4XFZA

Structure of the native full-length hiv-1 capsid protein in complex with pf-3450074 (pf74)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
221
structure length
213
Chain Sequence
PIVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 capsid protein
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
total genus 73
structure length 213
sequence length 221
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfzA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfzA02
1G03A 4XFYA 1EIAA 3DS5A 2PWMA 5JPAA 2BUOA 3DS1A 3NTEA 2JO0A 3P05A 1AFVA 4DGEC 1A43A 1U7KA 2X82A 3DS4A 2WLVA 1L6NA 5HGLA 4PH3A 1AUMA 3LRYA 4U0EA 4B4NA 2XT1A 4U0BA 1EOQA 4PH0A 4DGAC 3G28A 3DS0A 2GOLB 1EM9A 3MGEA 4COCA 2X83A 2WLVB 2KGFA 4M0IA 5DCKA 2Y4ZA 3DTJA 3DS2A 4PH1A 1BAJA 3DPHA 2XXMA 2KODA 1M9CC 4XFZA 2X2DD 2XGVA 3VRLC 4PH2A 4E91A 2M8PA 2M8NA 4U0AA 4LQWC 2ONTA 2V4XA 1M9YC 4HTWA 4WYMA 4XRQA 4U0CA 1E6JP 1GWPA 2XV6A 5I4TG 4E92A 3BP9A 2XDEA 1M9XC 4IPYA 3G26A 4XFXA 2JYLA 5HGOA 1P7NA 3G21A 1M9FC 3DS3A 3H47A 2LF4A 2EIAA 5HGKA 2XGUA 3H4EA 2JPRA 4J93A 4NX4C 1A8OA 1D1DA 4U0DA 5HGMA 1M9EC 3G29A 3G1IA 4INBA 1M9DC 2PWOA 2JYGA 2GONA 4XROA 4COPA 4QNBA 1AK4C 2XGYA 3G0VA 2M8LA 2L6EA 3G1GA 1QRJA 2PXRC 5HGNA 4U0FA
chains in the Genus database with same CATH superfamily
1HY8A 1VQPP 1L0IA 1KLPA 3DS5A 5BS1A 2OARA 2EHSA 3EJBA 3P05A 1U7KA 2WPTA 3CMAP 2GYKA 1AYIA 2VLNA 3B4QA 1EOQA 4DGAC 2GOLB 2KOPA 2LKIA 2DNWA 4R0MA 1DV5A 2Y4ZA 4H2WC 1BAJA 2FQ0A 3DPHA 4UHPB 4XFZA 2EFJA 1VQ6P 1Q81Q 4F37A 4QKOA 2FVFA 2K92A 4PH2A 4E91A 3EJEA 2OTJP 4LQWC 1M9YC 4WYMA 1YJ9P 1K73Q 2XV6A 2AF8A 5I4TG 4E92A 2XDEA 1W2BO 1UNKA 1YJWP 1IMQA 1M9XC 4IZ6A 4BPGA 1RO0A 2JYLA 3CPWO 5F2NA 2KG9A 3G21A 1M9FC 2MVVA 2PEQA 2JU1A 2KOQA 2LIUA 2FQ1A 3CCQP 2K2QA 2L4BA 4NX4C 5BS2A 5HGMA 2KOOA 1BXIA 5EW5E 1M9DC 2EHTA 1GPJA 2VLPA 3CCVP 2GZJA 2XGYA 3G0VA 2M8LA 2JU2A 4HKGA 2L0QA 1KC8Q 1YHQP 1QRJA 2QEXP 4PH1A 5HGNA 2AFEA 1G03A 4XFYA 2NO8A 5HV8A 1EIAA 5F2OA 3GJNA 1IUQA 1Q86Q 3NTEA 4DGEC 2FACA 2KGEA 1VQ8P 1A43A 2AVAA 3DS4A 1QVFO 5HGLA 2PEMA 4U0EA 2CGQA 2Z45A 2MVUA 3DS0A 2PEKA 1VHNA 1Q7YQ 4GR6A 4DG9A 1FR2A 3M1MA 2JGPA 1VQ7P 5DCKA 2Z44A 3CCMP 2MD9A 2VSQA 2OTLP 2LTEA 2K94A 2GDWA 5KP7B 1GXGA 3WBHA 2GZEA 3CCUP 4U0AA 1M1KQ 2ONTA 4U0CA 2MY5A 3GKLC 1K30A 2BHVA 1Q82Q 3G6EP 4IPYA 3G26A 4XFXA 5KP8B 3CC4P 2KORA 2GDYA 2N6ZA 3DS3A 1KD1Q 2XGUA 2PY8A 1S72P 3CCEP 2GDXA 4J93A 4PXHB 2KOSA 3CXCO 2FADA 2P9XA 2PEOA 2K0YA 4GR2A 1ACPA 4PWVB 2JQ4A 2GZGA 3G4SP 2ERHA 2FAEA 4QNBA 1AK4C 1K8AQ 2L6EA 5HVCA 4H2YC 1VQ4P 2N98A 1M74A 2PXRC 2KG8A 2CNRA 1K9MQ 3DS1A 3I56P 1VQ5P 2JBGA 2FVAA 3HYBA 2X82A 3CCJP 2ROQA 3EJDA 1E0HA 1ZNVA 1AUMA 1CEIA 3NY7B 4MRTC 4B4NA 2K93A 1DNYA 1Z6MA 3G71P 4PH0A 3G28A 5KP6B 3CE7A 3MGEA 1T8KA 2AFDA 5EJDA 4BPFA 4M0IA 3DTJA 3DS2A 1NQ4A 1AF8A 1NJIQ 2FQ2A 2N5IA 2XXMA 2LPKA 3CC7P 2M8PA 3B5IA 4CA3A 1UJZA 3E2DA 3RG6C 4BPHA 3BP9A 4H2XC 2MF4A 3GZMA 2JB0A 3I55P 3U43A 5HGOA 2FHSC 1VQKP 2LF4A 2KG6A 1VQMP 2JPRA 1A8OA 2DGYA 1KQSO 2GZFA 2PEJA 1M9EC 3G1IA 1RO2A 2LL8A 2PWOA 2JYGA 1ZMBA 2GONA 4XROA 2KWLA 4COPA 2PEIA 1MZ8A 1M6NA 2FVEA 4NEOA 5F2KA 1L0HA 2KGAA 4U0FA 7CEIA 3GZLA 5CZDB 2QNWA 2PWMA 5JPAA 2BUOA 2K5XA 3CC2P 2JO0A 1X3OA 2E1MA 2QA4P 1AFVA 2CQ8A 1IMPA 2WLVA 2VLOA 1L6NA 4PH3A 2KR5A 2XZ1C 3LRYA 2XT1A 4U0BA 3CD6P 2KW2A 2K0DX 1EM9A 1YI2P 3H0DA 4COCA 2X83A 2EG5A 2WLVB 2KGFA 2K0XA 1VQ9P 3OW2O 2N5HA 2GZIA 3CCSP 3CCRP 1RNIA 2KODA 1M9CC 1VQNP 1JJ2O 3CCLP 2X2DD 2XGVA 3VRLC 2M8NA 1HQBA 1N8RQ 1M90Q 2V4XA 4HTWA 4XRQA 1GWPA 1E6JP 1GXHA 1YITP 2L9FA 2M5RA 2JAZA 2PENA 1M6EX 2PNGA 1VKUA 2LMLA 2KGDA 1VQOP 2N6YA 1EMVA 2L22A 2LOLA 3Q20A 1P7NA 2KGCA 3CMEP 2LIWA 3H47A 3RG2A 2MR8A 1YJNP 1QVGO 2EIAA 5HGKA 2MR7A 2X2BA 3H4EA 1D1DA 4U0DA 2Z46A 2N50A 2XZ0D 3G29A 3HZQA 4INBA 1VQLP 1OR5A 1YIJP 2CG5B 3G1GA 1F80D 2VLQA 2CWOA 3LMOA
chains in the Genus database with same CATH topology
1G03A 4XFYA 1VQPP 1EIAA 3DS5A 2PWMA 5JPAA 2BUOA 1IUQA 3DS1A 5F2OA 5BS1A 2OARA 1Q86Q 3NTEA 2JO0A 3I56P 1VQ5P 2E1MA 3P05A 2QA4P 1AFVA 4DGEC 1VQ8P 1A43A 1U7KA 3HYBA 2X82A 3DS4A 2WLVA 3CCJP 1L6NA 1QVFO 5HGLA 4PH3A 3CMAP 1AUMA 3LRYA 2PEMA 4U0EA 4B4NA 2XT1A 2Z45A 4U0BA 3CD6P 3G71P 1EOQA 4PH0A 4DGAC 3G28A 3DS0A 2PEKA 2GOLB 1EM9A 3MGEA 1Q7YQ 1YI2P 4GR6A 3H0DA 4COCA 2X83A 2EG5A 3M1MA 2WLVB 2KGFA 1VQ7P 4M0IA 5DCKA 2Y4ZA 2Z44A 3DTJA 3CCMP 3DS2A 4PH1A 3OW2O 1VQ9P 1NJIQ 2OTLP 1BAJA 3CCSP 3DPHA 3CCRP 1RNIA 2XXMA 2KODA 1M9CC 4XFZA 2EFJA 1VQ6P 3WBHA 1VQNP 1Q81Q 1JJ2O 3CCLP 2X2DD 2XGVA 3CC7P 3VRLC 4PH2A 3CCUP 4E91A 2M8PA 2M8NA 3B5IA 2OTJP 4U0AA 4LQWC 1M1KQ 1N8RQ 1M90Q 2ONTA 2V4XA 3E2DA 1M9YC 4HTWA 4WYMA 4XRQA 4U0CA 1E6JP 1GWPA 1YJ9P 3RG6C 1YITP 1K73Q 1K9MQ 2XV6A 5I4TG 1K30A 4E92A 3BP9A 2PENA 2BHVA 2XDEA 1M6EX 1W2BO 1YJWP 1Q82Q 1M9XC 3I55P 4IPYA 3G6EP 1RO0A 3G26A 1VQOP 4XFXA 2JYLA 3CPWO 5F2NA 5HGOA 3Q20A 1P7NA 3G21A 3CC4P 3CMEP 1M9FC 3DS3A 1VQKP 3H47A 2LF4A 1YJNP 2PEQA 1QVGO 1KD1Q 2EIAA 5HGKA 2XGUA 2PY8A 3CCQP 1S72P 3CCEP 3H4EA 1VQMP 2JPRA 4J93A 4NX4C 1A8OA 1D1DA 2DGYA 3CXCO 4U0DA 2Z46A 5BS2A 5HGMA 1KQSO 2P9XA 2PEOA 2PEJA 1M9EC 3G29A 3HZQA 4GR2A 3G1IA 4INBA 1M9DC 1RO2A 2PWOA 2JYGA 1ZMBA 2GONA 4XROA 4COPA 3G4SP 1VQLP 1YIJP 4QNBA 2PEIA 3CCVP 1AK4C 1M6NA 2XGYA 3G0VA 2M8LA 1K8AQ 2L6EA 3G1GA 5F2KA 1VQ4P 1M74A 1KC8Q 1YHQP 1QRJA 2CWOA 3CC2P 2QEXP 2PXRC 5HGNA 4U0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G03 A;  4XFY A;  1EIA A;  3DS5 A;  2PWM A;  5JPA A;  2BUO A;  3DS1 A;  3NTE A;  2JO0 A;  3P05 A;  1AFV A;  4DGE C;  1A43 A;  1U7K A;  2X82 A;  3DS4 A;  2WLV A;  1L6N A;  5HGL A;  4PH3 A;  1AUM A;  3LRY A;  4U0E A;  4B4N A;  2XT1 A;  4U0B A;  1EOQ A;  4PH0 A;  4DGA C;  3G28 A;  3DS0 A;  2GOL B;  1EM9 A;  3MGE A;  4COC A;  2X83 A;  2WLV B;  2KGF A;  4M0I A;  5DCK A;  2Y4Z A;  3DTJ A;  3DS2 A;  4PH1 A;  1BAJ A;  3DPH A;  2XXM A;  2KOD A;  1M9C C;  4XFZ A;  2X2D D;  2XGV A;  3VRL C;  4PH2 A;  4E91 A;  2M8P A;  2M8N A;  4U0A A;  4LQW C;  2ONT A;  2V4X A;  1M9Y C;  4HTW A;  4WYM A;  4XRQ A;  4U0C A;  1E6J P;  1GWP A;  2XV6 A;  5I4T G;  4E92 A;  3BP9 A;  2XDE A;  1M9X C;  4IPY A;  3G26 A;  4XFX A;  2JYL A;  5HGO A;  1P7N A;  3G21 A;  1M9F C;  3DS3 A;  3H47 A;  2LF4 A;  2EIA A;  5HGK A;  2XGU A;  3H4E A;  2JPR A;  4J93 A;  4NX4 C;  1A8O A;  1D1D A;  4U0D A;  5HGM A;  1M9E C;  3G29 A;  3G1I A;  4INB A;  1M9D C;  2PWO A;  2JYG A;  2GON A;  4XRO A;  4COP A;  4QNB A;  1AK4 C;  2XGY A;  3G0V A;  2M8L A;  2L6E A;  3G1G A;  1QRJ A;  2PXR C;  5HGN A;  4U0F A; 
#chains in the Genus database with same CATH topology
 1HY8 A;  1VQP P;  1L0I A;  1KLP A;  3DS5 A;  5BS1 A;  2OAR A;  2EHS A;  3EJB A;  3P05 A;  1U7K A;  2WPT A;  3CMA P;  2GYK A;  1AYI A;  2VLN A;  3B4Q A;  1EOQ A;  4DGA C;  2GOL B;  2KOP A;  2LKI A;  2DNW A;  4R0M A;  1DV5 A;  2Y4Z A;  4H2W C;  1BAJ A;  2FQ0 A;  3DPH A;  4UHP B;  4XFZ A;  2EFJ A;  1VQ6 P;  1Q81 Q;  4F37 A;  4QKO A;  2FVF A;  2K92 A;  4PH2 A;  4E91 A;  3EJE A;  2OTJ P;  4LQW C;  1M9Y C;  4WYM A;  1YJ9 P;  1K73 Q;  2XV6 A;  2AF8 A;  5I4T G;  4E92 A;  2XDE A;  1W2B O;  1UNK A;  1YJW P;  1IMQ A;  1M9X C;  4IZ6 A;  4BPG A;  1RO0 A;  2JYL A;  3CPW O;  5F2N A;  2KG9 A;  3G21 A;  1M9F C;  2MVV A;  2PEQ A;  2JU1 A;  2KOQ A;  2LIU A;  2FQ1 A;  3CCQ P;  2K2Q A;  2L4B A;  4NX4 C;  5BS2 A;  5HGM A;  2KOO A;  1BXI A;  5EW5 E;  1M9D C;  2EHT A;  1GPJ A;  2VLP A;  3CCV P;  2GZJ A;  2XGY A;  3G0V A;  2M8L A;  2JU2 A;  4HKG A;  2L0Q A;  1KC8 Q;  1YHQ P;  1QRJ A;  2QEX P;  4PH1 A;  5HGN A;  2AFE A;  1G03 A;  4XFY A;  2NO8 A;  5HV8 A;  1EIA A;  5F2O A;  3GJN A;  1IUQ A;  1Q86 Q;  3NTE A;  4DGE C;  2FAC A;  2KGE A;  1VQ8 P;  1A43 A;  2AVA A;  3DS4 A;  1QVF O;  5HGL A;  2PEM A;  4U0E A;  2CGQ A;  2Z45 A;  2MVU A;  3DS0 A;  2PEK A;  1VHN A;  1Q7Y Q;  4GR6 A;  4DG9 A;  1FR2 A;  3M1M A;  2JGP A;  1VQ7 P;  5DCK A;  2Z44 A;  3CCM P;  2MD9 A;  2VSQ A;  2OTL P;  2LTE A;  2K94 A;  2GDW A;  5KP7 B;  1GXG A;  3WBH A;  2GZE A;  3CCU P;  4U0A A;  1M1K Q;  2ONT A;  4U0C A;  2MY5 A;  3GKL C;  1K30 A;  2BHV A;  1Q82 Q;  3G6E P;  4IPY A;  3G26 A;  4XFX A;  5KP8 B;  3CC4 P;  2KOR A;  2GDY A;  2N6Z A;  3DS3 A;  1KD1 Q;  2XGU A;  2PY8 A;  1S72 P;  3CCE P;  2GDX A;  4J93 A;  4PXH B;  2KOS A;  3CXC O;  2FAD A;  2P9X A;  2PEO A;  2K0Y A;  4GR2 A;  1ACP A;  4PWV B;  2JQ4 A;  2GZG A;  3G4S P;  2ERH A;  2FAE A;  4QNB A;  1AK4 C;  1K8A Q;  2L6E A;  5HVC A;  4H2Y C;  1VQ4 P;  2N98 A;  1M74 A;  2PXR C;  2KG8 A;  2CNR A;  1K9M Q;  3DS1 A;  3I56 P;  1VQ5 P;  2JBG A;  2FVA A;  3HYB A;  2X82 A;  3CCJ P;  2ROQ A;  3EJD A;  1E0H A;  1ZNV A;  1AUM A;  1CEI A;  3NY7 B;  4MRT C;  4B4N A;  2K93 A;  1DNY A;  1Z6M A;  3G71 P;  4PH0 A;  3G28 A;  5KP6 B;  3CE7 A;  3MGE A;  1T8K A;  2AFD A;  5EJD A;  4BPF A;  4M0I A;  3DTJ A;  3DS2 A;  1NQ4 A;  1AF8 A;  1NJI Q;  2FQ2 A;  2N5I A;  2XXM A;  2LPK A;  3CC7 P;  2M8P A;  3B5I A;  4CA3 A;  1UJZ A;  3E2D A;  3RG6 C;  4BPH A;  3BP9 A;  4H2X C;  2MF4 A;  3GZM A;  2JB0 A;  3I55 P;  3U43 A;  5HGO A;  2FHS C;  1VQK P;  2LF4 A;  2KG6 A;  1VQM P;  2JPR A;  1A8O A;  2DGY A;  1KQS O;  2GZF A;  2PEJ A;  1M9E C;  3G1I A;  1RO2 A;  2LL8 A;  2PWO A;  2JYG A;  1ZMB A;  2GON A;  4XRO A;  2KWL A;  4COP A;  2PEI A;  1MZ8 A;  1M6N A;  2FVE A;  4NEO A;  5F2K A;  1L0H A;  2KGA A;  4U0F A;  7CEI A;  3GZL A;  5CZD B;  2QNW A;  2PWM A;  5JPA A;  2BUO A;  2K5X A;  3CC2 P;  2JO0 A;  1X3O A;  2E1M A;  2QA4 P;  1AFV A;  2CQ8 A;  1IMP A;  2WLV A;  2VLO A;  1L6N A;  4PH3 A;  2KR5 A;  2XZ1 C;  3LRY A;  2XT1 A;  4U0B A;  3CD6 P;  2KW2 A;  2K0D X;  1EM9 A;  1YI2 P;  3H0D A;  4COC A;  2X83 A;  2EG5 A;  2WLV B;  2KGF A;  2K0X A;  1VQ9 P;  3OW2 O;  2N5H A;  2GZI A;  3CCS P;  3CCR P;  1RNI A;  2KOD A;  1M9C C;  1VQN P;  1JJ2 O;  3CCL P;  2X2D D;  2XGV A;  3VRL C;  2M8N A;  1HQB A;  1N8R Q;  1M90 Q;  2V4X A;  4HTW A;  4XRQ A;  1GWP A;  1E6J P;  1GXH A;  1YIT P;  2L9F A;  2M5R A;  2JAZ A;  2PEN A;  1M6E X;  2PNG A;  1VKU A;  2LML A;  2KGD A;  1VQO P;  2N6Y A;  1EMV A;  2L22 A;  2LOL A;  3Q20 A;  1P7N A;  2KGC A;  3CME P;  2LIW A;  3H47 A;  3RG2 A;  2MR8 A;  1YJN P;  1QVG O;  2EIA A;  5HGK A;  2MR7 A;  2X2B A;  3H4E A;  1D1D A;  4U0D A;  2Z46 A;  2N50 A;  2XZ0 D;  3G29 A;  3HZQ A;  4INB A;  1VQL P;  1OR5 A;  1YIJ P;  2CG5 B;  3G1G A;  1F80 D;  2VLQ A;  2CWO A;  3LMO A; 
#chains in the Genus database with same CATH homology
 1G03 A;  4XFY A;  1VQP P;  1EIA A;  3DS5 A;  2PWM A;  5JPA A;  2BUO A;  1IUQ A;  3DS1 A;  5F2O A;  5BS1 A;  2OAR A;  1Q86 Q;  3NTE A;  2JO0 A;  3I56 P;  1VQ5 P;  2E1M A;  3P05 A;  2QA4 P;  1AFV A;  4DGE C;  1VQ8 P;  1A43 A;  1U7K A;  3HYB A;  2X82 A;  3DS4 A;  2WLV A;  3CCJ P;  1L6N A;  1QVF O;  5HGL A;  4PH3 A;  3CMA P;  1AUM A;  3LRY A;  2PEM A;  4U0E A;  4B4N A;  2XT1 A;  2Z45 A;  4U0B A;  3CD6 P;  3G71 P;  1EOQ A;  4PH0 A;  4DGA C;  3G28 A;  3DS0 A;  2PEK A;  2GOL B;  1EM9 A;  3MGE A;  1Q7Y Q;  1YI2 P;  4GR6 A;  3H0D A;  4COC A;  2X83 A;  2EG5 A;  3M1M A;  2WLV B;  2KGF A;  1VQ7 P;  4M0I A;  5DCK A;  2Y4Z A;  2Z44 A;  3DTJ A;  3CCM P;  3DS2 A;  4PH1 A;  3OW2 O;  1VQ9 P;  1NJI Q;  2OTL P;  1BAJ A;  3CCS P;  3DPH A;  3CCR P;  1RNI A;  2XXM A;  2KOD A;  1M9C C;  4XFZ A;  2EFJ A;  1VQ6 P;  3WBH A;  1VQN P;  1Q81 Q;  1JJ2 O;  3CCL P;  2X2D D;  2XGV A;  3CC7 P;  3VRL C;  4PH2 A;  3CCU P;  4E91 A;  2M8P A;  2M8N A;  3B5I A;  2OTJ P;  4U0A A;  4LQW C;  1M1K Q;  1N8R Q;  1M90 Q;  2ONT A;  2V4X A;  3E2D A;  1M9Y C;  4HTW A;  4WYM A;  4XRQ A;  4U0C A;  1E6J P;  1GWP A;  1YJ9 P;  3RG6 C;  1YIT P;  1K73 Q;  1K9M Q;  2XV6 A;  5I4T G;  1K30 A;  4E92 A;  3BP9 A;  2PEN A;  2BHV A;  2XDE A;  1M6E X;  1W2B O;  1YJW P;  1Q82 Q;  1M9X C;  3I55 P;  4IPY A;  3G6E P;  1RO0 A;  3G26 A;  1VQO P;  4XFX A;  2JYL A;  3CPW O;  5F2N A;  5HGO A;  3Q20 A;  1P7N A;  3G21 A;  3CC4 P;  3CME P;  1M9F C;  3DS3 A;  1VQK P;  3H47 A;  2LF4 A;  1YJN P;  2PEQ A;  1QVG O;  1KD1 Q;  2EIA A;  5HGK A;  2XGU A;  2PY8 A;  3CCQ P;  1S72 P;  3CCE P;  3H4E A;  1VQM P;  2JPR A;  4J93 A;  4NX4 C;  1A8O A;  1D1D A;  2DGY A;  3CXC O;  4U0D A;  2Z46 A;  5BS2 A;  5HGM A;  1KQS O;  2P9X A;  2PEO A;  2PEJ A;  1M9E C;  3G29 A;  3HZQ A;  4GR2 A;  3G1I A;  4INB A;  1M9D C;  1RO2 A;  2PWO A;  2JYG A;  1ZMB A;  2GON A;  4XRO A;  4COP A;  3G4S P;  1VQL P;  1YIJ P;  4QNB A;  2PEI A;  3CCV P;  1AK4 C;  1M6N A;  2XGY A;  3G0V A;  2M8L A;  1K8A Q;  2L6E A;  3G1G A;  5F2K A;  1VQ4 P;  1M74 A;  1KC8 Q;  1YHQ P;  1QRJ A;  2CWO A;  3CC2 P;  2QEX P;  2PXR C;  5HGN A;  4U0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...