2BHCA

Na substituted e. coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhcA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhcA02
1YJ3A 3L24A 2MATA 4FLLA 2BWXA 1QXZA 4OOKA 4U6EA 2GG8A 4U6ZA 4R60A 2V6CA 3OVKA 5FCFA 5JHUA 1C27A 1QXYA 3PEBA 4S00A 5CDLA 2GG7A 2GZ5A 4IDYA 2GGBA 4IKUA 2EVOA 2GU7A 5JI6A 2P9AA 1W2MA 2BWSA 3TB5A 2BHDA 4Z7MA 2BHAA 4U6WA 2EA4A 4IKTA 2Q92A 2Q8KA 4EGEA 4IPAA 3BITA 1JAWA 1WL9A 3PKAA 4S2TP 3PKBA 4FLIA 1XGMA 4ZWOA 2BWVA 4IECA 4FLKA 2BWTA 4B28A 1C22A 4U69A 2NQ6A 1N51A 1YW7A 1QZYA 1CHMA 3S6BA 3QOCA 3TAVA 1XNZA 3IU7A 2ZSGA 3PN9A 2GG5A 4RZYA 2BHBA 3PKCA 1YW9A 4A6VA 2Q93A 2DFIA 4FO7A 5CDVA 1O0XA 2GU4A 4PV4A 1KP0A 2Q95A 4IKRA 2BWUA 3CB6A 4FO8A 3MATA 5CLSA 3O5VA 2HOWA 1BOAA 4RZZA 2V3ZA 3Q6DA 5CDEA 2Q94A 3FM3A 3FMQA 5D6FA 2V3XA 3CB5A 4FLJA 4S01A 1XGNA 2B3HA 4U75A 1WBQA 1WLRA 1C24A 1R5GA 2BN7A 1M35A 5CE6A 3PKEA 4PNCA 1WN1A 3IG4A 3RORA 4RGZ1 5CNXA 3MR1A 3BIQA 3RVAA 1KQ9A 1XGSA 4JUQA 5CIKA 4ZWUA 2IW2A 4ZNGA 2OKNA 1QXWA 2BB7A 3IU9A 5D6EA 3IU8A 4KM3A 1W7VA 3I7MA 4S2RP 4U6CA 1BN5A 3MX6A 2EA2A 2BH3A 5E2CA 1C23A 4IU6A 4U70A 4U6JA 2G6PA 1Y1NA 2GGCA 4QR8A 2GG3A 2GU5A 2GU6A 1XGOA 4A6WA 5FCHA 2V3YA 1R58A 1KQ0A 2B3LA 4FUKA 2GTXA 4MATA 2B3KA 3PKDA 1WY2A 4FKCA 3L7GA 2BWYA 3IL0A 1C21A 4U71A 2P99A 2NQ7A 4U76A 2P98A 1WL6A 3OOOA 4IKSA 2OAZA 2GG0A 3CTZA 4HXXA 4ZWPA 3D27A 4U73A 1YVMA 5E5BA 1A16A 5JFRA 4IF7A 1PV9A 1MATA 2EVCA 1B6AA 2GA2A 1YW8A 2Q96A 2BHCA 3BIPA 2GG2A 2EVMA 3FMRA 1B59A 1WKMA 2ADUA 2BWWA 2GG9A 1R5HA 4U1BA
chains in the Genus database with same CATH superfamily
1YJ3A 3L24A 2MATA 4FLLA 2BWXA 1QXZA 4OOKA 4U6EA 2GG8A 4U6ZA 4R60A 2V6CA 3OVKA 5FCFA 5JHUA 1C27A 1QXYA 3PEBA 4S00A 5CDLA 2GG7A 2GZ5A 4IDYA 2GGBA 4IKUA 2EVOA 2GU7A 5JI6A 2P9AA 1W2MA 2BWSA 3TB5A 2BHDA 4Z7MA 2BHAA 4U6WA 2EA4A 4IKTA 2Q92A 2Q8KA 4EGEA 4IPAA 3BITA 1JAWA 1WL9A 3PKAA 4S2TP 3PKBA 4FLIA 1XGMA 4ZWOA 2BWVA 4IECA 4FLKA 2BWTA 4B28A 1C22A 4U69A 2NQ6A 1N51A 1YW7A 1QZYA 1CHMA 3S6BA 3QOCA 3TAVA 1XNZA 3IU7A 2ZSGA 3PN9A 2GG5A 4RZYA 2BHBA 3PKCA 1YW9A 4A6VA 2Q93A 2DFIA 4FO7A 5CDVA 1O0XA 2GU4A 4PV4A 1KP0A 2Q95A 4IKRA 2BWUA 3CB6A 4FO8A 3MATA 5CLSA 3O5VA 2HOWA 1BOAA 4RZZA 2V3ZA 3Q6DA 5CDEA 2Q94A 3FM3A 3FMQA 5D6FA 2V3XA 3CB5A 4FLJA 4S01A 1XGNA 2B3HA 4U75A 1WBQA 1WLRA 1C24A 1R5GA 2BN7A 1M35A 5CE6A 3PKEA 4PNCA 1WN1A 3IG4A 3RORA 4RGZ1 5CNXA 3MR1A 3BIQA 3RVAA 1KQ9A 1XGSA 4JUQA 5CIKA 4ZWUA 2IW2A 4ZNGA 2OKNA 1QXWA 2BB7A 3IU9A 5D6EA 3IU8A 4KM3A 1W7VA 3I7MA 4S2RP 4U6CA 1BN5A 3MX6A 2EA2A 2BH3A 5E2CA 1C23A 4IU6A 4U70A 4U6JA 2G6PA 1Y1NA 2GGCA 4QR8A 2GG3A 2GU5A 2GU6A 1XGOA 4A6WA 5FCHA 2V3YA 1R58A 1KQ0A 2B3LA 4FUKA 2GTXA 4MATA 2B3KA 3PKDA 1WY2A 4FKCA 3L7GA 2BWYA 3IL0A 1C21A 4U71A 2P99A 2NQ7A 4U76A 2P98A 1WL6A 3OOOA 4IKSA 2OAZA 2GG0A 3CTZA 4HXXA 4ZWPA 3D27A 4U73A 1YVMA 5E5BA 1A16A 5JFRA 4IF7A 1PV9A 1MATA 2EVCA 1B6AA 2GA2A 1YW8A 2Q96A 2BHCA 3BIPA 2GG2A 2EVMA 3FMRA 1B59A 1WKMA 2ADUA 2BWWA 2GG9A 1R5HA 4U1BA
chains in the Genus database with same CATH topology
1YJ3A 3L24A 2MATA 4FLLA 2BWXA 1QXZA 4OOKA 4U6EA 2GG8A 4U6ZA 4R60A 2V6CA 3OVKA 5FCFA 5JHUA 1C27A 1QXYA 3PEBA 4S00A 5CDLA 2GG7A 2GZ5A 4IDYA 2GGBA 4IKUA 2EVOA 2GU7A 5JI6A 2P9AA 1W2MA 2BWSA 3TB5A 2BHDA 4Z7MA 2BHAA 4U6WA 2EA4A 4IKTA 2Q92A 2Q8KA 4EGEA 4IPAA 3BITA 1JAWA 1WL9A 3PKAA 4S2TP 3PKBA 4FLIA 1XGMA 4ZWOA 2BWVA 4IECA 4FLKA 2BWTA 4B28A 1C22A 4U69A 2NQ6A 1N51A 1YW7A 1QZYA 1CHMA 3S6BA 3QOCA 3TAVA 1XNZA 3IU7A 2ZSGA 3PN9A 2GG5A 4RZYA 2BHBA 3PKCA 1YW9A 4A6VA 2Q93A 2DFIA 4FO7A 5CDVA 1O0XA 2GU4A 4PV4A 1KP0A 2Q95A 4IKRA 2BWUA 3CB6A 4FO8A 3MATA 5CLSA 3O5VA 2HOWA 1BOAA 4RZZA 2V3ZA 3Q6DA 5CDEA 2Q94A 3FM3A 3FMQA 5D6FA 2V3XA 3CB5A 4FLJA 4S01A 1XGNA 2B3HA 4U75A 1WBQA 1WLRA 1C24A 1R5GA 2BN7A 1M35A 5CE6A 3PKEA 4PNCA 1WN1A 3IG4A 3RORA 4RGZ1 5CNXA 3MR1A 3BIQA 3RVAA 1KQ9A 1XGSA 4JUQA 5CIKA 4ZWUA 2IW2A 4ZNGA 2OKNA 1QXWA 2BB7A 3IU9A 5D6EA 3IU8A 4KM3A 1W7VA 3I7MA 4S2RP 4U6CA 1BN5A 3MX6A 2EA2A 2BH3A 5E2CA 1C23A 4IU6A 4U70A 4U6JA 2G6PA 1Y1NA 2GGCA 4QR8A 2GG3A 2GU5A 2GU6A 1XGOA 4A6WA 5FCHA 2V3YA 1R58A 1KQ0A 2B3LA 4FUKA 2GTXA 4MATA 2B3KA 3PKDA 1WY2A 4FKCA 3L7GA 2BWYA 3IL0A 1C21A 4U71A 2P99A 2NQ7A 4U76A 2P98A 1WL6A 3OOOA 4IKSA 2OAZA 2GG0A 3CTZA 4HXXA 4ZWPA 3D27A 4U73A 1YVMA 5E5BA 1A16A 5JFRA 4IF7A 1PV9A 1MATA 2EVCA 1B6AA 2GA2A 1YW8A 2Q96A 2BHCA 3BIPA 2GG2A 2EVMA 3FMRA 1B59A 1WKMA 2ADUA 2BWWA 2GG9A 1R5HA 4U1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YJ3 A;  3L24 A;  2MAT A;  4FLL A;  2BWX A;  1QXZ A;  4OOK A;  4U6E A;  2GG8 A;  4U6Z A;  4R60 A;  2V6C A;  3OVK A;  5FCF A;  5JHU A;  1C27 A;  1QXY A;  3PEB A;  4S00 A;  5CDL A;  2GG7 A;  2GZ5 A;  4IDY A;  2GGB A;  4IKU A;  2EVO A;  2GU7 A;  5JI6 A;  2P9A A;  1W2M A;  2BWS A;  3TB5 A;  2BHD A;  4Z7M A;  2BHA A;  4U6W A;  2EA4 A;  4IKT A;  2Q92 A;  2Q8K A;  4EGE A;  4IPA A;  3BIT A;  1JAW A;  1WL9 A;  3PKA A;  4S2T P;  3PKB A;  4FLI A;  1XGM A;  4ZWO A;  2BWV A;  4IEC A;  4FLK A;  2BWT A;  4B28 A;  1C22 A;  4U69 A;  2NQ6 A;  1N51 A;  1YW7 A;  1QZY A;  1CHM A;  3S6B A;  3QOC A;  3TAV A;  1XNZ A;  3IU7 A;  2ZSG A;  3PN9 A;  2GG5 A;  4RZY A;  2BHB A;  3PKC A;  1YW9 A;  4A6V A;  2Q93 A;  2DFI A;  4FO7 A;  5CDV A;  1O0X A;  2GU4 A;  4PV4 A;  1KP0 A;  2Q95 A;  4IKR A;  2BWU A;  3CB6 A;  4FO8 A;  3MAT A;  5CLS A;  3O5V A;  2HOW A;  1BOA A;  4RZZ A;  2V3Z A;  3Q6D A;  5CDE A;  2Q94 A;  3FM3 A;  3FMQ A;  5D6F A;  2V3X A;  3CB5 A;  4FLJ A;  4S01 A;  1XGN A;  2B3H A;  4U75 A;  1WBQ A;  1WLR A;  1C24 A;  1R5G A;  2BN7 A;  1M35 A;  5CE6 A;  3PKE A;  4PNC A;  1WN1 A;  3IG4 A;  3ROR A;  4RGZ 1;  5CNX A;  3MR1 A;  3BIQ A;  3RVA A;  1KQ9 A;  1XGS A;  4JUQ A;  5CIK A;  4ZWU A;  2IW2 A;  4ZNG A;  2OKN A;  1QXW A;  2BB7 A;  3IU9 A;  5D6E A;  3IU8 A;  4KM3 A;  1W7V A;  3I7M A;  4S2R P;  4U6C A;  1BN5 A;  3MX6 A;  2EA2 A;  2BH3 A;  5E2C A;  1C23 A;  4IU6 A;  4U70 A;  4U6J A;  2G6P A;  1Y1N A;  2GGC A;  4QR8 A;  2GG3 A;  2GU5 A;  2GU6 A;  1XGO A;  4A6W A;  5FCH A;  2V3Y A;  1R58 A;  1KQ0 A;  2B3L A;  4FUK A;  2GTX A;  4MAT A;  2B3K A;  3PKD A;  1WY2 A;  4FKC A;  3L7G A;  2BWY A;  3IL0 A;  1C21 A;  4U71 A;  2P99 A;  2NQ7 A;  4U76 A;  2P98 A;  1WL6 A;  3OOO A;  4IKS A;  2OAZ A;  2GG0 A;  3CTZ A;  4HXX A;  4ZWP A;  3D27 A;  4U73 A;  1YVM A;  5E5B A;  1A16 A;  5JFR A;  4IF7 A;  1PV9 A;  1MAT A;  2EVC A;  1B6A A;  2GA2 A;  1YW8 A;  2Q96 A;  2BHC A;  3BIP A;  2GG2 A;  2EVM A;  3FMR A;  1B59 A;  1WKM A;  2ADU A;  2BWW A;  2GG9 A;  1R5H A;  4U1B A; 
#chains in the Genus database with same CATH topology
 1YJ3 A;  3L24 A;  2MAT A;  4FLL A;  2BWX A;  1QXZ A;  4OOK A;  4U6E A;  2GG8 A;  4U6Z A;  4R60 A;  2V6C A;  3OVK A;  5FCF A;  5JHU A;  1C27 A;  1QXY A;  3PEB A;  4S00 A;  5CDL A;  2GG7 A;  2GZ5 A;  4IDY A;  2GGB A;  4IKU A;  2EVO A;  2GU7 A;  5JI6 A;  2P9A A;  1W2M A;  2BWS A;  3TB5 A;  2BHD A;  4Z7M A;  2BHA A;  4U6W A;  2EA4 A;  4IKT A;  2Q92 A;  2Q8K A;  4EGE A;  4IPA A;  3BIT A;  1JAW A;  1WL9 A;  3PKA A;  4S2T P;  3PKB A;  4FLI A;  1XGM A;  4ZWO A;  2BWV A;  4IEC A;  4FLK A;  2BWT A;  4B28 A;  1C22 A;  4U69 A;  2NQ6 A;  1N51 A;  1YW7 A;  1QZY A;  1CHM A;  3S6B A;  3QOC A;  3TAV A;  1XNZ A;  3IU7 A;  2ZSG A;  3PN9 A;  2GG5 A;  4RZY A;  2BHB A;  3PKC A;  1YW9 A;  4A6V A;  2Q93 A;  2DFI A;  4FO7 A;  5CDV A;  1O0X A;  2GU4 A;  4PV4 A;  1KP0 A;  2Q95 A;  4IKR A;  2BWU A;  3CB6 A;  4FO8 A;  3MAT A;  5CLS A;  3O5V A;  2HOW A;  1BOA A;  4RZZ A;  2V3Z A;  3Q6D A;  5CDE A;  2Q94 A;  3FM3 A;  3FMQ A;  5D6F A;  2V3X A;  3CB5 A;  4FLJ A;  4S01 A;  1XGN A;  2B3H A;  4U75 A;  1WBQ A;  1WLR A;  1C24 A;  1R5G A;  2BN7 A;  1M35 A;  5CE6 A;  3PKE A;  4PNC A;  1WN1 A;  3IG4 A;  3ROR A;  4RGZ 1;  5CNX A;  3MR1 A;  3BIQ A;  3RVA A;  1KQ9 A;  1XGS A;  4JUQ A;  5CIK A;  4ZWU A;  2IW2 A;  4ZNG A;  2OKN A;  1QXW A;  2BB7 A;  3IU9 A;  5D6E A;  3IU8 A;  4KM3 A;  1W7V A;  3I7M A;  4S2R P;  4U6C A;  1BN5 A;  3MX6 A;  2EA2 A;  2BH3 A;  5E2C A;  1C23 A;  4IU6 A;  4U70 A;  4U6J A;  2G6P A;  1Y1N A;  2GGC A;  4QR8 A;  2GG3 A;  2GU5 A;  2GU6 A;  1XGO A;  4A6W A;  5FCH A;  2V3Y A;  1R58 A;  1KQ0 A;  2B3L A;  4FUK A;  2GTX A;  4MAT A;  2B3K A;  3PKD A;  1WY2 A;  4FKC A;  3L7G A;  2BWY A;  3IL0 A;  1C21 A;  4U71 A;  2P99 A;  2NQ7 A;  4U76 A;  2P98 A;  1WL6 A;  3OOO A;  4IKS A;  2OAZ A;  2GG0 A;  3CTZ A;  4HXX A;  4ZWP A;  3D27 A;  4U73 A;  1YVM A;  5E5B A;  1A16 A;  5JFR A;  4IF7 A;  1PV9 A;  1MAT A;  2EVC A;  1B6A A;  2GA2 A;  1YW8 A;  2Q96 A;  2BHC A;  3BIP A;  2GG2 A;  2EVM A;  3FMR A;  1B59 A;  1WKM A;  2ADU A;  2BWW A;  2GG9 A;  1R5H A;  4U1B A; 
#chains in the Genus database with same CATH homology
 1YJ3 A;  3L24 A;  2MAT A;  4FLL A;  2BWX A;  1QXZ A;  4OOK A;  4U6E A;  2GG8 A;  4U6Z A;  4R60 A;  2V6C A;  3OVK A;  5FCF A;  5JHU A;  1C27 A;  1QXY A;  3PEB A;  4S00 A;  5CDL A;  2GG7 A;  2GZ5 A;  4IDY A;  2GGB A;  4IKU A;  2EVO A;  2GU7 A;  5JI6 A;  2P9A A;  1W2M A;  2BWS A;  3TB5 A;  2BHD A;  4Z7M A;  2BHA A;  4U6W A;  2EA4 A;  4IKT A;  2Q92 A;  2Q8K A;  4EGE A;  4IPA A;  3BIT A;  1JAW A;  1WL9 A;  3PKA A;  4S2T P;  3PKB A;  4FLI A;  1XGM A;  4ZWO A;  2BWV A;  4IEC A;  4FLK A;  2BWT A;  4B28 A;  1C22 A;  4U69 A;  2NQ6 A;  1N51 A;  1YW7 A;  1QZY A;  1CHM A;  3S6B A;  3QOC A;  3TAV A;  1XNZ A;  3IU7 A;  2ZSG A;  3PN9 A;  2GG5 A;  4RZY A;  2BHB A;  3PKC A;  1YW9 A;  4A6V A;  2Q93 A;  2DFI A;  4FO7 A;  5CDV A;  1O0X A;  2GU4 A;  4PV4 A;  1KP0 A;  2Q95 A;  4IKR A;  2BWU A;  3CB6 A;  4FO8 A;  3MAT A;  5CLS A;  3O5V A;  2HOW A;  1BOA A;  4RZZ A;  2V3Z A;  3Q6D A;  5CDE A;  2Q94 A;  3FM3 A;  3FMQ A;  5D6F A;  2V3X A;  3CB5 A;  4FLJ A;  4S01 A;  1XGN A;  2B3H A;  4U75 A;  1WBQ A;  1WLR A;  1C24 A;  1R5G A;  2BN7 A;  1M35 A;  5CE6 A;  3PKE A;  4PNC A;  1WN1 A;  3IG4 A;  3ROR A;  4RGZ 1;  5CNX A;  3MR1 A;  3BIQ A;  3RVA A;  1KQ9 A;  1XGS A;  4JUQ A;  5CIK A;  4ZWU A;  2IW2 A;  4ZNG A;  2OKN A;  1QXW A;  2BB7 A;  3IU9 A;  5D6E A;  3IU8 A;  4KM3 A;  1W7V A;  3I7M A;  4S2R P;  4U6C A;  1BN5 A;  3MX6 A;  2EA2 A;  2BH3 A;  5E2C A;  1C23 A;  4IU6 A;  4U70 A;  4U6J A;  2G6P A;  1Y1N A;  2GGC A;  4QR8 A;  2GG3 A;  2GU5 A;  2GU6 A;  1XGO A;  4A6W A;  5FCH A;  2V3Y A;  1R58 A;  1KQ0 A;  2B3L A;  4FUK A;  2GTX A;  4MAT A;  2B3K A;  3PKD A;  1WY2 A;  4FKC A;  3L7G A;  2BWY A;  3IL0 A;  1C21 A;  4U71 A;  2P99 A;  2NQ7 A;  4U76 A;  2P98 A;  1WL6 A;  3OOO A;  4IKS A;  2OAZ A;  2GG0 A;  3CTZ A;  4HXX A;  4ZWP A;  3D27 A;  4U73 A;  1YVM A;  5E5B A;  1A16 A;  5JFR A;  4IF7 A;  1PV9 A;  1MAT A;  2EVC A;  1B6A A;  2GA2 A;  1YW8 A;  2Q96 A;  2BHC A;  3BIP A;  2GG2 A;  2EVM A;  3FMR A;  1B59 A;  1WKM A;  2ADU A;  2BWW A;  2GG9 A;  1R5H A;  4U1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...