2BHCA

Na substituted e. coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
molecule keywords XAA-PRO AMINOPEPTIDASE
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhcA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhcA02
1YW9A 1BOAA 2GZ5A 4QR8A 1PV9A 3MR1A 2GGCA 1YVMA 2B3LA 5D6EA 4A6VA 1W7VA 2GG9A 1WBQA 3IU7A 4S2TP 1N51A 4B28A 1QXYA 2BWXA 4FLIA 2B3KA 1M35A 2NQ7A 3MATA 4FLKA 1QXWA 3CTZA 4KM3A 5E5BA 1YW8A 3FMQA 2GA2A 3Q6DA 1WL6A 2BWWA 3IU8A 3L7GA 2HOWA 3BIQA 3L24A 3PN9A 2ADUA 2Q93A 4A6WA 4U75A 2GU4A 1MATA 5CNXA 3PKBA 5CDLA 1YJ3A 2BWVA 4U73A 2Q8KA 4IKTA 1R5HA 1Y1NA 1W2MA 5FCHA 3I7MA 2NQ6A 1KQ0A 1A16A 4Z7MA 3OVKA 2BHCA 4IECA 4ZWOA 2MATA 5CE6A 4U6JA 2V3ZA 3CB5A 4RZYA 2EA4A 4IKRA 3PKEA 2BN7A 4FUKA 2P9AA 4U69A 5E2CA 3RVAA 3BITA 1B59A 5D6FA 1XGNA 3O5VA 4U6CA 1XGOA 2Q96A 4IU6A 4U6WA 3CB6A 2EA2A 2ZSGA 4RGZ1 2GU6A 2IW2A 1KQ9A 2V3XA 5JHUA 4JUQA 5JI6A 2GU5A 2V3YA 5CIKA 1O0XA 4OOKA 2G6PA 2GG2A 2OAZA 3TAVA 1WLRA 4IKUA 5FCFA 1C24A 1CHMA 3QOCA 4S2RP 4IPAA 1XGMA 5CLSA 2P99A 4IF7A 2GG0A 3IU9A 2P98A 4FO8A 1KP0A 2GTXA 1B6AA 1C21A 1WL9A 4EGEA 4U70A 4MATA 5JFRA 3OOOA 3BIPA 4ZWUA 3MX6A 2BWTA 2GG3A 2GG8A 4FKCA 4U1BA 4S01A 1R58A 4U71A 3D27A 3PEBA 4PV4A 1WN1A 4R60A 1QZYA 2GG5A 4FO7A 3RORA 4S00A 2EVOA 2BB7A 1C22A 2BHBA 2V6CA 4U6EA 1YW7A 2Q92A 1R5GA 1JAWA 2BHDA 1XNZA 2GGBA 4IKSA 3TB5A 3IL0A 4HXXA 3PKAA 2EVCA 3FMRA 4U76A 4U6ZA 1XGSA 2GG7A 2BH3A 1QXZA 3S6BA 5CDVA 4IDYA 3PKDA 4FLJA 3FM3A 2BWSA 1WKMA 2EVMA 2BWUA 1C23A 3PKCA 2BWYA 4ZNGA 1WY2A 2OKNA 2B3HA 4ZWPA 5CDEA 2DFIA 2BHAA 3IG4A 2GU7A 1BN5A 2Q94A 4RZZA 4FLLA 4PNCA 1C27A 2Q95A
chains in the Genus database with same CATH superfamily
1YW9A 1BOAA 2GZ5A 4QR8A 1PV9A 3MR1A 2GGCA 1YVMA 2B3LA 5D6EA 4A6VA 1W7VA 2GG9A 1WBQA 3IU7A 4S2TP 1N51A 4B28A 1QXYA 2BWXA 4FLIA 2B3KA 1M35A 2NQ7A 3MATA 4FLKA 1QXWA 3CTZA 4KM3A 5E5BA 1YW8A 3FMQA 2GA2A 3Q6DA 1WL6A 2BWWA 3IU8A 3L7GA 2HOWA 3BIQA 3L24A 3PN9A 2ADUA 2Q93A 4A6WA 4U75A 2GU4A 1MATA 5CNXA 3PKBA 5CDLA 1YJ3A 2BWVA 4U73A 2Q8KA 4IKTA 1R5HA 1Y1NA 1W2MA 5FCHA 3I7MA 2NQ6A 1KQ0A 1A16A 4Z7MA 3OVKA 2BHCA 4IECA 4ZWOA 2MATA 5CE6A 4U6JA 2V3ZA 3CB5A 4RZYA 2EA4A 4IKRA 3PKEA 2BN7A 4FUKA 2P9AA 4U69A 5E2CA 3RVAA 3BITA 1B59A 5D6FA 1XGNA 3O5VA 4U6CA 1XGOA 2Q96A 4IU6A 4U6WA 3CB6A 2EA2A 2ZSGA 4RGZ1 2GU6A 2IW2A 1KQ9A 2V3XA 5JHUA 4JUQA 5JI6A 2GU5A 2V3YA 5CIKA 1O0XA 4OOKA 2G6PA 2GG2A 2OAZA 3TAVA 1WLRA 4IKUA 5FCFA 1C24A 1CHMA 3QOCA 4S2RP 4IPAA 1XGMA 5CLSA 2P99A 4IF7A 2GG0A 3IU9A 2P98A 4FO8A 1KP0A 2GTXA 1B6AA 1C21A 1WL9A 4EGEA 4U70A 4MATA 5JFRA 3OOOA 3BIPA 4ZWUA 3MX6A 2BWTA 2GG3A 2GG8A 4FKCA 4U1BA 4S01A 1R58A 4U71A 3D27A 3PEBA 4PV4A 1WN1A 4R60A 1QZYA 2GG5A 4FO7A 3RORA 4S00A 2EVOA 2BB7A 1C22A 2BHBA 2V6CA 4U6EA 1YW7A 2Q92A 1R5GA 1JAWA 2BHDA 1XNZA 2GGBA 4IKSA 3TB5A 3IL0A 4HXXA 3PKAA 2EVCA 3FMRA 4U76A 4U6ZA 1XGSA 2GG7A 2BH3A 1QXZA 3S6BA 5CDVA 4IDYA 3PKDA 4FLJA 3FM3A 2BWSA 1WKMA 2EVMA 2BWUA 1C23A 3PKCA 2BWYA 4ZNGA 1WY2A 2OKNA 2B3HA 4ZWPA 5CDEA 2DFIA 2BHAA 3IG4A 2GU7A 1BN5A 2Q94A 4RZZA 4FLLA 4PNCA 1C27A 2Q95A
chains in the Genus database with same CATH topology
1YW9A 1BOAA 2GZ5A 4QR8A 1PV9A 3MR1A 2GGCA 1YVMA 2B3LA 5D6EA 4A6VA 1W7VA 2GG9A 1WBQA 3IU7A 4S2TP 1N51A 4B28A 1QXYA 2BWXA 4FLIA 2B3KA 1M35A 2NQ7A 3MATA 4FLKA 1QXWA 3CTZA 4KM3A 5E5BA 1YW8A 3FMQA 2GA2A 3Q6DA 1WL6A 2BWWA 3IU8A 3L7GA 2HOWA 3BIQA 3L24A 3PN9A 2ADUA 2Q93A 4A6WA 4U75A 2GU4A 1MATA 5CNXA 3PKBA 5CDLA 1YJ3A 2BWVA 4U73A 2Q8KA 4IKTA 1R5HA 1Y1NA 1W2MA 5FCHA 3I7MA 2NQ6A 1KQ0A 1A16A 4Z7MA 3OVKA 2BHCA 4IECA 4ZWOA 2MATA 5CE6A 4U6JA 2V3ZA 3CB5A 4RZYA 2EA4A 4IKRA 3PKEA 2BN7A 4FUKA 2P9AA 4U69A 5E2CA 3RVAA 3BITA 1B59A 5D6FA 1XGNA 3O5VA 4U6CA 1XGOA 2Q96A 4IU6A 4U6WA 3CB6A 2EA2A 2ZSGA 4RGZ1 2GU6A 2IW2A 1KQ9A 2V3XA 5JHUA 4JUQA 5JI6A 2GU5A 2V3YA 5CIKA 1O0XA 4OOKA 2G6PA 2GG2A 2OAZA 3TAVA 1WLRA 4IKUA 5FCFA 1C24A 1CHMA 3QOCA 4S2RP 4IPAA 1XGMA 5CLSA 2P99A 4IF7A 2GG0A 3IU9A 2P98A 4FO8A 1KP0A 2GTXA 1B6AA 1C21A 1WL9A 4EGEA 4U70A 4MATA 5JFRA 3OOOA 3BIPA 4ZWUA 3MX6A 2BWTA 2GG3A 2GG8A 4FKCA 4U1BA 4S01A 1R58A 4U71A 3D27A 3PEBA 4PV4A 1WN1A 4R60A 1QZYA 2GG5A 4FO7A 3RORA 4S00A 2EVOA 2BB7A 1C22A 2BHBA 2V6CA 4U6EA 1YW7A 2Q92A 1R5GA 1JAWA 2BHDA 1XNZA 2GGBA 4IKSA 3TB5A 3IL0A 4HXXA 3PKAA 2EVCA 3FMRA 4U76A 4U6ZA 1XGSA 2GG7A 2BH3A 1QXZA 3S6BA 5CDVA 4IDYA 3PKDA 4FLJA 3FM3A 2BWSA 1WKMA 2EVMA 2BWUA 1C23A 3PKCA 2BWYA 4ZNGA 1WY2A 2OKNA 2B3HA 4ZWPA 5CDEA 2DFIA 2BHAA 3IG4A 2GU7A 1BN5A 2Q94A 4RZZA 4FLLA 4PNCA 1C27A 2Q95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW9 A;  1BOA A;  2GZ5 A;  4QR8 A;  1PV9 A;  3MR1 A;  2GGC A;  1YVM A;  2B3L A;  5D6E A;  4A6V A;  1W7V A;  2GG9 A;  1WBQ A;  3IU7 A;  4S2T P;  1N51 A;  4B28 A;  1QXY A;  2BWX A;  4FLI A;  2B3K A;  1M35 A;  2NQ7 A;  3MAT A;  4FLK A;  1QXW A;  3CTZ A;  4KM3 A;  5E5B A;  1YW8 A;  3FMQ A;  2GA2 A;  3Q6D A;  1WL6 A;  2BWW A;  3IU8 A;  3L7G A;  2HOW A;  3BIQ A;  3L24 A;  3PN9 A;  2ADU A;  2Q93 A;  4A6W A;  4U75 A;  2GU4 A;  1MAT A;  5CNX A;  3PKB A;  5CDL A;  1YJ3 A;  2BWV A;  4U73 A;  2Q8K A;  4IKT A;  1R5H A;  1Y1N A;  1W2M A;  5FCH A;  3I7M A;  2NQ6 A;  1KQ0 A;  1A16 A;  4Z7M A;  3OVK A;  2BHC A;  4IEC A;  4ZWO A;  2MAT A;  5CE6 A;  4U6J A;  2V3Z A;  3CB5 A;  4RZY A;  2EA4 A;  4IKR A;  3PKE A;  2BN7 A;  4FUK A;  2P9A A;  4U69 A;  5E2C A;  3RVA A;  3BIT A;  1B59 A;  5D6F A;  1XGN A;  3O5V A;  4U6C A;  1XGO A;  2Q96 A;  4IU6 A;  4U6W A;  3CB6 A;  2EA2 A;  2ZSG A;  4RGZ 1;  2GU6 A;  2IW2 A;  1KQ9 A;  2V3X A;  5JHU A;  4JUQ A;  5JI6 A;  2GU5 A;  2V3Y A;  5CIK A;  1O0X A;  4OOK A;  2G6P A;  2GG2 A;  2OAZ A;  3TAV A;  1WLR A;  4IKU A;  5FCF A;  1C24 A;  1CHM A;  3QOC A;  4S2R P;  4IPA A;  1XGM A;  5CLS A;  2P99 A;  4IF7 A;  2GG0 A;  3IU9 A;  2P98 A;  4FO8 A;  1KP0 A;  2GTX A;  1B6A A;  1C21 A;  1WL9 A;  4EGE A;  4U70 A;  4MAT A;  5JFR A;  3OOO A;  3BIP A;  4ZWU A;  3MX6 A;  2BWT A;  2GG3 A;  2GG8 A;  4FKC A;  4U1B A;  4S01 A;  1R58 A;  4U71 A;  3D27 A;  3PEB A;  4PV4 A;  1WN1 A;  4R60 A;  1QZY A;  2GG5 A;  4FO7 A;  3ROR A;  4S00 A;  2EVO A;  2BB7 A;  1C22 A;  2BHB A;  2V6C A;  4U6E A;  1YW7 A;  2Q92 A;  1R5G A;  1JAW A;  2BHD A;  1XNZ A;  2GGB A;  4IKS A;  3TB5 A;  3IL0 A;  4HXX A;  3PKA A;  2EVC A;  3FMR A;  4U76 A;  4U6Z A;  1XGS A;  2GG7 A;  2BH3 A;  1QXZ A;  3S6B A;  5CDV A;  4IDY A;  3PKD A;  4FLJ A;  3FM3 A;  2BWS A;  1WKM A;  2EVM A;  2BWU A;  1C23 A;  3PKC A;  2BWY A;  4ZNG A;  1WY2 A;  2OKN A;  2B3H A;  4ZWP A;  5CDE A;  2DFI A;  2BHA A;  3IG4 A;  2GU7 A;  1BN5 A;  2Q94 A;  4RZZ A;  4FLL A;  4PNC A;  1C27 A;  2Q95 A; 
#chains in the Genus database with same CATH topology
 1YW9 A;  1BOA A;  2GZ5 A;  4QR8 A;  1PV9 A;  3MR1 A;  2GGC A;  1YVM A;  2B3L A;  5D6E A;  4A6V A;  1W7V A;  2GG9 A;  1WBQ A;  3IU7 A;  4S2T P;  1N51 A;  4B28 A;  1QXY A;  2BWX A;  4FLI A;  2B3K A;  1M35 A;  2NQ7 A;  3MAT A;  4FLK A;  1QXW A;  3CTZ A;  4KM3 A;  5E5B A;  1YW8 A;  3FMQ A;  2GA2 A;  3Q6D A;  1WL6 A;  2BWW A;  3IU8 A;  3L7G A;  2HOW A;  3BIQ A;  3L24 A;  3PN9 A;  2ADU A;  2Q93 A;  4A6W A;  4U75 A;  2GU4 A;  1MAT A;  5CNX A;  3PKB A;  5CDL A;  1YJ3 A;  2BWV A;  4U73 A;  2Q8K A;  4IKT A;  1R5H A;  1Y1N A;  1W2M A;  5FCH A;  3I7M A;  2NQ6 A;  1KQ0 A;  1A16 A;  4Z7M A;  3OVK A;  2BHC A;  4IEC A;  4ZWO A;  2MAT A;  5CE6 A;  4U6J A;  2V3Z A;  3CB5 A;  4RZY A;  2EA4 A;  4IKR A;  3PKE A;  2BN7 A;  4FUK A;  2P9A A;  4U69 A;  5E2C A;  3RVA A;  3BIT A;  1B59 A;  5D6F A;  1XGN A;  3O5V A;  4U6C A;  1XGO A;  2Q96 A;  4IU6 A;  4U6W A;  3CB6 A;  2EA2 A;  2ZSG A;  4RGZ 1;  2GU6 A;  2IW2 A;  1KQ9 A;  2V3X A;  5JHU A;  4JUQ A;  5JI6 A;  2GU5 A;  2V3Y A;  5CIK A;  1O0X A;  4OOK A;  2G6P A;  2GG2 A;  2OAZ A;  3TAV A;  1WLR A;  4IKU A;  5FCF A;  1C24 A;  1CHM A;  3QOC A;  4S2R P;  4IPA A;  1XGM A;  5CLS A;  2P99 A;  4IF7 A;  2GG0 A;  3IU9 A;  2P98 A;  4FO8 A;  1KP0 A;  2GTX A;  1B6A A;  1C21 A;  1WL9 A;  4EGE A;  4U70 A;  4MAT A;  5JFR A;  3OOO A;  3BIP A;  4ZWU A;  3MX6 A;  2BWT A;  2GG3 A;  2GG8 A;  4FKC A;  4U1B A;  4S01 A;  1R58 A;  4U71 A;  3D27 A;  3PEB A;  4PV4 A;  1WN1 A;  4R60 A;  1QZY A;  2GG5 A;  4FO7 A;  3ROR A;  4S00 A;  2EVO A;  2BB7 A;  1C22 A;  2BHB A;  2V6C A;  4U6E A;  1YW7 A;  2Q92 A;  1R5G A;  1JAW A;  2BHD A;  1XNZ A;  2GGB A;  4IKS A;  3TB5 A;  3IL0 A;  4HXX A;  3PKA A;  2EVC A;  3FMR A;  4U76 A;  4U6Z A;  1XGS A;  2GG7 A;  2BH3 A;  1QXZ A;  3S6B A;  5CDV A;  4IDY A;  3PKD A;  4FLJ A;  3FM3 A;  2BWS A;  1WKM A;  2EVM A;  2BWU A;  1C23 A;  3PKC A;  2BWY A;  4ZNG A;  1WY2 A;  2OKN A;  2B3H A;  4ZWP A;  5CDE A;  2DFI A;  2BHA A;  3IG4 A;  2GU7 A;  1BN5 A;  2Q94 A;  4RZZ A;  4FLL A;  4PNC A;  1C27 A;  2Q95 A; 
#chains in the Genus database with same CATH homology
 1YW9 A;  1BOA A;  2GZ5 A;  4QR8 A;  1PV9 A;  3MR1 A;  2GGC A;  1YVM A;  2B3L A;  5D6E A;  4A6V A;  1W7V A;  2GG9 A;  1WBQ A;  3IU7 A;  4S2T P;  1N51 A;  4B28 A;  1QXY A;  2BWX A;  4FLI A;  2B3K A;  1M35 A;  2NQ7 A;  3MAT A;  4FLK A;  1QXW A;  3CTZ A;  4KM3 A;  5E5B A;  1YW8 A;  3FMQ A;  2GA2 A;  3Q6D A;  1WL6 A;  2BWW A;  3IU8 A;  3L7G A;  2HOW A;  3BIQ A;  3L24 A;  3PN9 A;  2ADU A;  2Q93 A;  4A6W A;  4U75 A;  2GU4 A;  1MAT A;  5CNX A;  3PKB A;  5CDL A;  1YJ3 A;  2BWV A;  4U73 A;  2Q8K A;  4IKT A;  1R5H A;  1Y1N A;  1W2M A;  5FCH A;  3I7M A;  2NQ6 A;  1KQ0 A;  1A16 A;  4Z7M A;  3OVK A;  2BHC A;  4IEC A;  4ZWO A;  2MAT A;  5CE6 A;  4U6J A;  2V3Z A;  3CB5 A;  4RZY A;  2EA4 A;  4IKR A;  3PKE A;  2BN7 A;  4FUK A;  2P9A A;  4U69 A;  5E2C A;  3RVA A;  3BIT A;  1B59 A;  5D6F A;  1XGN A;  3O5V A;  4U6C A;  1XGO A;  2Q96 A;  4IU6 A;  4U6W A;  3CB6 A;  2EA2 A;  2ZSG A;  4RGZ 1;  2GU6 A;  2IW2 A;  1KQ9 A;  2V3X A;  5JHU A;  4JUQ A;  5JI6 A;  2GU5 A;  2V3Y A;  5CIK A;  1O0X A;  4OOK A;  2G6P A;  2GG2 A;  2OAZ A;  3TAV A;  1WLR A;  4IKU A;  5FCF A;  1C24 A;  1CHM A;  3QOC A;  4S2R P;  4IPA A;  1XGM A;  5CLS A;  2P99 A;  4IF7 A;  2GG0 A;  3IU9 A;  2P98 A;  4FO8 A;  1KP0 A;  2GTX A;  1B6A A;  1C21 A;  1WL9 A;  4EGE A;  4U70 A;  4MAT A;  5JFR A;  3OOO A;  3BIP A;  4ZWU A;  3MX6 A;  2BWT A;  2GG3 A;  2GG8 A;  4FKC A;  4U1B A;  4S01 A;  1R58 A;  4U71 A;  3D27 A;  3PEB A;  4PV4 A;  1WN1 A;  4R60 A;  1QZY A;  2GG5 A;  4FO7 A;  3ROR A;  4S00 A;  2EVO A;  2BB7 A;  1C22 A;  2BHB A;  2V6C A;  4U6E A;  1YW7 A;  2Q92 A;  1R5G A;  1JAW A;  2BHD A;  1XNZ A;  2GGB A;  4IKS A;  3TB5 A;  3IL0 A;  4HXX A;  3PKA A;  2EVC A;  3FMR A;  4U76 A;  4U6Z A;  1XGS A;  2GG7 A;  2BH3 A;  1QXZ A;  3S6B A;  5CDV A;  4IDY A;  3PKD A;  4FLJ A;  3FM3 A;  2BWS A;  1WKM A;  2EVM A;  2BWU A;  1C23 A;  3PKC A;  2BWY A;  4ZNG A;  1WY2 A;  2OKN A;  2B3H A;  4ZWP A;  5CDE A;  2DFI A;  2BHA A;  3IG4 A;  2GU7 A;  1BN5 A;  2Q94 A;  4RZZ A;  4FLL A;  4PNC A;  1C27 A;  2Q95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...