2BHCA

Na substituted e. coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhcA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhcA02
4R60A 4IECA 5E5BA 3TAVA 4RZZA 3BITA 4S00A 2GZ5A 4U6CA 3PKBA 1R5HA 2V3ZA 2EVOA 4KM3A 4EGEA 4U70A 3L24A 2BWUA 3L7GA 2GTXA 2BWVA 3IL0A 5CNXA 1C24A 3PEBA 3PN9A 1XGMA 4IKTA 4JUQA 2BN7A 2NQ7A 1XGSA 3MR1A 5E2CA 1QXWA 1M35A 1XGOA 1YVMA 2P99A 2BH3A 2P9AA 1WL9A 1B59A 5JFRA 1R58A 3S6BA 3MX6A 1WLRA 3Q6DA 4S2TP 4IF7A 2Q96A 2GU5A 2Q95A 3FMQA 2Q94A 2NQ6A 2GG9A 2BHCA 4U6JA 2V6CA 4HXXA 1O0XA 2EA2A 4MATA 1B6AA 5JI6A 4U71A 4FLLA 3RORA 1PV9A 2GA2A 4IKRA 2V3XA 1XNZA 1N51A 1QZYA 2GG7A 4IKSA 4PV4A 3FM3A 5CLSA 2GG5A 2B3KA 2GG0A 2BB7A 1Y1NA 4FO8A 4FLKA 4A6WA 1WBQA 4U75A 1YW8A 2B3HA 2GGCA 2BHAA 5FCFA 5CDLA 4Z7MA 2GG8A 1C27A 2G6PA 2Q8KA 2GU4A 2MATA 1MATA 2P98A 1BOAA 2EA4A 1JAWA 4RGZ1 2BWYA 3IG4A 4U73A 1QXYA 4U6ZA 1WY2A 1KQ9A 1QXZA 4FLJA 4IDYA 4ZWUA 4ZWPA 2GG2A 4RZYA 3PKEA 4FUKA 3IU7A 4IU6A 4U76A 3IU9A 3TB5A 1WN1A 4U69A 2OAZA 3IU8A 2EVMA 1YJ3A 3OOOA 5D6FA 5JHUA 2BHBA 2V3YA 1A16A 2ZSGA 3OVKA 3PKAA 4U6WA 2GU7A 3BIPA 5CE6A 4IKUA 4FLIA 2BWXA 3PKCA 2HOWA 4U1BA 4FKCA 1WL6A 3D27A 2BHDA 5CDEA 1R5GA 2IW2A 3MATA 3CTZA 2GU6A 3BIQA 2GG3A 3O5VA 4A6VA 1C22A 4ZNGA 4QR8A 2Q93A 1W2MA 3FMRA 1YW9A 3PKDA 2EVCA 2ADUA 2B3LA 2Q92A 1W7VA 2OKNA 4S01A 3QOCA 4B28A 1C21A 3CB6A 2BWTA 1KQ0A 4S2RP 2BWWA 4U6EA 4OOKA 5CIKA 3CB5A 4FO7A 4PNCA 1WKMA 1BN5A 1C23A 1KP0A 2BWSA 3I7MA 5FCHA 2GGBA 1YW7A 1XGNA 4ZWOA 5D6EA 2DFIA 3RVAA 1CHMA 4IPAA 5CDVA
chains in the Genus database with same CATH superfamily
4R60A 4IECA 5E5BA 3TAVA 4RZZA 3BITA 4S00A 2GZ5A 4U6CA 3PKBA 1R5HA 2V3ZA 2EVOA 4KM3A 4EGEA 4U70A 3L24A 2BWUA 3L7GA 2GTXA 2BWVA 3IL0A 5CNXA 1C24A 3PEBA 3PN9A 1XGMA 4IKTA 4JUQA 2BN7A 2NQ7A 1XGSA 3MR1A 5E2CA 1QXWA 1M35A 1XGOA 1YVMA 2P99A 2BH3A 2P9AA 1WL9A 1B59A 5JFRA 1R58A 3S6BA 3MX6A 1WLRA 3Q6DA 4S2TP 4IF7A 2Q96A 2GU5A 2Q95A 3FMQA 2Q94A 2NQ6A 2GG9A 2BHCA 4U6JA 2V6CA 4HXXA 1O0XA 2EA2A 4MATA 1B6AA 5JI6A 4U71A 4FLLA 3RORA 1PV9A 2GA2A 4IKRA 2V3XA 1XNZA 1N51A 1QZYA 2GG7A 4IKSA 4PV4A 3FM3A 5CLSA 2GG5A 2B3KA 2GG0A 2BB7A 1Y1NA 4FO8A 4FLKA 4A6WA 1WBQA 4U75A 1YW8A 2B3HA 2GGCA 2BHAA 5FCFA 5CDLA 4Z7MA 2GG8A 1C27A 2G6PA 2Q8KA 2GU4A 2MATA 1MATA 2P98A 1BOAA 2EA4A 1JAWA 4RGZ1 2BWYA 3IG4A 4U73A 1QXYA 4U6ZA 1WY2A 1KQ9A 1QXZA 4FLJA 4IDYA 4ZWUA 4ZWPA 2GG2A 4RZYA 3PKEA 4FUKA 3IU7A 4IU6A 4U76A 3IU9A 3TB5A 1WN1A 4U69A 2OAZA 3IU8A 2EVMA 1YJ3A 3OOOA 5D6FA 5JHUA 2BHBA 2V3YA 1A16A 2ZSGA 3OVKA 3PKAA 4U6WA 2GU7A 3BIPA 5CE6A 4IKUA 4FLIA 2BWXA 3PKCA 2HOWA 4U1BA 4FKCA 1WL6A 3D27A 2BHDA 5CDEA 1R5GA 2IW2A 3MATA 3CTZA 2GU6A 3BIQA 2GG3A 3O5VA 4A6VA 1C22A 4ZNGA 4QR8A 2Q93A 1W2MA 3FMRA 1YW9A 3PKDA 2EVCA 2ADUA 2B3LA 2Q92A 1W7VA 2OKNA 4S01A 3QOCA 4B28A 1C21A 3CB6A 2BWTA 1KQ0A 4S2RP 2BWWA 4U6EA 4OOKA 5CIKA 3CB5A 4FO7A 4PNCA 1WKMA 1BN5A 1C23A 1KP0A 2BWSA 3I7MA 5FCHA 2GGBA 1YW7A 1XGNA 4ZWOA 5D6EA 2DFIA 3RVAA 1CHMA 4IPAA 5CDVA
chains in the Genus database with same CATH topology
4R60A 4IECA 5E5BA 3TAVA 4RZZA 3BITA 4S00A 2GZ5A 4U6CA 3PKBA 1R5HA 2V3ZA 2EVOA 4KM3A 4EGEA 4U70A 3L24A 2BWUA 3L7GA 2GTXA 2BWVA 3IL0A 5CNXA 1C24A 3PEBA 3PN9A 1XGMA 4IKTA 4JUQA 2BN7A 2NQ7A 1XGSA 3MR1A 5E2CA 1QXWA 1M35A 1XGOA 1YVMA 2P99A 2BH3A 2P9AA 1WL9A 1B59A 5JFRA 1R58A 3S6BA 3MX6A 1WLRA 3Q6DA 4S2TP 4IF7A 2Q96A 2GU5A 2Q95A 3FMQA 2Q94A 2NQ6A 2GG9A 2BHCA 4U6JA 2V6CA 4HXXA 1O0XA 2EA2A 4MATA 1B6AA 5JI6A 4U71A 4FLLA 3RORA 1PV9A 2GA2A 4IKRA 2V3XA 1XNZA 1N51A 1QZYA 2GG7A 4IKSA 4PV4A 3FM3A 5CLSA 2GG5A 2B3KA 2GG0A 2BB7A 1Y1NA 4FO8A 4FLKA 4A6WA 1WBQA 4U75A 1YW8A 2B3HA 2GGCA 2BHAA 5FCFA 5CDLA 4Z7MA 2GG8A 1C27A 2G6PA 2Q8KA 2GU4A 2MATA 1MATA 2P98A 1BOAA 2EA4A 1JAWA 4RGZ1 2BWYA 3IG4A 4U73A 1QXYA 4U6ZA 1WY2A 1KQ9A 1QXZA 4FLJA 4IDYA 4ZWUA 4ZWPA 2GG2A 4RZYA 3PKEA 4FUKA 3IU7A 4IU6A 4U76A 3IU9A 3TB5A 1WN1A 4U69A 2OAZA 3IU8A 2EVMA 1YJ3A 3OOOA 5D6FA 5JHUA 2BHBA 2V3YA 1A16A 2ZSGA 3OVKA 3PKAA 4U6WA 2GU7A 3BIPA 5CE6A 4IKUA 4FLIA 2BWXA 3PKCA 2HOWA 4U1BA 4FKCA 1WL6A 3D27A 2BHDA 5CDEA 1R5GA 2IW2A 3MATA 3CTZA 2GU6A 3BIQA 2GG3A 3O5VA 4A6VA 1C22A 4ZNGA 4QR8A 2Q93A 1W2MA 3FMRA 1YW9A 3PKDA 2EVCA 2ADUA 2B3LA 2Q92A 1W7VA 2OKNA 4S01A 3QOCA 4B28A 1C21A 3CB6A 2BWTA 1KQ0A 4S2RP 2BWWA 4U6EA 4OOKA 5CIKA 3CB5A 4FO7A 4PNCA 1WKMA 1BN5A 1C23A 1KP0A 2BWSA 3I7MA 5FCHA 2GGBA 1YW7A 1XGNA 4ZWOA 5D6EA 2DFIA 3RVAA 1CHMA 4IPAA 5CDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R60 A;  4IEC A;  5E5B A;  3TAV A;  4RZZ A;  3BIT A;  4S00 A;  2GZ5 A;  4U6C A;  3PKB A;  1R5H A;  2V3Z A;  2EVO A;  4KM3 A;  4EGE A;  4U70 A;  3L24 A;  2BWU A;  3L7G A;  2GTX A;  2BWV A;  3IL0 A;  5CNX A;  1C24 A;  3PEB A;  3PN9 A;  1XGM A;  4IKT A;  4JUQ A;  2BN7 A;  2NQ7 A;  1XGS A;  3MR1 A;  5E2C A;  1QXW A;  1M35 A;  1XGO A;  1YVM A;  2P99 A;  2BH3 A;  2P9A A;  1WL9 A;  1B59 A;  5JFR A;  1R58 A;  3S6B A;  3MX6 A;  1WLR A;  3Q6D A;  4S2T P;  4IF7 A;  2Q96 A;  2GU5 A;  2Q95 A;  3FMQ A;  2Q94 A;  2NQ6 A;  2GG9 A;  2BHC A;  4U6J A;  2V6C A;  4HXX A;  1O0X A;  2EA2 A;  4MAT A;  1B6A A;  5JI6 A;  4U71 A;  4FLL A;  3ROR A;  1PV9 A;  2GA2 A;  4IKR A;  2V3X A;  1XNZ A;  1N51 A;  1QZY A;  2GG7 A;  4IKS A;  4PV4 A;  3FM3 A;  5CLS A;  2GG5 A;  2B3K A;  2GG0 A;  2BB7 A;  1Y1N A;  4FO8 A;  4FLK A;  4A6W A;  1WBQ A;  4U75 A;  1YW8 A;  2B3H A;  2GGC A;  2BHA A;  5FCF A;  5CDL A;  4Z7M A;  2GG8 A;  1C27 A;  2G6P A;  2Q8K A;  2GU4 A;  2MAT A;  1MAT A;  2P98 A;  1BOA A;  2EA4 A;  1JAW A;  4RGZ 1;  2BWY A;  3IG4 A;  4U73 A;  1QXY A;  4U6Z A;  1WY2 A;  1KQ9 A;  1QXZ A;  4FLJ A;  4IDY A;  4ZWU A;  4ZWP A;  2GG2 A;  4RZY A;  3PKE A;  4FUK A;  3IU7 A;  4IU6 A;  4U76 A;  3IU9 A;  3TB5 A;  1WN1 A;  4U69 A;  2OAZ A;  3IU8 A;  2EVM A;  1YJ3 A;  3OOO A;  5D6F A;  5JHU A;  2BHB A;  2V3Y A;  1A16 A;  2ZSG A;  3OVK A;  3PKA A;  4U6W A;  2GU7 A;  3BIP A;  5CE6 A;  4IKU A;  4FLI A;  2BWX A;  3PKC A;  2HOW A;  4U1B A;  4FKC A;  1WL6 A;  3D27 A;  2BHD A;  5CDE A;  1R5G A;  2IW2 A;  3MAT A;  3CTZ A;  2GU6 A;  3BIQ A;  2GG3 A;  3O5V A;  4A6V A;  1C22 A;  4ZNG A;  4QR8 A;  2Q93 A;  1W2M A;  3FMR A;  1YW9 A;  3PKD A;  2EVC A;  2ADU A;  2B3L A;  2Q92 A;  1W7V A;  2OKN A;  4S01 A;  3QOC A;  4B28 A;  1C21 A;  3CB6 A;  2BWT A;  1KQ0 A;  4S2R P;  2BWW A;  4U6E A;  4OOK A;  5CIK A;  3CB5 A;  4FO7 A;  4PNC A;  1WKM A;  1BN5 A;  1C23 A;  1KP0 A;  2BWS A;  3I7M A;  5FCH A;  2GGB A;  1YW7 A;  1XGN A;  4ZWO A;  5D6E A;  2DFI A;  3RVA A;  1CHM A;  4IPA A;  5CDV A; 
#chains in the Genus database with same CATH topology
 4R60 A;  4IEC A;  5E5B A;  3TAV A;  4RZZ A;  3BIT A;  4S00 A;  2GZ5 A;  4U6C A;  3PKB A;  1R5H A;  2V3Z A;  2EVO A;  4KM3 A;  4EGE A;  4U70 A;  3L24 A;  2BWU A;  3L7G A;  2GTX A;  2BWV A;  3IL0 A;  5CNX A;  1C24 A;  3PEB A;  3PN9 A;  1XGM A;  4IKT A;  4JUQ A;  2BN7 A;  2NQ7 A;  1XGS A;  3MR1 A;  5E2C A;  1QXW A;  1M35 A;  1XGO A;  1YVM A;  2P99 A;  2BH3 A;  2P9A A;  1WL9 A;  1B59 A;  5JFR A;  1R58 A;  3S6B A;  3MX6 A;  1WLR A;  3Q6D A;  4S2T P;  4IF7 A;  2Q96 A;  2GU5 A;  2Q95 A;  3FMQ A;  2Q94 A;  2NQ6 A;  2GG9 A;  2BHC A;  4U6J A;  2V6C A;  4HXX A;  1O0X A;  2EA2 A;  4MAT A;  1B6A A;  5JI6 A;  4U71 A;  4FLL A;  3ROR A;  1PV9 A;  2GA2 A;  4IKR A;  2V3X A;  1XNZ A;  1N51 A;  1QZY A;  2GG7 A;  4IKS A;  4PV4 A;  3FM3 A;  5CLS A;  2GG5 A;  2B3K A;  2GG0 A;  2BB7 A;  1Y1N A;  4FO8 A;  4FLK A;  4A6W A;  1WBQ A;  4U75 A;  1YW8 A;  2B3H A;  2GGC A;  2BHA A;  5FCF A;  5CDL A;  4Z7M A;  2GG8 A;  1C27 A;  2G6P A;  2Q8K A;  2GU4 A;  2MAT A;  1MAT A;  2P98 A;  1BOA A;  2EA4 A;  1JAW A;  4RGZ 1;  2BWY A;  3IG4 A;  4U73 A;  1QXY A;  4U6Z A;  1WY2 A;  1KQ9 A;  1QXZ A;  4FLJ A;  4IDY A;  4ZWU A;  4ZWP A;  2GG2 A;  4RZY A;  3PKE A;  4FUK A;  3IU7 A;  4IU6 A;  4U76 A;  3IU9 A;  3TB5 A;  1WN1 A;  4U69 A;  2OAZ A;  3IU8 A;  2EVM A;  1YJ3 A;  3OOO A;  5D6F A;  5JHU A;  2BHB A;  2V3Y A;  1A16 A;  2ZSG A;  3OVK A;  3PKA A;  4U6W A;  2GU7 A;  3BIP A;  5CE6 A;  4IKU A;  4FLI A;  2BWX A;  3PKC A;  2HOW A;  4U1B A;  4FKC A;  1WL6 A;  3D27 A;  2BHD A;  5CDE A;  1R5G A;  2IW2 A;  3MAT A;  3CTZ A;  2GU6 A;  3BIQ A;  2GG3 A;  3O5V A;  4A6V A;  1C22 A;  4ZNG A;  4QR8 A;  2Q93 A;  1W2M A;  3FMR A;  1YW9 A;  3PKD A;  2EVC A;  2ADU A;  2B3L A;  2Q92 A;  1W7V A;  2OKN A;  4S01 A;  3QOC A;  4B28 A;  1C21 A;  3CB6 A;  2BWT A;  1KQ0 A;  4S2R P;  2BWW A;  4U6E A;  4OOK A;  5CIK A;  3CB5 A;  4FO7 A;  4PNC A;  1WKM A;  1BN5 A;  1C23 A;  1KP0 A;  2BWS A;  3I7M A;  5FCH A;  2GGB A;  1YW7 A;  1XGN A;  4ZWO A;  5D6E A;  2DFI A;  3RVA A;  1CHM A;  4IPA A;  5CDV A; 
#chains in the Genus database with same CATH homology
 4R60 A;  4IEC A;  5E5B A;  3TAV A;  4RZZ A;  3BIT A;  4S00 A;  2GZ5 A;  4U6C A;  3PKB A;  1R5H A;  2V3Z A;  2EVO A;  4KM3 A;  4EGE A;  4U70 A;  3L24 A;  2BWU A;  3L7G A;  2GTX A;  2BWV A;  3IL0 A;  5CNX A;  1C24 A;  3PEB A;  3PN9 A;  1XGM A;  4IKT A;  4JUQ A;  2BN7 A;  2NQ7 A;  1XGS A;  3MR1 A;  5E2C A;  1QXW A;  1M35 A;  1XGO A;  1YVM A;  2P99 A;  2BH3 A;  2P9A A;  1WL9 A;  1B59 A;  5JFR A;  1R58 A;  3S6B A;  3MX6 A;  1WLR A;  3Q6D A;  4S2T P;  4IF7 A;  2Q96 A;  2GU5 A;  2Q95 A;  3FMQ A;  2Q94 A;  2NQ6 A;  2GG9 A;  2BHC A;  4U6J A;  2V6C A;  4HXX A;  1O0X A;  2EA2 A;  4MAT A;  1B6A A;  5JI6 A;  4U71 A;  4FLL A;  3ROR A;  1PV9 A;  2GA2 A;  4IKR A;  2V3X A;  1XNZ A;  1N51 A;  1QZY A;  2GG7 A;  4IKS A;  4PV4 A;  3FM3 A;  5CLS A;  2GG5 A;  2B3K A;  2GG0 A;  2BB7 A;  1Y1N A;  4FO8 A;  4FLK A;  4A6W A;  1WBQ A;  4U75 A;  1YW8 A;  2B3H A;  2GGC A;  2BHA A;  5FCF A;  5CDL A;  4Z7M A;  2GG8 A;  1C27 A;  2G6P A;  2Q8K A;  2GU4 A;  2MAT A;  1MAT A;  2P98 A;  1BOA A;  2EA4 A;  1JAW A;  4RGZ 1;  2BWY A;  3IG4 A;  4U73 A;  1QXY A;  4U6Z A;  1WY2 A;  1KQ9 A;  1QXZ A;  4FLJ A;  4IDY A;  4ZWU A;  4ZWP A;  2GG2 A;  4RZY A;  3PKE A;  4FUK A;  3IU7 A;  4IU6 A;  4U76 A;  3IU9 A;  3TB5 A;  1WN1 A;  4U69 A;  2OAZ A;  3IU8 A;  2EVM A;  1YJ3 A;  3OOO A;  5D6F A;  5JHU A;  2BHB A;  2V3Y A;  1A16 A;  2ZSG A;  3OVK A;  3PKA A;  4U6W A;  2GU7 A;  3BIP A;  5CE6 A;  4IKU A;  4FLI A;  2BWX A;  3PKC A;  2HOW A;  4U1B A;  4FKC A;  1WL6 A;  3D27 A;  2BHD A;  5CDE A;  1R5G A;  2IW2 A;  3MAT A;  3CTZ A;  2GU6 A;  3BIQ A;  2GG3 A;  3O5V A;  4A6V A;  1C22 A;  4ZNG A;  4QR8 A;  2Q93 A;  1W2M A;  3FMR A;  1YW9 A;  3PKD A;  2EVC A;  2ADU A;  2B3L A;  2Q92 A;  1W7V A;  2OKN A;  4S01 A;  3QOC A;  4B28 A;  1C21 A;  3CB6 A;  2BWT A;  1KQ0 A;  4S2R P;  2BWW A;  4U6E A;  4OOK A;  5CIK A;  3CB5 A;  4FO7 A;  4PNC A;  1WKM A;  1BN5 A;  1C23 A;  1KP0 A;  2BWS A;  3I7M A;  5FCH A;  2GGB A;  1YW7 A;  1XGN A;  4ZWO A;  5D6E A;  2DFI A;  3RVA A;  1CHM A;  4IPA A;  5CDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...