2BHCA

Na substituted e. coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhcA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhcA02
4RZYA 3IL0A 2GU5A 4S00A 2GG5A 1C21A 1QXWA 5CDVA 1R58A 2Q94A 5E5BA 4U6EA 5CE6A 3RVAA 1WL6A 4FLJA 1YJ3A 2EVOA 1YW8A 1YVMA 2EVCA 2BWXA 1KQ0A 1XGNA 4U70A 4U73A 4U6WA 4IKTA 3PEBA 3L24A 3PKDA 4R60A 4B28A 1M35A 4ZWOA 2IW2A 2B3HA 2GZ5A 5E2CA 2OAZA 2Q92A 2BWYA 5FCFA 2BHAA 2GG7A 2GTXA 1BOAA 3PKBA 2HOWA 1KP0A 3FMRA 2V6CA 4IKRA 2BWSA 3IU9A 4JUQA 2Q95A 4A6WA 4OOKA 4PV4A 4S2RP 2V3YA 3BIPA 2EA2A 3IU7A 4IPAA 4U6JA 3CB5A 1O0XA 1R5GA 3PN9A 3FMQA 1PV9A 5CDEA 1C27A 4IECA 1YW9A 2BWWA 3CTZA 1XNZA 3L7GA 1C22A 1WY2A 2G6PA 1WL9A 3I7MA 3MATA 4FO8A 2DFIA 5D6EA 3BIQA 4IF7A 5CNXA 4IKUA 4FLLA 2BHCA 3TAVA 1B6AA 4U6CA 1WKMA 3Q6DA 2GU6A 1N51A 2NQ7A 1XGMA 4KM3A 2MATA 2Q93A 2P99A 4ZWUA 3QOCA 3S6BA 3IU8A 3MX6A 3CB6A 5JFRA 4QR8A 4IDYA 2Q8KA 1WN1A 1C23A 4A6VA 2BWVA 2ADUA 4RGZ1 1QXYA 2BB7A 3D27A 2BHDA 3FM3A 4FLKA 1C24A 1Y1NA 4ZNGA 3MR1A 3PKCA 1QXZA 1KQ9A 4FLIA 4U6ZA 1XGSA 2BN7A 4U71A 1YW7A 2BH3A 2GG3A 4RZZA 4IU6A 3RORA 2GG0A 2EVMA 4MATA 2ZSGA 3IG4A 4S01A 1QZYA 2BWUA 2B3LA 5JI6A 2GG8A 4HXXA 5D6FA 4S2TP 4ZWPA 4IKSA 3O5VA 5CIKA 2BHBA 2B3KA 3OOOA 1W7VA 1WLRA 1JAWA 4EGEA 2GGCA 5FCHA 1CHMA 1XGOA 3PKEA 5JHUA 1WBQA 2V3ZA 2OKNA 3BITA 4U75A 5CDLA 2V3XA 4FKCA 2Q96A 1R5HA 2BWTA 2GG9A 2GA2A 4PNCA 3TB5A 1B59A 2P9AA 2GU4A 2GGBA 3PKAA 2P98A 4Z7MA 2NQ6A 2GU7A 3OVKA 2GG2A 1BN5A 2EA4A 4FO7A 4U76A 1MATA 4U69A 4FUKA 1W2MA 4U1BA 1A16A 5CLSA
chains in the Genus database with same CATH superfamily
4RZYA 3IL0A 2GU5A 4S00A 2GG5A 1C21A 1QXWA 5CDVA 1R58A 2Q94A 5E5BA 4U6EA 5CE6A 3RVAA 1WL6A 4FLJA 1YJ3A 2EVOA 1YW8A 1YVMA 2EVCA 2BWXA 1KQ0A 1XGNA 4U70A 4U73A 4U6WA 4IKTA 3PEBA 3L24A 3PKDA 4R60A 4B28A 1M35A 4ZWOA 2IW2A 2B3HA 2GZ5A 5E2CA 2OAZA 2Q92A 2BWYA 5FCFA 2BHAA 2GG7A 2GTXA 1BOAA 3PKBA 2HOWA 1KP0A 3FMRA 2V6CA 4IKRA 2BWSA 3IU9A 4JUQA 2Q95A 4A6WA 4OOKA 4PV4A 4S2RP 2V3YA 3BIPA 2EA2A 3IU7A 4IPAA 4U6JA 3CB5A 1O0XA 1R5GA 3PN9A 3FMQA 1PV9A 5CDEA 1C27A 4IECA 1YW9A 2BWWA 3CTZA 1XNZA 3L7GA 1C22A 1WY2A 2G6PA 1WL9A 3I7MA 3MATA 4FO8A 2DFIA 5D6EA 3BIQA 4IF7A 5CNXA 4IKUA 4FLLA 2BHCA 3TAVA 1B6AA 4U6CA 1WKMA 3Q6DA 2GU6A 1N51A 2NQ7A 1XGMA 4KM3A 2MATA 2Q93A 2P99A 4ZWUA 3QOCA 3S6BA 3IU8A 3MX6A 3CB6A 5JFRA 4QR8A 4IDYA 2Q8KA 1WN1A 1C23A 4A6VA 2BWVA 2ADUA 4RGZ1 1QXYA 2BB7A 3D27A 2BHDA 3FM3A 4FLKA 1C24A 1Y1NA 4ZNGA 3MR1A 3PKCA 1QXZA 1KQ9A 4FLIA 4U6ZA 1XGSA 2BN7A 4U71A 1YW7A 2BH3A 2GG3A 4RZZA 4IU6A 3RORA 2GG0A 2EVMA 4MATA 2ZSGA 3IG4A 4S01A 1QZYA 2BWUA 2B3LA 5JI6A 2GG8A 4HXXA 5D6FA 4S2TP 4ZWPA 4IKSA 3O5VA 5CIKA 2BHBA 2B3KA 3OOOA 1W7VA 1WLRA 1JAWA 4EGEA 2GGCA 5FCHA 1CHMA 1XGOA 3PKEA 5JHUA 1WBQA 2V3ZA 2OKNA 3BITA 4U75A 5CDLA 2V3XA 4FKCA 2Q96A 1R5HA 2BWTA 2GG9A 2GA2A 4PNCA 3TB5A 1B59A 2P9AA 2GU4A 2GGBA 3PKAA 2P98A 4Z7MA 2NQ6A 2GU7A 3OVKA 2GG2A 1BN5A 2EA4A 4FO7A 4U76A 1MATA 4U69A 4FUKA 1W2MA 4U1BA 1A16A 5CLSA
chains in the Genus database with same CATH topology
4RZYA 3IL0A 2GU5A 4S00A 2GG5A 1C21A 1QXWA 5CDVA 1R58A 2Q94A 5E5BA 4U6EA 5CE6A 3RVAA 1WL6A 4FLJA 1YJ3A 2EVOA 1YW8A 1YVMA 2EVCA 2BWXA 1KQ0A 1XGNA 4U70A 4U73A 4U6WA 4IKTA 3PEBA 3L24A 3PKDA 4R60A 4B28A 1M35A 4ZWOA 2IW2A 2B3HA 2GZ5A 5E2CA 2OAZA 2Q92A 2BWYA 5FCFA 2BHAA 2GG7A 2GTXA 1BOAA 3PKBA 2HOWA 1KP0A 3FMRA 2V6CA 4IKRA 2BWSA 3IU9A 4JUQA 2Q95A 4A6WA 4OOKA 4PV4A 4S2RP 2V3YA 3BIPA 2EA2A 3IU7A 4IPAA 4U6JA 3CB5A 1O0XA 1R5GA 3PN9A 3FMQA 1PV9A 5CDEA 1C27A 4IECA 1YW9A 2BWWA 3CTZA 1XNZA 3L7GA 1C22A 1WY2A 2G6PA 1WL9A 3I7MA 3MATA 4FO8A 2DFIA 5D6EA 3BIQA 4IF7A 5CNXA 4IKUA 4FLLA 2BHCA 3TAVA 1B6AA 4U6CA 1WKMA 3Q6DA 2GU6A 1N51A 2NQ7A 1XGMA 4KM3A 2MATA 2Q93A 2P99A 4ZWUA 3QOCA 3S6BA 3IU8A 3MX6A 3CB6A 5JFRA 4QR8A 4IDYA 2Q8KA 1WN1A 1C23A 4A6VA 2BWVA 2ADUA 4RGZ1 1QXYA 2BB7A 3D27A 2BHDA 3FM3A 4FLKA 1C24A 1Y1NA 4ZNGA 3MR1A 3PKCA 1QXZA 1KQ9A 4FLIA 4U6ZA 1XGSA 2BN7A 4U71A 1YW7A 2BH3A 2GG3A 4RZZA 4IU6A 3RORA 2GG0A 2EVMA 4MATA 2ZSGA 3IG4A 4S01A 1QZYA 2BWUA 2B3LA 5JI6A 2GG8A 4HXXA 5D6FA 4S2TP 4ZWPA 4IKSA 3O5VA 5CIKA 2BHBA 2B3KA 3OOOA 1W7VA 1WLRA 1JAWA 4EGEA 2GGCA 5FCHA 1CHMA 1XGOA 3PKEA 5JHUA 1WBQA 2V3ZA 2OKNA 3BITA 4U75A 5CDLA 2V3XA 4FKCA 2Q96A 1R5HA 2BWTA 2GG9A 2GA2A 4PNCA 3TB5A 1B59A 2P9AA 2GU4A 2GGBA 3PKAA 2P98A 4Z7MA 2NQ6A 2GU7A 3OVKA 2GG2A 1BN5A 2EA4A 4FO7A 4U76A 1MATA 4U69A 4FUKA 1W2MA 4U1BA 1A16A 5CLSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RZY A;  3IL0 A;  2GU5 A;  4S00 A;  2GG5 A;  1C21 A;  1QXW A;  5CDV A;  1R58 A;  2Q94 A;  5E5B A;  4U6E A;  5CE6 A;  3RVA A;  1WL6 A;  4FLJ A;  1YJ3 A;  2EVO A;  1YW8 A;  1YVM A;  2EVC A;  2BWX A;  1KQ0 A;  1XGN A;  4U70 A;  4U73 A;  4U6W A;  4IKT A;  3PEB A;  3L24 A;  3PKD A;  4R60 A;  4B28 A;  1M35 A;  4ZWO A;  2IW2 A;  2B3H A;  2GZ5 A;  5E2C A;  2OAZ A;  2Q92 A;  2BWY A;  5FCF A;  2BHA A;  2GG7 A;  2GTX A;  1BOA A;  3PKB A;  2HOW A;  1KP0 A;  3FMR A;  2V6C A;  4IKR A;  2BWS A;  3IU9 A;  4JUQ A;  2Q95 A;  4A6W A;  4OOK A;  4PV4 A;  4S2R P;  2V3Y A;  3BIP A;  2EA2 A;  3IU7 A;  4IPA A;  4U6J A;  3CB5 A;  1O0X A;  1R5G A;  3PN9 A;  3FMQ A;  1PV9 A;  5CDE A;  1C27 A;  4IEC A;  1YW9 A;  2BWW A;  3CTZ A;  1XNZ A;  3L7G A;  1C22 A;  1WY2 A;  2G6P A;  1WL9 A;  3I7M A;  3MAT A;  4FO8 A;  2DFI A;  5D6E A;  3BIQ A;  4IF7 A;  5CNX A;  4IKU A;  4FLL A;  2BHC A;  3TAV A;  1B6A A;  4U6C A;  1WKM A;  3Q6D A;  2GU6 A;  1N51 A;  2NQ7 A;  1XGM A;  4KM3 A;  2MAT A;  2Q93 A;  2P99 A;  4ZWU A;  3QOC A;  3S6B A;  3IU8 A;  3MX6 A;  3CB6 A;  5JFR A;  4QR8 A;  4IDY A;  2Q8K A;  1WN1 A;  1C23 A;  4A6V A;  2BWV A;  2ADU A;  4RGZ 1;  1QXY A;  2BB7 A;  3D27 A;  2BHD A;  3FM3 A;  4FLK A;  1C24 A;  1Y1N A;  4ZNG A;  3MR1 A;  3PKC A;  1QXZ A;  1KQ9 A;  4FLI A;  4U6Z A;  1XGS A;  2BN7 A;  4U71 A;  1YW7 A;  2BH3 A;  2GG3 A;  4RZZ A;  4IU6 A;  3ROR A;  2GG0 A;  2EVM A;  4MAT A;  2ZSG A;  3IG4 A;  4S01 A;  1QZY A;  2BWU A;  2B3L A;  5JI6 A;  2GG8 A;  4HXX A;  5D6F A;  4S2T P;  4ZWP A;  4IKS A;  3O5V A;  5CIK A;  2BHB A;  2B3K A;  3OOO A;  1W7V A;  1WLR A;  1JAW A;  4EGE A;  2GGC A;  5FCH A;  1CHM A;  1XGO A;  3PKE A;  5JHU A;  1WBQ A;  2V3Z A;  2OKN A;  3BIT A;  4U75 A;  5CDL A;  2V3X A;  4FKC A;  2Q96 A;  1R5H A;  2BWT A;  2GG9 A;  2GA2 A;  4PNC A;  3TB5 A;  1B59 A;  2P9A A;  2GU4 A;  2GGB A;  3PKA A;  2P98 A;  4Z7M A;  2NQ6 A;  2GU7 A;  3OVK A;  2GG2 A;  1BN5 A;  2EA4 A;  4FO7 A;  4U76 A;  1MAT A;  4U69 A;  4FUK A;  1W2M A;  4U1B A;  1A16 A;  5CLS A; 
#chains in the Genus database with same CATH topology
 4RZY A;  3IL0 A;  2GU5 A;  4S00 A;  2GG5 A;  1C21 A;  1QXW A;  5CDV A;  1R58 A;  2Q94 A;  5E5B A;  4U6E A;  5CE6 A;  3RVA A;  1WL6 A;  4FLJ A;  1YJ3 A;  2EVO A;  1YW8 A;  1YVM A;  2EVC A;  2BWX A;  1KQ0 A;  1XGN A;  4U70 A;  4U73 A;  4U6W A;  4IKT A;  3PEB A;  3L24 A;  3PKD A;  4R60 A;  4B28 A;  1M35 A;  4ZWO A;  2IW2 A;  2B3H A;  2GZ5 A;  5E2C A;  2OAZ A;  2Q92 A;  2BWY A;  5FCF A;  2BHA A;  2GG7 A;  2GTX A;  1BOA A;  3PKB A;  2HOW A;  1KP0 A;  3FMR A;  2V6C A;  4IKR A;  2BWS A;  3IU9 A;  4JUQ A;  2Q95 A;  4A6W A;  4OOK A;  4PV4 A;  4S2R P;  2V3Y A;  3BIP A;  2EA2 A;  3IU7 A;  4IPA A;  4U6J A;  3CB5 A;  1O0X A;  1R5G A;  3PN9 A;  3FMQ A;  1PV9 A;  5CDE A;  1C27 A;  4IEC A;  1YW9 A;  2BWW A;  3CTZ A;  1XNZ A;  3L7G A;  1C22 A;  1WY2 A;  2G6P A;  1WL9 A;  3I7M A;  3MAT A;  4FO8 A;  2DFI A;  5D6E A;  3BIQ A;  4IF7 A;  5CNX A;  4IKU A;  4FLL A;  2BHC A;  3TAV A;  1B6A A;  4U6C A;  1WKM A;  3Q6D A;  2GU6 A;  1N51 A;  2NQ7 A;  1XGM A;  4KM3 A;  2MAT A;  2Q93 A;  2P99 A;  4ZWU A;  3QOC A;  3S6B A;  3IU8 A;  3MX6 A;  3CB6 A;  5JFR A;  4QR8 A;  4IDY A;  2Q8K A;  1WN1 A;  1C23 A;  4A6V A;  2BWV A;  2ADU A;  4RGZ 1;  1QXY A;  2BB7 A;  3D27 A;  2BHD A;  3FM3 A;  4FLK A;  1C24 A;  1Y1N A;  4ZNG A;  3MR1 A;  3PKC A;  1QXZ A;  1KQ9 A;  4FLI A;  4U6Z A;  1XGS A;  2BN7 A;  4U71 A;  1YW7 A;  2BH3 A;  2GG3 A;  4RZZ A;  4IU6 A;  3ROR A;  2GG0 A;  2EVM A;  4MAT A;  2ZSG A;  3IG4 A;  4S01 A;  1QZY A;  2BWU A;  2B3L A;  5JI6 A;  2GG8 A;  4HXX A;  5D6F A;  4S2T P;  4ZWP A;  4IKS A;  3O5V A;  5CIK A;  2BHB A;  2B3K A;  3OOO A;  1W7V A;  1WLR A;  1JAW A;  4EGE A;  2GGC A;  5FCH A;  1CHM A;  1XGO A;  3PKE A;  5JHU A;  1WBQ A;  2V3Z A;  2OKN A;  3BIT A;  4U75 A;  5CDL A;  2V3X A;  4FKC A;  2Q96 A;  1R5H A;  2BWT A;  2GG9 A;  2GA2 A;  4PNC A;  3TB5 A;  1B59 A;  2P9A A;  2GU4 A;  2GGB A;  3PKA A;  2P98 A;  4Z7M A;  2NQ6 A;  2GU7 A;  3OVK A;  2GG2 A;  1BN5 A;  2EA4 A;  4FO7 A;  4U76 A;  1MAT A;  4U69 A;  4FUK A;  1W2M A;  4U1B A;  1A16 A;  5CLS A; 
#chains in the Genus database with same CATH homology
 4RZY A;  3IL0 A;  2GU5 A;  4S00 A;  2GG5 A;  1C21 A;  1QXW A;  5CDV A;  1R58 A;  2Q94 A;  5E5B A;  4U6E A;  5CE6 A;  3RVA A;  1WL6 A;  4FLJ A;  1YJ3 A;  2EVO A;  1YW8 A;  1YVM A;  2EVC A;  2BWX A;  1KQ0 A;  1XGN A;  4U70 A;  4U73 A;  4U6W A;  4IKT A;  3PEB A;  3L24 A;  3PKD A;  4R60 A;  4B28 A;  1M35 A;  4ZWO A;  2IW2 A;  2B3H A;  2GZ5 A;  5E2C A;  2OAZ A;  2Q92 A;  2BWY A;  5FCF A;  2BHA A;  2GG7 A;  2GTX A;  1BOA A;  3PKB A;  2HOW A;  1KP0 A;  3FMR A;  2V6C A;  4IKR A;  2BWS A;  3IU9 A;  4JUQ A;  2Q95 A;  4A6W A;  4OOK A;  4PV4 A;  4S2R P;  2V3Y A;  3BIP A;  2EA2 A;  3IU7 A;  4IPA A;  4U6J A;  3CB5 A;  1O0X A;  1R5G A;  3PN9 A;  3FMQ A;  1PV9 A;  5CDE A;  1C27 A;  4IEC A;  1YW9 A;  2BWW A;  3CTZ A;  1XNZ A;  3L7G A;  1C22 A;  1WY2 A;  2G6P A;  1WL9 A;  3I7M A;  3MAT A;  4FO8 A;  2DFI A;  5D6E A;  3BIQ A;  4IF7 A;  5CNX A;  4IKU A;  4FLL A;  2BHC A;  3TAV A;  1B6A A;  4U6C A;  1WKM A;  3Q6D A;  2GU6 A;  1N51 A;  2NQ7 A;  1XGM A;  4KM3 A;  2MAT A;  2Q93 A;  2P99 A;  4ZWU A;  3QOC A;  3S6B A;  3IU8 A;  3MX6 A;  3CB6 A;  5JFR A;  4QR8 A;  4IDY A;  2Q8K A;  1WN1 A;  1C23 A;  4A6V A;  2BWV A;  2ADU A;  4RGZ 1;  1QXY A;  2BB7 A;  3D27 A;  2BHD A;  3FM3 A;  4FLK A;  1C24 A;  1Y1N A;  4ZNG A;  3MR1 A;  3PKC A;  1QXZ A;  1KQ9 A;  4FLI A;  4U6Z A;  1XGS A;  2BN7 A;  4U71 A;  1YW7 A;  2BH3 A;  2GG3 A;  4RZZ A;  4IU6 A;  3ROR A;  2GG0 A;  2EVM A;  4MAT A;  2ZSG A;  3IG4 A;  4S01 A;  1QZY A;  2BWU A;  2B3L A;  5JI6 A;  2GG8 A;  4HXX A;  5D6F A;  4S2T P;  4ZWP A;  4IKS A;  3O5V A;  5CIK A;  2BHB A;  2B3K A;  3OOO A;  1W7V A;  1WLR A;  1JAW A;  4EGE A;  2GGC A;  5FCH A;  1CHM A;  1XGO A;  3PKE A;  5JHU A;  1WBQ A;  2V3Z A;  2OKN A;  3BIT A;  4U75 A;  5CDL A;  2V3X A;  4FKC A;  2Q96 A;  1R5H A;  2BWT A;  2GG9 A;  2GA2 A;  4PNC A;  3TB5 A;  1B59 A;  2P9A A;  2GU4 A;  2GGB A;  3PKA A;  2P98 A;  4Z7M A;  2NQ6 A;  2GU7 A;  3OVK A;  2GG2 A;  1BN5 A;  2EA4 A;  4FO7 A;  4U76 A;  1MAT A;  4U69 A;  4FUK A;  1W2M A;  4U1B A;  1A16 A;  5CLS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...