1AFVA

Hiv-1 capsid protein (p24) complex with fab25.3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of dimeric HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 CAPSID PROTEIN
total genus 44
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1afvA00
1GWPA 1EM9A 2X83A 4HTWA 2Y4ZA 5JPAA 2LF4A 1AK4C 2XGUA 2M8NA 1P7NA 1EIAA 5HGNA 4QNBA 2JPRA 4U0BA 4U0CA 2M8PA 4XFYA 4DGEC 1L6NA 2EIAA 1M9DC 2PXRC 1QRJA 4PH2A 4PH0A 5HGOA 4E91A 1U7KA 4U0EA 4XROA 4XFZA 1D1DA 1AFVA 1M9YC 4U0AA 5HGKA 3BP9A 4E92A 2X2DD 4J93A 2X82A 2GONA 3H4EA 1M9FC 2PWOA 2V4XA 2WLVA 3NTEA 4XFXA 2XDEA 1M9XC 3P05A 1M9CC 4LQWC 4U0DA 4PH3A 5HGLA 5HGMA 4XRQA 2M8LA 1G03A 3MGEA 2XGVA 4INBA 4B4NA 4DGAC 2KGFA 2XGYA 2PWMA 1E6JP 1M9EC 2WLVB 4NX4C 3H47A 4U0FA 2GOLB 4WYMA
chains in the Genus database with same CATH superfamily
1GWPA 1EM9A 2X83A 4HTWA 2Y4ZA 5JPAA 2LF4A 1AK4C 2XGUA 2M8NA 1P7NA 1EIAA 5HGNA 4QNBA 2JPRA 4U0BA 4U0CA 2M8PA 4XFYA 4DGEC 1L6NA 2EIAA 1M9DC 2PXRC 1QRJA 4PH2A 4PH0A 5HGOA 4E91A 1U7KA 4U0EA 4XROA 4XFZA 1D1DA 1AFVA 1M9YC 4U0AA 5HGKA 3BP9A 4E92A 2X2DD 4J93A 2X82A 2GONA 3H4EA 1M9FC 2PWOA 2V4XA 2WLVA 3NTEA 4XFXA 2XDEA 1M9XC 3P05A 1M9CC 4LQWC 4U0DA 4PH3A 5HGLA 5HGMA 4XRQA 2M8LA 1G03A 3MGEA 2XGVA 4INBA 4B4NA 4DGAC 2KGFA 2XGYA 2PWMA 1E6JP 1M9EC 2WLVB 4NX4C 3H47A 4U0FA 2GOLB 4WYMA
chains in the Genus database with same CATH topology
1GWPA 1EM9A 2X83A 4HTWA 2Y4ZA 5JPAA 2LF4A 1AK4C 2XGUA 2M8NA 1P7NA 1EIAA 5HGNA 4QNBA 2JPRA 4U0BA 4U0CA 2M8PA 4XFYA 4DGEC 1L6NA 2EIAA 1M9DC 2PXRC 1QRJA 4PH2A 4PH0A 5HGOA 4E91A 1U7KA 4U0EA 4XROA 4XFZA 1D1DA 1AFVA 1M9YC 4U0AA 5HGKA 3BP9A 4E92A 2X2DD 4J93A 2X82A 2GONA 3H4EA 1M9FC 2PWOA 2V4XA 2WLVA 3NTEA 4XFXA 2XDEA 1M9XC 3P05A 1M9CC 4LQWC 4U0DA 4PH3A 5HGLA 5HGMA 4XRQA 2M8LA 1G03A 3MGEA 2XGVA 4INBA 4B4NA 4DGAC 2KGFA 2XGYA 2PWMA 1E6JP 1M9EC 2WLVB 4NX4C 3H47A 4U0FA 2GOLB 4WYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWP A;  1EM9 A;  2X83 A;  4HTW A;  2Y4Z A;  5JPA A;  2LF4 A;  1AK4 C;  2XGU A;  2M8N A;  1P7N A;  1EIA A;  5HGN A;  4QNB A;  2JPR A;  4U0B A;  4U0C A;  2M8P A;  4XFY A;  4DGE C;  1L6N A;  2EIA A;  1M9D C;  2PXR C;  1QRJ A;  4PH2 A;  4PH0 A;  5HGO A;  4E91 A;  1U7K A;  4U0E A;  4XRO A;  4XFZ A;  1D1D A;  1AFV A;  1M9Y C;  4U0A A;  5HGK A;  3BP9 A;  4E92 A;  2X2D D;  4J93 A;  2X82 A;  2GON A;  3H4E A;  1M9F C;  2PWO A;  2V4X A;  2WLV A;  3NTE A;  4XFX A;  2XDE A;  1M9X C;  3P05 A;  1M9C C;  4LQW C;  4U0D A;  4PH3 A;  5HGL A;  5HGM A;  4XRQ A;  2M8L A;  1G03 A;  3MGE A;  2XGV A;  4INB A;  4B4N A;  4DGA C;  2KGF A;  2XGY A;  2PWM A;  1E6J P;  1M9E C;  2WLV B;  4NX4 C;  3H47 A;  4U0F A;  2GOL B;  4WYM A; 
#chains in the Genus database with same CATH topology
 1GWP A;  1EM9 A;  2X83 A;  4HTW A;  2Y4Z A;  5JPA A;  2LF4 A;  1AK4 C;  2XGU A;  2M8N A;  1P7N A;  1EIA A;  5HGN A;  4QNB A;  2JPR A;  4U0B A;  4U0C A;  2M8P A;  4XFY A;  4DGE C;  1L6N A;  2EIA A;  1M9D C;  2PXR C;  1QRJ A;  4PH2 A;  4PH0 A;  5HGO A;  4E91 A;  1U7K A;  4U0E A;  4XRO A;  4XFZ A;  1D1D A;  1AFV A;  1M9Y C;  4U0A A;  5HGK A;  3BP9 A;  4E92 A;  2X2D D;  4J93 A;  2X82 A;  2GON A;  3H4E A;  1M9F C;  2PWO A;  2V4X A;  2WLV A;  3NTE A;  4XFX A;  2XDE A;  1M9X C;  3P05 A;  1M9C C;  4LQW C;  4U0D A;  4PH3 A;  5HGL A;  5HGM A;  4XRQ A;  2M8L A;  1G03 A;  3MGE A;  2XGV A;  4INB A;  4B4N A;  4DGA C;  2KGF A;  2XGY A;  2PWM A;  1E6J P;  1M9E C;  2WLV B;  4NX4 C;  3H47 A;  4U0F A;  2GOL B;  4WYM A; 
#chains in the Genus database with same CATH homology
 1GWP A;  1EM9 A;  2X83 A;  4HTW A;  2Y4Z A;  5JPA A;  2LF4 A;  1AK4 C;  2XGU A;  2M8N A;  1P7N A;  1EIA A;  5HGN A;  4QNB A;  2JPR A;  4U0B A;  4U0C A;  2M8P A;  4XFY A;  4DGE C;  1L6N A;  2EIA A;  1M9D C;  2PXR C;  1QRJ A;  4PH2 A;  4PH0 A;  5HGO A;  4E91 A;  1U7K A;  4U0E A;  4XRO A;  4XFZ A;  1D1D A;  1AFV A;  1M9Y C;  4U0A A;  5HGK A;  3BP9 A;  4E92 A;  2X2D D;  4J93 A;  2X82 A;  2GON A;  3H4E A;  1M9F C;  2PWO A;  2V4X A;  2WLV A;  3NTE A;  4XFX A;  2XDE A;  1M9X C;  3P05 A;  1M9C C;  4LQW C;  4U0D A;  4PH3 A;  5HGL A;  5HGM A;  4XRQ A;  2M8L A;  1G03 A;  3MGE A;  2XGV A;  4INB A;  4B4N A;  4DGA C;  2KGF A;  2XGY A;  2PWM A;  1E6J P;  1M9E C;  2WLV B;  4NX4 C;  3H47 A;  4U0F A;  2GOL B;  4WYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...