 4KM3A 4FLLA 2GG3A 1QXYA 1KQ9A 2V6CA 4Z7MA 4IDYA 3PN9A 2OKNA 5FCHA 1BN5A 4IKTA 1QXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZWP A;  3O5V A;  1WL6 A;  2ADU A;  5JFR A;  5JHU A;  3BIP A;  2GU7 A;  2GG8 A;  3PKC A;  1M35 A;  3D27 A;  5JI6 A;  5CIK A;  4FUK A;  3S6B A;  4QR8 A;  2GGB A;  2BWV A;  3L24 A;  1WL9 A;  3PEB A;  5CE6 A;  5E5B A;  2BWW A;  3IG4 A;  4ZNG A;  2BH3 A;  2IW2 A;  2GG2 A;  1A16 A;  2P99 A;  2BWU A;  3ROR A;  2EVO A;  4IEC A;  5E2C A;  3MX6 A;  3CB5 A;  1C23 A;  1YJ3 A;  2Q95 A;  2BN7 A;  2BWS A;  2B3K A;  3BIQ A;  4JUQ A;  2BHD A;  3BIT A;  1B6A A;  4ZWU A;  1C22 A;  2NQ6 A;  2OAZ A;  4IKU A;  4U6Z A;  4U73 A;  1BOA A;  2BHC A;  3FMQ A;  3CB6 A;  4OOK A;  4MAT A;  4B28 A;  5CDV A;  2GA2 A;  4U6C A;  4U6E A;  4S2T P;  4FLJ A;  2P9A A;  3CTZ A;  1C27 A;  2MAT A;  1R5G A;  5D6E A;  4RGZ 1;  1W7V A;  5CLS A;  3IU9 A;  4U71 A;  3IU7 A;  4U1B A;  2V3X A;  4U75 A;  4FO7 A;  3IU8 A;  4S00 A;  2Q94 A;  3PKE A;  1B59 A;  3OOO A;  3MR1 A;  4R60 A;  1W2M A;  3PKB A;  3I7M A;  4FLI A;  4RZY A;  4U69 A;  1JAW A;  3IL0 A;  2BHB A;  4S01 A;  1WLR A;  2BWT A;  3RVA A;  1KP0 A;  2BB7 A;  3QOC A;  4U6W A;  1WY2 A;  2GU5 A;  1N51 A;  2GG7 A;  4PNC A;  1QZY A;  3PKD A;  4FKC A;  2BHA A;  2EVM A;  1XGO A;  5CNX A;  2GG0 A;  1PV9 A;  2HOW A;  2GU6 A;  5FCF A;  2Q96 A;  5CDL A;  1R5H A;  4U76 A;  2BWY A;  3L7G A;  1XGM A;  2NQ7 A;  2EA2 A;  4FLK A;  2GG9 A;  2Q93 A;  1C21 A;  4HXX A;  3TB5 A;  5D6F A;  2EA4 A;  1QXZ A;  3FM3 A;  2Q92 A;  4ZWO A;  4PV4 A;  4U6J A;  3OVK A;  4S2R P;  2EVC A;  2GZ5 A;  1XGS A;  2GTX A;  2Q8K A;  1O0X A;  4A6V A;  1CHM A;  2DFI A;  1WBQ A;  4RZZ A;  2GG5 A;  4FO8 A;  4EGE A;  2B3L A;  2BWX A;  1WKM A;  1YVM A;  4IKS A;  3Q6D A;  4IF7 A;  4IU6 A;  1WN1 A;  2V3Y A;  2V3Z A;  1Y1N A;  2B3H A;  3FMR A;  3MAT A;  4A6W A;  1XNZ A;  1XGN A;  3PKA A;  1YW9 A;  1YW7 A;  2P98 A;  3TAV A;  1MAT A;  1C24 A;  2ZSG A;  4IPA A;  1R58 A;  2GGC A;  2GU4 A;  1KQ0 A;  1YW8 A;  2G6P A;  4U70 A;  4IKR A;  5CDE A;  4KM3 A;  4FLL A;  2GG3 A;  1QXY A;  1KQ9 A;  2V6C A;  4Z7M A;  4IDY A;  3PN9 A;  2OKN A;  5FCH A;  1BN5 A;  4IKT A;  1QXW A; 
#chains in the Genus database with same CATH topology
 4ZWP A;  3O5V A;  1WL6 A;  2ADU A;  5JFR A;  5JHU A;  3BIP A;  2GU7 A;  2GG8 A;  3PKC A;  1M35 A;  3D27 A;  5JI6 A;  5CIK A;  4FUK A;  3S6B A;  4QR8 A;  2GGB A;  2BWV A;  3L24 A;  1WL9 A;  3PEB A;  5CE6 A;  5E5B A;  2BWW A;  3IG4 A;  4ZNG A;  2BH3 A;  2IW2 A;  2GG2 A;  1A16 A;  2P99 A;  2BWU A;  3ROR A;  2EVO A;  4IEC A;  5E2C A;  3MX6 A;  3CB5 A;  1C23 A;  1YJ3 A;  2Q95 A;  2BN7 A;  2BWS A;  2B3K A;  3BIQ A;  4JUQ A;  2BHD A;  3BIT A;  1B6A A;  4ZWU A;  1C22 A;  2NQ6 A;  2OAZ A;  4IKU A;  4U6Z A;  4U73 A;  1BOA A;  2BHC A;  3FMQ A;  3CB6 A;  4OOK A;  4MAT A;  4B28 A;  5CDV A;  2GA2 A;  4U6C A;  4U6E A;  4S2T P;  4FLJ A;  2P9A A;  3CTZ A;  1C27 A;  2MAT A;  1R5G A;  5D6E A;  4RGZ 1;  1W7V A;  5CLS A;  3IU9 A;  4U71 A;  3IU7 A;  4U1B A;  2V3X A;  4U75 A;  4FO7 A;  3IU8 A;  4S00 A;  2Q94 A;  3PKE A;  1B59 A;  3OOO A;  3MR1 A;  4R60 A;  1W2M A;  3PKB A;  3I7M A;  4FLI A;  4RZY A;  4U69 A;  1JAW A;  3IL0 A;  2BHB A;  4S01 A;  1WLR A;  2BWT A;  3RVA A;  1KP0 A;  2BB7 A;  3QOC A;  4U6W A;  1WY2 A;  2GU5 A;  1N51 A;  2GG7 A;  4PNC A;  1QZY A;  3PKD A;  4FKC A;  2BHA A;  2EVM A;  1XGO A;  5CNX A;  2GG0 A;  1PV9 A;  2HOW A;  2GU6 A;  5FCF A;  2Q96 A;  5CDL A;  1R5H A;  4U76 A;  2BWY A;  3L7G A;  1XGM A;  2NQ7 A;  2EA2 A;  4FLK A;  2GG9 A;  2Q93 A;  1C21 A;  4HXX A;  3TB5 A;  5D6F A;  2EA4 A;  1QXZ A;  3FM3 A;  2Q92 A;  4ZWO A;  4PV4 A;  4U6J A;  3OVK A;  4S2R P;  2EVC A;  2GZ5 A;  1XGS A;  2GTX A;  2Q8K A;  1O0X A;  4A6V A;  1CHM A;  2DFI A;  1WBQ A;  4RZZ A;  2GG5 A;  4FO8 A;  4EGE A;  2B3L A;  2BWX A;  1WKM A;  1YVM A;  4IKS A;  3Q6D A;  4IF7 A;  4IU6 A;  1WN1 A;  2V3Y A;  2V3Z A;  1Y1N A;  2B3H A;  3FMR A;  3MAT A;  4A6W A;  1XNZ A;  1XGN A;  3PKA A;  1YW9 A;  1YW7 A;  2P98 A;  3TAV A;  1MAT A;  1C24 A;  2ZSG A;  4IPA A;  1R58 A;  2GGC A;  2GU4 A;  1KQ0 A;  1YW8 A;  2G6P A;  4U70 A;  4IKR A;  5CDE A;  4KM3 A;  4FLL A;  2GG3 A;  1QXY A;  1KQ9 A;  2V6C A;  4Z7M A;  4IDY A;  3PN9 A;  2OKN A;  5FCH A;  1BN5 A;  4IKT A;  1QXW A; 
#chains in the Genus database with same CATH homology
 4ZWP A;  3O5V A;  1WL6 A;  2ADU A;  5JFR A;  5JHU A;  3BIP A;  2GU7 A;  2GG8 A;  3PKC A;  1M35 A;  3D27 A;  5JI6 A;  5CIK A;  4FUK A;  3S6B A;  4QR8 A;  2GGB A;  2BWV A;  3L24 A;  1WL9 A;  3PEB A;  5CE6 A;  5E5B A;  2BWW A;  3IG4 A;  4ZNG A;  2BH3 A;  2IW2 A;  2GG2 A;  1A16 A;  2P99 A;  2BWU A;  3ROR A;  2EVO A;  4IEC A;  5E2C A;  3MX6 A;  3CB5 A;  1C23 A;  1YJ3 A;  2Q95 A;  2BN7 A;  2BWS A;  2B3K A;  3BIQ A;  4JUQ A;  2BHD A;  3BIT A;  1B6A A;  4ZWU A;  1C22 A;  2NQ6 A;  2OAZ A;  4IKU A;  4U6Z A;  4U73 A;  1BOA A;  2BHC A;  3FMQ A;  3CB6 A;  4OOK A;  4MAT A;  4B28 A;  5CDV A;  2GA2 A;  4U6C A;  4U6E A;  4S2T P;  4FLJ A;  2P9A A;  3CTZ A;  1C27 A;  2MAT A;  1R5G A;  5D6E A;  4RGZ 1;  1W7V A;  5CLS A;  3IU9 A;  4U71 A;  3IU7 A;  4U1B A;  2V3X A;  4U75 A;  4FO7 A;  3IU8 A;  4S00 A;  2Q94 A;  3PKE A;  1B59 A;  3OOO A;  3MR1 A;  4R60 A;  1W2M A;  3PKB A;  3I7M A;  4FLI A;  4RZY A;  4U69 A;  1JAW A;  3IL0 A;  2BHB A;  4S01 A;  1WLR A;  2BWT A;  3RVA A;  1KP0 A;  2BB7 A;  3QOC A;  4U6W A;  1WY2 A;  2GU5 A;  1N51 A;  2GG7 A;  4PNC A;  1QZY A;  3PKD A;  4FKC A;  2BHA A;  2EVM A;  1XGO A;  5CNX A;  2GG0 A;  1PV9 A;  2HOW A;  2GU6 A;  5FCF A;  2Q96 A;  5CDL A;  1R5H A;  4U76 A;  2BWY A;  3L7G A;  1XGM A;  2NQ7 A;  2EA2 A;  4FLK A;  2GG9 A;  2Q93 A;  1C21 A;  4HXX A;  3TB5 A;  5D6F A;  2EA4 A;  1QXZ A;  3FM3 A;  2Q92 A;  4ZWO A;  4PV4 A;  4U6J A;  3OVK A;  4S2R P;  2EVC A;  2GZ5 A;  1XGS A;  2GTX A;  2Q8K A;  1O0X A;  4A6V A;  1CHM A;  2DFI A;  1WBQ A;  4RZZ A;  2GG5 A;  4FO8 A;  4EGE A;  2B3L A;  2BWX A;  1WKM A;  1YVM A;  4IKS A;  3Q6D A;  4IF7 A;  4IU6 A;  1WN1 A;  2V3Y A;  2V3Z A;  1Y1N A;  2B3H A;  3FMR A;  3MAT A;  4A6W A;  1XNZ A;  1XGN A;  3PKA A;  1YW9 A;  1YW7 A;  2P98 A;  3TAV A;  1MAT A;  1C24 A;  2ZSG A;  4IPA A;  1R58 A;  2GGC A;  2GU4 A;  1KQ0 A;  1YW8 A;  2G6P A;  4U70 A;  4IKR A;  5CDE A;  4KM3 A;  4FLL A;  2GG3 A;  1QXY A;  1KQ9 A;  2V6C A;  4Z7M A;  4IDY A;  3PN9 A;  2OKN A;  5FCH A;  1BN5 A;  4IKT A;  1QXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...