The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
131
|
structure length |
131
|
Chain Sequence |
SNAKLDQIRLYLDQKGAELAIFSDPVTINYLTGFFCDPHERQLFLFVYHDLAPVLFVPALEVARASQAISFPVFGYVDSENPWEKIKAVLPNTAAKTIYAEFDHLNVNKFHGLQTIFSGQFNNLTPYVQGM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The Crystal Structure of the Creatinase/Prolidase N-terminal domain of an X-PRO dipeptidase from Streptococcus pyogenes to 1.85A
rcsb |
| molecule keywords |
X-PRO dipeptidase
|
| molecule tags |
Hydrolase
|
| source organism |
Streptococcus pyogenes m1 gas
|
| total genus |
35
|
| structure length |
131
|
| sequence length |
131
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.4.13.9: Xaa-Pro dipeptidase. |
| pdb deposition date | 2010-07-28 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 3-Layer(aba) Sandwich | Creatine Amidinohydrolase; Chain A, domain 1 | Creatinase/prolidase N-terminal domain |
#chains in the Genus database with same CATH superfamily 5CDL A; 2BWY A; 3PEB A; 5CE6 A; 2BHC A; 4RZZ A; 3L7G A; 1W2M A; 4S01 A; 1WN1 A; 5FCF A; 2BWV A; 3CB5 A; 5E2C A; 3OOO A; 4PV4 A; 2BH3 A; 1W7V A; 1WL6 A; 4ZNG A; 1JAW A; 1N51 A; 4FKC A; 3OVK A; 2BHB A; 4RZY A; 2BWU A; 1WL9 A; 5FCH A; 3IL0 A; 4QR8 A; 4ZWU A; 2BWT A; 2ZSG A; 4B28 A; 3I7M A; 4EGE A; 2V3Y A; 1WLR A; 3BIT A; 3PN9 A; 4ZWP A; 1WBQ A; 1M35 A; 5CNX A; 4S00 A; 2BWS A; 2OKN A; 2BN7 A; 3Q6D A; 3CTZ A; 1A16 A; 5E5B A; 4RGZ 1; 2BHA A; 1CHM A; 5CDE A; 3QOC A; 2V3X A; 3BIQ A; 1PV9 A; 2IW2 A; 2BWW A; 3BIP A; 4S2T P; 2BHD A; 3CB6 A; 5CDV A; 3L24 A; 1WY2 A; 3O5V A; 3IG4 A; 5CIK A; 2V3Z A; 3RVA A; 1KP0 A; 4R60 A; 4S2R P; 2BWX A; 2HOW A; 4ZWO A; #chains in the Genus database with same CATH topology 5CDL A; 2BWY A; 3PEB A; 5CE6 A; 2BHC A; 4RZZ A; 3L7G A; 1W2M A; 4S01 A; 1WN1 A; 5FCF A; 2BWV A; 3CB5 A; 5E2C A; 3OOO A; 4PV4 A; 2BH3 A; 1W7V A; 1WL6 A; 4ZNG A; 1JAW A; 1N51 A; 4FKC A; 3OVK A; 2BHB A; 4RZY A; 2BWU A; 1WL9 A; 5FCH A; 3IL0 A; 4QR8 A; 4ZWU A; 2BWT A; 2ZSG A; 4B28 A; 3I7M A; 4EGE A; 2V3Y A; 1WLR A; 3BIT A; 3PN9 A; 4ZWP A; 1WBQ A; 1M35 A; 5CNX A; 4S00 A; 2BWS A; 2OKN A; 2BN7 A; 3Q6D A; 3CTZ A; 1A16 A; 5E5B A; 4RGZ 1; 2BHA A; 1CHM A; 5CDE A; 3QOC A; 2V3X A; 3BIQ A; 1PV9 A; 2IW2 A; 2BWW A; 3BIP A; 4S2T P; 2BHD A; 3CB6 A; 5CDV A; 3L24 A; 1WY2 A; 3O5V A; 3IG4 A; 5CIK A; 2V3Z A; 3RVA A; 1KP0 A; 4R60 A; 4S2R P; 2BWX A; 2HOW A; 4ZWO A; #chains in the Genus database with same CATH homology 5CDL A; 2BWY A; 3PEB A; 5CE6 A; 2BHC A; 4RZZ A; 3L7G A; 1W2M A; 4S01 A; 1WN1 A; 5FCF A; 2BWV A; 3CB5 A; 5E2C A; 3OOO A; 4PV4 A; 2BH3 A; 1W7V A; 1WL6 A; 4ZNG A; 1JAW A; 1N51 A; 4FKC A; 3OVK A; 2BHB A; 4RZY A; 2BWU A; 1WL9 A; 5FCH A; 3IL0 A; 4QR8 A; 4ZWU A; 2BWT A; 2ZSG A; 4B28 A; 3I7M A; 4EGE A; 2V3Y A; 1WLR A; 3BIT A; 3PN9 A; 4ZWP A; 1WBQ A; 1M35 A; 5CNX A; 4S00 A; 2BWS A; 2OKN A; 2BN7 A; 3Q6D A; 3CTZ A; 1A16 A; 5E5B A; 4RGZ 1; 2BHA A; 1CHM A; 5CDE A; 3QOC A; 2V3X A; 3BIQ A; 1PV9 A; 2IW2 A; 2BWW A; 3BIP A; 4S2T P; 2BHD A; 3CB6 A; 5CDV A; 3L24 A; 1WY2 A; 3O5V A; 3IG4 A; 5CIK A; 2V3Z A; 3RVA A; 1KP0 A; 4R60 A; 4S2R P; 2BWX A; 2HOW A; 4ZWO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
