1AFVA

Hiv-1 capsid protein (p24) complex with fab25.3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 CAPSID PROTEIN
publication title Crystal structure of dimeric HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 44
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1afvA00
4DGAC 2X83A 5HGMA 1AK4C 1M9EC 2X2DD 4NX4C 2KGFA 1P7NA 4XROA 2M8NA 4U0DA 5HGLA 3NTEA 4J93A 4XFXA 2M8PA 2V4XA 1M9XC 2XGYA 2JPRA 4U0EA 2GONA 1QRJA 5JPAA 5HGNA 1M9CC 2WLVA 2PWMA 4PH0A 1AFVA 4XFYA 4E91A 3BP9A 2XGUA 2WLVB 4QNBA 1G03A 1L6NA 4U0FA 1EM9A 4PH2A 2PWOA 4INBA 2Y4ZA 4DGEC 3H4EA 4U0BA 5HGKA 4WYMA 1EIAA 1GWPA 1U7KA 1M9YC 4XRQA 4U0AA 4E92A 3P05A 4B4NA 3H47A 1M9DC 2X82A 2M8LA 1M9FC 1E6JP 1D1DA 4U0CA 2XGVA 5HGOA 2EIAA 2XDEA 4HTWA 4XFZA 4LQWC 2LF4A 3MGEA 2GOLB 2PXRC 4PH3A
chains in the Genus database with same CATH superfamily
4DGAC 2X83A 5HGMA 1AK4C 1M9EC 2X2DD 4NX4C 2KGFA 1P7NA 4XROA 2M8NA 4U0DA 5HGLA 3NTEA 4J93A 4XFXA 2M8PA 2V4XA 1M9XC 2XGYA 2JPRA 4U0EA 2GONA 1QRJA 5JPAA 5HGNA 1M9CC 2WLVA 2PWMA 4PH0A 1AFVA 4XFYA 4E91A 3BP9A 2XGUA 2WLVB 4QNBA 1G03A 1L6NA 4U0FA 1EM9A 4PH2A 2PWOA 4INBA 2Y4ZA 4DGEC 3H4EA 4U0BA 5HGKA 4WYMA 1EIAA 1GWPA 1U7KA 1M9YC 4XRQA 4U0AA 4E92A 3P05A 4B4NA 3H47A 1M9DC 2X82A 2M8LA 1M9FC 1E6JP 1D1DA 4U0CA 2XGVA 5HGOA 2EIAA 2XDEA 4HTWA 4XFZA 4LQWC 2LF4A 3MGEA 2GOLB 2PXRC 4PH3A
chains in the Genus database with same CATH topology
4DGAC 2X83A 5HGMA 1AK4C 1M9EC 2X2DD 4NX4C 2KGFA 1P7NA 4XROA 2M8NA 4U0DA 5HGLA 3NTEA 4J93A 4XFXA 2M8PA 2V4XA 1M9XC 2XGYA 2JPRA 4U0EA 2GONA 1QRJA 5JPAA 5HGNA 1M9CC 2WLVA 2PWMA 4PH0A 1AFVA 4XFYA 4E91A 3BP9A 2XGUA 2WLVB 4QNBA 1G03A 1L6NA 4U0FA 1EM9A 4PH2A 2PWOA 4INBA 2Y4ZA 4DGEC 3H4EA 4U0BA 5HGKA 4WYMA 1EIAA 1GWPA 1U7KA 1M9YC 4XRQA 4U0AA 4E92A 3P05A 4B4NA 3H47A 1M9DC 2X82A 2M8LA 1M9FC 1E6JP 1D1DA 4U0CA 2XGVA 5HGOA 2EIAA 2XDEA 4HTWA 4XFZA 4LQWC 2LF4A 3MGEA 2GOLB 2PXRC 4PH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGA C;  2X83 A;  5HGM A;  1AK4 C;  1M9E C;  2X2D D;  4NX4 C;  2KGF A;  1P7N A;  4XRO A;  2M8N A;  4U0D A;  5HGL A;  3NTE A;  4J93 A;  4XFX A;  2M8P A;  2V4X A;  1M9X C;  2XGY A;  2JPR A;  4U0E A;  2GON A;  1QRJ A;  5JPA A;  5HGN A;  1M9C C;  2WLV A;  2PWM A;  4PH0 A;  1AFV A;  4XFY A;  4E91 A;  3BP9 A;  2XGU A;  2WLV B;  4QNB A;  1G03 A;  1L6N A;  4U0F A;  1EM9 A;  4PH2 A;  2PWO A;  4INB A;  2Y4Z A;  4DGE C;  3H4E A;  4U0B A;  5HGK A;  4WYM A;  1EIA A;  1GWP A;  1U7K A;  1M9Y C;  4XRQ A;  4U0A A;  4E92 A;  3P05 A;  4B4N A;  3H47 A;  1M9D C;  2X82 A;  2M8L A;  1M9F C;  1E6J P;  1D1D A;  4U0C A;  2XGV A;  5HGO A;  2EIA A;  2XDE A;  4HTW A;  4XFZ A;  4LQW C;  2LF4 A;  3MGE A;  2GOL B;  2PXR C;  4PH3 A; 
#chains in the Genus database with same CATH topology
 4DGA C;  2X83 A;  5HGM A;  1AK4 C;  1M9E C;  2X2D D;  4NX4 C;  2KGF A;  1P7N A;  4XRO A;  2M8N A;  4U0D A;  5HGL A;  3NTE A;  4J93 A;  4XFX A;  2M8P A;  2V4X A;  1M9X C;  2XGY A;  2JPR A;  4U0E A;  2GON A;  1QRJ A;  5JPA A;  5HGN A;  1M9C C;  2WLV A;  2PWM A;  4PH0 A;  1AFV A;  4XFY A;  4E91 A;  3BP9 A;  2XGU A;  2WLV B;  4QNB A;  1G03 A;  1L6N A;  4U0F A;  1EM9 A;  4PH2 A;  2PWO A;  4INB A;  2Y4Z A;  4DGE C;  3H4E A;  4U0B A;  5HGK A;  4WYM A;  1EIA A;  1GWP A;  1U7K A;  1M9Y C;  4XRQ A;  4U0A A;  4E92 A;  3P05 A;  4B4N A;  3H47 A;  1M9D C;  2X82 A;  2M8L A;  1M9F C;  1E6J P;  1D1D A;  4U0C A;  2XGV A;  5HGO A;  2EIA A;  2XDE A;  4HTW A;  4XFZ A;  4LQW C;  2LF4 A;  3MGE A;  2GOL B;  2PXR C;  4PH3 A; 
#chains in the Genus database with same CATH homology
 4DGA C;  2X83 A;  5HGM A;  1AK4 C;  1M9E C;  2X2D D;  4NX4 C;  2KGF A;  1P7N A;  4XRO A;  2M8N A;  4U0D A;  5HGL A;  3NTE A;  4J93 A;  4XFX A;  2M8P A;  2V4X A;  1M9X C;  2XGY A;  2JPR A;  4U0E A;  2GON A;  1QRJ A;  5JPA A;  5HGN A;  1M9C C;  2WLV A;  2PWM A;  4PH0 A;  1AFV A;  4XFY A;  4E91 A;  3BP9 A;  2XGU A;  2WLV B;  4QNB A;  1G03 A;  1L6N A;  4U0F A;  1EM9 A;  4PH2 A;  2PWO A;  4INB A;  2Y4Z A;  4DGE C;  3H4E A;  4U0B A;  5HGK A;  4WYM A;  1EIA A;  1GWP A;  1U7K A;  1M9Y C;  4XRQ A;  4U0A A;  4E92 A;  3P05 A;  4B4N A;  3H47 A;  1M9D C;  2X82 A;  2M8L A;  1M9F C;  1E6J P;  1D1D A;  4U0C A;  2XGV A;  5HGO A;  2EIA A;  2XDE A;  4HTW A;  4XFZ A;  4LQW C;  2LF4 A;  3MGE A;  2GOL B;  2PXR C;  4PH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...