2BHCA

Na substituted e. coli aminopeptidase p
Total Genus 159
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
159
sequence length
440
structure length
440
Chain Sequence
SEISRQEFQRRRQALVEQMQPGSAALIFAAPEVTRSADSEYPYRQNSDFWYFTGFNEPEAVLVLIKSDDTHNHSVLFNRVRDLTAEIWFGRRLGQDAAPEKLGVDRALAFSEINQQLYQLLNGLDVVYHAQGEYAYADVIVNSALEKLRKGSRQNLTAPATMIDWRPVVHEMRLFKSPEEIAVLRRAGEITAMAHTRAMEKCRPGMFEYHLEGEIHHEFNRHGARYPSYNTIVGSGENGCILHYTENECEMRDGDLVLIDAGCEYKGYAGDITRTFPVNGKFTQAQREIYDIVLESLETSLRLYRPGTSILEVTGEVVRIMVSGLVKLGILKGDVDELIAQNAHRPFFMHGLSHWLGLDVHDVGVYGQDRSRILEPGMVLTVEPGLYIAPDAEVPEQYRGIGIRIEDDIVITETGNENLTASVVKKPEEIEALMVAARKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XAA-PRO AMINOPEPTIDASE
publication title Structural and Functional Implications of Metal Ion Selection in Aminopeptidase P, a Metalloprotease with a Dinuclear Metal Center.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 159
structure length 440
sequence length 440
ec nomenclature ec 3.4.11.9: Xaa-Pro aminopeptidase.
pdb deposition date 2005-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00557 Peptidase_M24 Metallopeptidase family M24
A PF05195 AMP_N Aminopeptidase P, N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 2bhcA01
3.90.230.10 Alpha Beta Alpha-Beta Complex Creatine Amidinohydrolase Creatinase/methionine aminopeptidase superfamily 2bhcA02
2GG3A 2GZ5A 4U6WA 3CB5A 1KQ9A 1QZYA 2EVMA 2GG5A 2V3YA 4IKUA 1O0XA 1R58A 1QXYA 2P98A 4MATA 2BH3A 5CDVA 1XGOA 4B28A 1C22A 3PKCA 2EA4A 2G6PA 1Y1NA 2GU5A 2P99A 3PKEA 2GG8A 2Q93A 1C21A 3IG4A 1WN1A 3D27A 4JUQA 2GU4A 5JHUA 4FKCA 4IECA 1M35A 1R5HA 1KQ0A 1W7VA 3CTZA 1XGSA 2DFIA 3PEBA 3FM3A 2BHCA 1A16A 4QR8A 1QXWA 4RZYA 2GU6A 1YJ3A 2EA2A 4KM3A 4U6JA 1C23A 1JAWA 3I7MA 1QXZA 5CIKA 1WY2A 1YW7A 1B6AA 2GU7A 4RZZA 3TAVA 2HOWA 1WL9A 2IW2A 1WLRA 2B3HA 1YVMA 4OOKA 2MATA 1WBQA 2BWSA 4U70A 4RGZ1 4U69A 2V3ZA 1PV9A 1MATA 2NQ7A 2GG2A 2BB7A 1W2MA 3QOCA 4IDYA 3IU8A 3S6BA 4PNCA 3TB5A 3OVKA 1XGNA 3L7GA 1YW8A 3MR1A 4IU6A 2BWYA 4U6ZA 2BWVA 2GA2A 2BWXA 4FO8A 1WL6A 3IL0A 1KP0A 4IPAA 4FUKA 4EGEA 1C24A 5E5BA 5CNXA 5CLSA 5FCHA 2Q94A 2Q8KA 3BITA 3PN9A 4S00A 4U6CA 3MATA 5FCFA 1WKMA 4IKSA 4FO7A 2GGCA 4IKRA 2GG9A 5D6EA 2OAZA 4FLJA 4HXXA 3OOOA 1XNZA 4A6VA 3IU7A 2OKNA 2Q92A 4ZWPA 1BOAA 3MX6A 2B3LA 2GG7A 2V6CA 4IF7A 5JFRA 4ZNGA 5CE6A 3PKDA 2EVOA 3PKAA 5D6FA 2ZSGA 2NQ6A 3BIPA 5E2CA 2ADUA 2Q95A 1R5GA 1YW9A 1XGMA 1CHMA 4U71A 3IU9A 3FMQA 2BHAA 4U6EA 3L24A 3FMRA 4ZWUA 4ZWOA 3CB6A 2BHDA 4Z7MA 4U75A 4S01A 1C27A 4IKTA 5JI6A 2Q96A 4FLIA 2V3XA 4U73A 4S2RP 4FLLA 4FLKA 3RORA 3O5VA 3BIQA 1BN5A 3Q6DA 3RVAA 2BWWA 4A6WA 2GG0A 1N51A 4U76A 2P9AA 2BHBA 5CDEA 2BWTA 2BN7A 2GTXA 3PKBA 5CDLA 1B59A 2EVCA 4S2TP 4R60A 2B3KA 2GGBA 4U1BA 2BWUA 4PV4A
chains in the Genus database with same CATH superfamily
2GG3A 2GZ5A 4U6WA 3CB5A 1KQ9A 1QZYA 2EVMA 2GG5A 2V3YA 4IKUA 1O0XA 1R58A 1QXYA 2P98A 4MATA 2BH3A 5CDVA 1XGOA 4B28A 1C22A 3PKCA 2EA4A 2G6PA 1Y1NA 2GU5A 2P99A 3PKEA 2GG8A 2Q93A 1C21A 3IG4A 1WN1A 3D27A 4JUQA 2GU4A 5JHUA 4FKCA 4IECA 1M35A 1R5HA 1KQ0A 1W7VA 3CTZA 1XGSA 2DFIA 3PEBA 3FM3A 2BHCA 1A16A 4QR8A 1QXWA 4RZYA 2GU6A 1YJ3A 2EA2A 4KM3A 4U6JA 1C23A 1JAWA 3I7MA 1QXZA 5CIKA 1WY2A 1YW7A 1B6AA 2GU7A 4RZZA 3TAVA 2HOWA 1WL9A 2IW2A 1WLRA 2B3HA 1YVMA 4OOKA 2MATA 1WBQA 2BWSA 4U70A 4RGZ1 4U69A 2V3ZA 1PV9A 1MATA 2NQ7A 2GG2A 2BB7A 1W2MA 3QOCA 4IDYA 3IU8A 3S6BA 4PNCA 3TB5A 3OVKA 1XGNA 3L7GA 1YW8A 3MR1A 4IU6A 2BWYA 4U6ZA 2BWVA 2GA2A 2BWXA 4FO8A 1WL6A 3IL0A 1KP0A 4IPAA 4FUKA 4EGEA 1C24A 5E5BA 5CNXA 5CLSA 5FCHA 2Q94A 2Q8KA 3BITA 3PN9A 4S00A 4U6CA 3MATA 5FCFA 1WKMA 4IKSA 4FO7A 2GGCA 4IKRA 2GG9A 5D6EA 2OAZA 4FLJA 4HXXA 3OOOA 1XNZA 4A6VA 3IU7A 2OKNA 2Q92A 4ZWPA 1BOAA 3MX6A 2B3LA 2GG7A 2V6CA 4IF7A 5JFRA 4ZNGA 5CE6A 3PKDA 2EVOA 3PKAA 5D6FA 2ZSGA 2NQ6A 3BIPA 5E2CA 2ADUA 2Q95A 1R5GA 1YW9A 1XGMA 1CHMA 4U71A 3IU9A 3FMQA 2BHAA 4U6EA 3L24A 3FMRA 4ZWUA 4ZWOA 3CB6A 2BHDA 4Z7MA 4U75A 4S01A 1C27A 4IKTA 5JI6A 2Q96A 4FLIA 2V3XA 4U73A 4S2RP 4FLLA 4FLKA 3RORA 3O5VA 3BIQA 1BN5A 3Q6DA 3RVAA 2BWWA 4A6WA 2GG0A 1N51A 4U76A 2P9AA 2BHBA 5CDEA 2BWTA 2BN7A 2GTXA 3PKBA 5CDLA 1B59A 2EVCA 4S2TP 4R60A 2B3KA 2GGBA 4U1BA 2BWUA 4PV4A
chains in the Genus database with same CATH topology
2GG3A 2GZ5A 4U6WA 3CB5A 1KQ9A 1QZYA 2EVMA 2GG5A 2V3YA 4IKUA 1O0XA 1R58A 1QXYA 2P98A 4MATA 2BH3A 5CDVA 1XGOA 4B28A 1C22A 3PKCA 2EA4A 2G6PA 1Y1NA 2GU5A 2P99A 3PKEA 2GG8A 2Q93A 1C21A 3IG4A 1WN1A 3D27A 4JUQA 2GU4A 5JHUA 4FKCA 4IECA 1M35A 1R5HA 1KQ0A 1W7VA 3CTZA 1XGSA 2DFIA 3PEBA 3FM3A 2BHCA 1A16A 4QR8A 1QXWA 4RZYA 2GU6A 1YJ3A 2EA2A 4KM3A 4U6JA 1C23A 1JAWA 3I7MA 1QXZA 5CIKA 1WY2A 1YW7A 1B6AA 2GU7A 4RZZA 3TAVA 2HOWA 1WL9A 2IW2A 1WLRA 2B3HA 1YVMA 4OOKA 2MATA 1WBQA 2BWSA 4U70A 4RGZ1 4U69A 2V3ZA 1PV9A 1MATA 2NQ7A 2GG2A 2BB7A 1W2MA 3QOCA 4IDYA 3IU8A 3S6BA 4PNCA 3TB5A 3OVKA 1XGNA 3L7GA 1YW8A 3MR1A 4IU6A 2BWYA 4U6ZA 2BWVA 2GA2A 2BWXA 4FO8A 1WL6A 3IL0A 1KP0A 4IPAA 4FUKA 4EGEA 1C24A 5E5BA 5CNXA 5CLSA 5FCHA 2Q94A 2Q8KA 3BITA 3PN9A 4S00A 4U6CA 3MATA 5FCFA 1WKMA 4IKSA 4FO7A 2GGCA 4IKRA 2GG9A 5D6EA 2OAZA 4FLJA 4HXXA 3OOOA 1XNZA 4A6VA 3IU7A 2OKNA 2Q92A 4ZWPA 1BOAA 3MX6A 2B3LA 2GG7A 2V6CA 4IF7A 5JFRA 4ZNGA 5CE6A 3PKDA 2EVOA 3PKAA 5D6FA 2ZSGA 2NQ6A 3BIPA 5E2CA 2ADUA 2Q95A 1R5GA 1YW9A 1XGMA 1CHMA 4U71A 3IU9A 3FMQA 2BHAA 4U6EA 3L24A 3FMRA 4ZWUA 4ZWOA 3CB6A 2BHDA 4Z7MA 4U75A 4S01A 1C27A 4IKTA 5JI6A 2Q96A 4FLIA 2V3XA 4U73A 4S2RP 4FLLA 4FLKA 3RORA 3O5VA 3BIQA 1BN5A 3Q6DA 3RVAA 2BWWA 4A6WA 2GG0A 1N51A 4U76A 2P9AA 2BHBA 5CDEA 2BWTA 2BN7A 2GTXA 3PKBA 5CDLA 1B59A 2EVCA 4S2TP 4R60A 2B3KA 2GGBA 4U1BA 2BWUA 4PV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GG3 A;  2GZ5 A;  4U6W A;  3CB5 A;  1KQ9 A;  1QZY A;  2EVM A;  2GG5 A;  2V3Y A;  4IKU A;  1O0X A;  1R58 A;  1QXY A;  2P98 A;  4MAT A;  2BH3 A;  5CDV A;  1XGO A;  4B28 A;  1C22 A;  3PKC A;  2EA4 A;  2G6P A;  1Y1N A;  2GU5 A;  2P99 A;  3PKE A;  2GG8 A;  2Q93 A;  1C21 A;  3IG4 A;  1WN1 A;  3D27 A;  4JUQ A;  2GU4 A;  5JHU A;  4FKC A;  4IEC A;  1M35 A;  1R5H A;  1KQ0 A;  1W7V A;  3CTZ A;  1XGS A;  2DFI A;  3PEB A;  3FM3 A;  2BHC A;  1A16 A;  4QR8 A;  1QXW A;  4RZY A;  2GU6 A;  1YJ3 A;  2EA2 A;  4KM3 A;  4U6J A;  1C23 A;  1JAW A;  3I7M A;  1QXZ A;  5CIK A;  1WY2 A;  1YW7 A;  1B6A A;  2GU7 A;  4RZZ A;  3TAV A;  2HOW A;  1WL9 A;  2IW2 A;  1WLR A;  2B3H A;  1YVM A;  4OOK A;  2MAT A;  1WBQ A;  2BWS A;  4U70 A;  4RGZ 1;  4U69 A;  2V3Z A;  1PV9 A;  1MAT A;  2NQ7 A;  2GG2 A;  2BB7 A;  1W2M A;  3QOC A;  4IDY A;  3IU8 A;  3S6B A;  4PNC A;  3TB5 A;  3OVK A;  1XGN A;  3L7G A;  1YW8 A;  3MR1 A;  4IU6 A;  2BWY A;  4U6Z A;  2BWV A;  2GA2 A;  2BWX A;  4FO8 A;  1WL6 A;  3IL0 A;  1KP0 A;  4IPA A;  4FUK A;  4EGE A;  1C24 A;  5E5B A;  5CNX A;  5CLS A;  5FCH A;  2Q94 A;  2Q8K A;  3BIT A;  3PN9 A;  4S00 A;  4U6C A;  3MAT A;  5FCF A;  1WKM A;  4IKS A;  4FO7 A;  2GGC A;  4IKR A;  2GG9 A;  5D6E A;  2OAZ A;  4FLJ A;  4HXX A;  3OOO A;  1XNZ A;  4A6V A;  3IU7 A;  2OKN A;  2Q92 A;  4ZWP A;  1BOA A;  3MX6 A;  2B3L A;  2GG7 A;  2V6C A;  4IF7 A;  5JFR A;  4ZNG A;  5CE6 A;  3PKD A;  2EVO A;  3PKA A;  5D6F A;  2ZSG A;  2NQ6 A;  3BIP A;  5E2C A;  2ADU A;  2Q95 A;  1R5G A;  1YW9 A;  1XGM A;  1CHM A;  4U71 A;  3IU9 A;  3FMQ A;  2BHA A;  4U6E A;  3L24 A;  3FMR A;  4ZWU A;  4ZWO A;  3CB6 A;  2BHD A;  4Z7M A;  4U75 A;  4S01 A;  1C27 A;  4IKT A;  5JI6 A;  2Q96 A;  4FLI A;  2V3X A;  4U73 A;  4S2R P;  4FLL A;  4FLK A;  3ROR A;  3O5V A;  3BIQ A;  1BN5 A;  3Q6D A;  3RVA A;  2BWW A;  4A6W A;  2GG0 A;  1N51 A;  4U76 A;  2P9A A;  2BHB A;  5CDE A;  2BWT A;  2BN7 A;  2GTX A;  3PKB A;  5CDL A;  1B59 A;  2EVC A;  4S2T P;  4R60 A;  2B3K A;  2GGB A;  4U1B A;  2BWU A;  4PV4 A; 
#chains in the Genus database with same CATH topology
 2GG3 A;  2GZ5 A;  4U6W A;  3CB5 A;  1KQ9 A;  1QZY A;  2EVM A;  2GG5 A;  2V3Y A;  4IKU A;  1O0X A;  1R58 A;  1QXY A;  2P98 A;  4MAT A;  2BH3 A;  5CDV A;  1XGO A;  4B28 A;  1C22 A;  3PKC A;  2EA4 A;  2G6P A;  1Y1N A;  2GU5 A;  2P99 A;  3PKE A;  2GG8 A;  2Q93 A;  1C21 A;  3IG4 A;  1WN1 A;  3D27 A;  4JUQ A;  2GU4 A;  5JHU A;  4FKC A;  4IEC A;  1M35 A;  1R5H A;  1KQ0 A;  1W7V A;  3CTZ A;  1XGS A;  2DFI A;  3PEB A;  3FM3 A;  2BHC A;  1A16 A;  4QR8 A;  1QXW A;  4RZY A;  2GU6 A;  1YJ3 A;  2EA2 A;  4KM3 A;  4U6J A;  1C23 A;  1JAW A;  3I7M A;  1QXZ A;  5CIK A;  1WY2 A;  1YW7 A;  1B6A A;  2GU7 A;  4RZZ A;  3TAV A;  2HOW A;  1WL9 A;  2IW2 A;  1WLR A;  2B3H A;  1YVM A;  4OOK A;  2MAT A;  1WBQ A;  2BWS A;  4U70 A;  4RGZ 1;  4U69 A;  2V3Z A;  1PV9 A;  1MAT A;  2NQ7 A;  2GG2 A;  2BB7 A;  1W2M A;  3QOC A;  4IDY A;  3IU8 A;  3S6B A;  4PNC A;  3TB5 A;  3OVK A;  1XGN A;  3L7G A;  1YW8 A;  3MR1 A;  4IU6 A;  2BWY A;  4U6Z A;  2BWV A;  2GA2 A;  2BWX A;  4FO8 A;  1WL6 A;  3IL0 A;  1KP0 A;  4IPA A;  4FUK A;  4EGE A;  1C24 A;  5E5B A;  5CNX A;  5CLS A;  5FCH A;  2Q94 A;  2Q8K A;  3BIT A;  3PN9 A;  4S00 A;  4U6C A;  3MAT A;  5FCF A;  1WKM A;  4IKS A;  4FO7 A;  2GGC A;  4IKR A;  2GG9 A;  5D6E A;  2OAZ A;  4FLJ A;  4HXX A;  3OOO A;  1XNZ A;  4A6V A;  3IU7 A;  2OKN A;  2Q92 A;  4ZWP A;  1BOA A;  3MX6 A;  2B3L A;  2GG7 A;  2V6C A;  4IF7 A;  5JFR A;  4ZNG A;  5CE6 A;  3PKD A;  2EVO A;  3PKA A;  5D6F A;  2ZSG A;  2NQ6 A;  3BIP A;  5E2C A;  2ADU A;  2Q95 A;  1R5G A;  1YW9 A;  1XGM A;  1CHM A;  4U71 A;  3IU9 A;  3FMQ A;  2BHA A;  4U6E A;  3L24 A;  3FMR A;  4ZWU A;  4ZWO A;  3CB6 A;  2BHD A;  4Z7M A;  4U75 A;  4S01 A;  1C27 A;  4IKT A;  5JI6 A;  2Q96 A;  4FLI A;  2V3X A;  4U73 A;  4S2R P;  4FLL A;  4FLK A;  3ROR A;  3O5V A;  3BIQ A;  1BN5 A;  3Q6D A;  3RVA A;  2BWW A;  4A6W A;  2GG0 A;  1N51 A;  4U76 A;  2P9A A;  2BHB A;  5CDE A;  2BWT A;  2BN7 A;  2GTX A;  3PKB A;  5CDL A;  1B59 A;  2EVC A;  4S2T P;  4R60 A;  2B3K A;  2GGB A;  4U1B A;  2BWU A;  4PV4 A; 
#chains in the Genus database with same CATH homology
 2GG3 A;  2GZ5 A;  4U6W A;  3CB5 A;  1KQ9 A;  1QZY A;  2EVM A;  2GG5 A;  2V3Y A;  4IKU A;  1O0X A;  1R58 A;  1QXY A;  2P98 A;  4MAT A;  2BH3 A;  5CDV A;  1XGO A;  4B28 A;  1C22 A;  3PKC A;  2EA4 A;  2G6P A;  1Y1N A;  2GU5 A;  2P99 A;  3PKE A;  2GG8 A;  2Q93 A;  1C21 A;  3IG4 A;  1WN1 A;  3D27 A;  4JUQ A;  2GU4 A;  5JHU A;  4FKC A;  4IEC A;  1M35 A;  1R5H A;  1KQ0 A;  1W7V A;  3CTZ A;  1XGS A;  2DFI A;  3PEB A;  3FM3 A;  2BHC A;  1A16 A;  4QR8 A;  1QXW A;  4RZY A;  2GU6 A;  1YJ3 A;  2EA2 A;  4KM3 A;  4U6J A;  1C23 A;  1JAW A;  3I7M A;  1QXZ A;  5CIK A;  1WY2 A;  1YW7 A;  1B6A A;  2GU7 A;  4RZZ A;  3TAV A;  2HOW A;  1WL9 A;  2IW2 A;  1WLR A;  2B3H A;  1YVM A;  4OOK A;  2MAT A;  1WBQ A;  2BWS A;  4U70 A;  4RGZ 1;  4U69 A;  2V3Z A;  1PV9 A;  1MAT A;  2NQ7 A;  2GG2 A;  2BB7 A;  1W2M A;  3QOC A;  4IDY A;  3IU8 A;  3S6B A;  4PNC A;  3TB5 A;  3OVK A;  1XGN A;  3L7G A;  1YW8 A;  3MR1 A;  4IU6 A;  2BWY A;  4U6Z A;  2BWV A;  2GA2 A;  2BWX A;  4FO8 A;  1WL6 A;  3IL0 A;  1KP0 A;  4IPA A;  4FUK A;  4EGE A;  1C24 A;  5E5B A;  5CNX A;  5CLS A;  5FCH A;  2Q94 A;  2Q8K A;  3BIT A;  3PN9 A;  4S00 A;  4U6C A;  3MAT A;  5FCF A;  1WKM A;  4IKS A;  4FO7 A;  2GGC A;  4IKR A;  2GG9 A;  5D6E A;  2OAZ A;  4FLJ A;  4HXX A;  3OOO A;  1XNZ A;  4A6V A;  3IU7 A;  2OKN A;  2Q92 A;  4ZWP A;  1BOA A;  3MX6 A;  2B3L A;  2GG7 A;  2V6C A;  4IF7 A;  5JFR A;  4ZNG A;  5CE6 A;  3PKD A;  2EVO A;  3PKA A;  5D6F A;  2ZSG A;  2NQ6 A;  3BIP A;  5E2C A;  2ADU A;  2Q95 A;  1R5G A;  1YW9 A;  1XGM A;  1CHM A;  4U71 A;  3IU9 A;  3FMQ A;  2BHA A;  4U6E A;  3L24 A;  3FMR A;  4ZWU A;  4ZWO A;  3CB6 A;  2BHD A;  4Z7M A;  4U75 A;  4S01 A;  1C27 A;  4IKT A;  5JI6 A;  2Q96 A;  4FLI A;  2V3X A;  4U73 A;  4S2R P;  4FLL A;  4FLK A;  3ROR A;  3O5V A;  3BIQ A;  1BN5 A;  3Q6D A;  3RVA A;  2BWW A;  4A6W A;  2GG0 A;  1N51 A;  4U76 A;  2P9A A;  2BHB A;  5CDE A;  2BWT A;  2BN7 A;  2GTX A;  3PKB A;  5CDL A;  1B59 A;  2EVC A;  4S2T P;  4R60 A;  2B3K A;  2GGB A;  4U1B A;  2BWU A;  4PV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...