1AFVA

Hiv-1 capsid protein (p24) complex with fab25.3
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN IMMUNODEFICIENCY VIRUS TYPE 1 CAPSID PROTEIN
publication title Crystal structure of dimeric HIV-1 capsid protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 44
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 1997-03-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1afvA00
4LQWC 4U0FA 1AK4C 1EIAA 4PH3A 1AFVA 2M8LA 1L6NA 4B4NA 3BP9A 1M9XC 4QNBA 3NTEA 1U7KA 2JPRA 2WLVB 2X83A 4XROA 4INBA 4XFYA 1P7NA 2M8PA 1M9EC 2PXRC 4U0CA 2X82A 4PH2A 2XGYA 5JPAA 1E6JP 4PH0A 2XGUA 2GOLB 1M9DC 1M9CC 4NX4C 1D1DA 4E92A 3P05A 1M9FC 4E91A 4XFXA 4HTWA 4J93A 4DGEC 4U0DA 5HGMA 2GONA 1GWPA 1EM9A 4U0BA 4WYMA 1M9YC 5HGOA 3H4EA 2EIAA 5HGNA 4XRQA 2XGVA 2PWMA 4DGAC 1G03A 3H47A 4U0AA 2KGFA 2WLVA 2X2DD 2PWOA 5HGLA 3MGEA 4U0EA 1QRJA 2V4XA 2M8NA 2Y4ZA 5HGKA 2XDEA 2LF4A 4XFZA
chains in the Genus database with same CATH superfamily
4LQWC 4U0FA 1AK4C 1EIAA 4PH3A 1AFVA 2M8LA 1L6NA 4B4NA 3BP9A 1M9XC 4QNBA 3NTEA 1U7KA 2JPRA 2WLVB 2X83A 4XROA 4INBA 4XFYA 1P7NA 2M8PA 1M9EC 2PXRC 4U0CA 2X82A 4PH2A 2XGYA 5JPAA 1E6JP 4PH0A 2XGUA 2GOLB 1M9DC 1M9CC 4NX4C 1D1DA 4E92A 3P05A 1M9FC 4E91A 4XFXA 4HTWA 4J93A 4DGEC 4U0DA 5HGMA 2GONA 1GWPA 1EM9A 4U0BA 4WYMA 1M9YC 5HGOA 3H4EA 2EIAA 5HGNA 4XRQA 2XGVA 2PWMA 4DGAC 1G03A 3H47A 4U0AA 2KGFA 2WLVA 2X2DD 2PWOA 5HGLA 3MGEA 4U0EA 1QRJA 2V4XA 2M8NA 2Y4ZA 5HGKA 2XDEA 2LF4A 4XFZA
chains in the Genus database with same CATH topology
4LQWC 4U0FA 1AK4C 1EIAA 4PH3A 1AFVA 2M8LA 1L6NA 4B4NA 3BP9A 1M9XC 4QNBA 3NTEA 1U7KA 2JPRA 2WLVB 2X83A 4XROA 4INBA 4XFYA 1P7NA 2M8PA 1M9EC 2PXRC 4U0CA 2X82A 4PH2A 2XGYA 5JPAA 1E6JP 4PH0A 2XGUA 2GOLB 1M9DC 1M9CC 4NX4C 1D1DA 4E92A 3P05A 1M9FC 4E91A 4XFXA 4HTWA 4J93A 4DGEC 4U0DA 5HGMA 2GONA 1GWPA 1EM9A 4U0BA 4WYMA 1M9YC 5HGOA 3H4EA 2EIAA 5HGNA 4XRQA 2XGVA 2PWMA 4DGAC 1G03A 3H47A 4U0AA 2KGFA 2WLVA 2X2DD 2PWOA 5HGLA 3MGEA 4U0EA 1QRJA 2V4XA 2M8NA 2Y4ZA 5HGKA 2XDEA 2LF4A 4XFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQW C;  4U0F A;  1AK4 C;  1EIA A;  4PH3 A;  1AFV A;  2M8L A;  1L6N A;  4B4N A;  3BP9 A;  1M9X C;  4QNB A;  3NTE A;  1U7K A;  2JPR A;  2WLV B;  2X83 A;  4XRO A;  4INB A;  4XFY A;  1P7N A;  2M8P A;  1M9E C;  2PXR C;  4U0C A;  2X82 A;  4PH2 A;  2XGY A;  5JPA A;  1E6J P;  4PH0 A;  2XGU A;  2GOL B;  1M9D C;  1M9C C;  4NX4 C;  1D1D A;  4E92 A;  3P05 A;  1M9F C;  4E91 A;  4XFX A;  4HTW A;  4J93 A;  4DGE C;  4U0D A;  5HGM A;  2GON A;  1GWP A;  1EM9 A;  4U0B A;  4WYM A;  1M9Y C;  5HGO A;  3H4E A;  2EIA A;  5HGN A;  4XRQ A;  2XGV A;  2PWM A;  4DGA C;  1G03 A;  3H47 A;  4U0A A;  2KGF A;  2WLV A;  2X2D D;  2PWO A;  5HGL A;  3MGE A;  4U0E A;  1QRJ A;  2V4X A;  2M8N A;  2Y4Z A;  5HGK A;  2XDE A;  2LF4 A;  4XFZ A; 
#chains in the Genus database with same CATH topology
 4LQW C;  4U0F A;  1AK4 C;  1EIA A;  4PH3 A;  1AFV A;  2M8L A;  1L6N A;  4B4N A;  3BP9 A;  1M9X C;  4QNB A;  3NTE A;  1U7K A;  2JPR A;  2WLV B;  2X83 A;  4XRO A;  4INB A;  4XFY A;  1P7N A;  2M8P A;  1M9E C;  2PXR C;  4U0C A;  2X82 A;  4PH2 A;  2XGY A;  5JPA A;  1E6J P;  4PH0 A;  2XGU A;  2GOL B;  1M9D C;  1M9C C;  4NX4 C;  1D1D A;  4E92 A;  3P05 A;  1M9F C;  4E91 A;  4XFX A;  4HTW A;  4J93 A;  4DGE C;  4U0D A;  5HGM A;  2GON A;  1GWP A;  1EM9 A;  4U0B A;  4WYM A;  1M9Y C;  5HGO A;  3H4E A;  2EIA A;  5HGN A;  4XRQ A;  2XGV A;  2PWM A;  4DGA C;  1G03 A;  3H47 A;  4U0A A;  2KGF A;  2WLV A;  2X2D D;  2PWO A;  5HGL A;  3MGE A;  4U0E A;  1QRJ A;  2V4X A;  2M8N A;  2Y4Z A;  5HGK A;  2XDE A;  2LF4 A;  4XFZ A; 
#chains in the Genus database with same CATH homology
 4LQW C;  4U0F A;  1AK4 C;  1EIA A;  4PH3 A;  1AFV A;  2M8L A;  1L6N A;  4B4N A;  3BP9 A;  1M9X C;  4QNB A;  3NTE A;  1U7K A;  2JPR A;  2WLV B;  2X83 A;  4XRO A;  4INB A;  4XFY A;  1P7N A;  2M8P A;  1M9E C;  2PXR C;  4U0C A;  2X82 A;  4PH2 A;  2XGY A;  5JPA A;  1E6J P;  4PH0 A;  2XGU A;  2GOL B;  1M9D C;  1M9C C;  4NX4 C;  1D1D A;  4E92 A;  3P05 A;  1M9F C;  4E91 A;  4XFX A;  4HTW A;  4J93 A;  4DGE C;  4U0D A;  5HGM A;  2GON A;  1GWP A;  1EM9 A;  4U0B A;  4WYM A;  1M9Y C;  5HGO A;  3H4E A;  2EIA A;  5HGN A;  4XRQ A;  2XGV A;  2PWM A;  4DGA C;  1G03 A;  3H47 A;  4U0A A;  2KGF A;  2WLV A;  2X2D D;  2PWO A;  5HGL A;  3MGE A;  4U0E A;  1QRJ A;  2V4X A;  2M8N A;  2Y4Z A;  5HGK A;  2XDE A;  2LF4 A;  4XFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...