4XFZA

Structure of the native full-length hiv-1 capsid protein in complex with pf-3450074 (pf74)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
221
structure length
213
Chain Sequence
PIVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 capsid protein
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
total genus 73
structure length 213
sequence length 221
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfzA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfzA02
2V4XA 2L6EA 2JO0A 5HGKA 1AUMA 4E91A 4U0AA 4E92A 4XFXA 1EIAA 2PWMA 4WYMA 2JPRA 4COCA 1EM9A 5HGOA 1M9DC 4U0DA 4U0EA 3LRYA 1AK4C 4DGEC 2X83A 4QNBA 3G26A 3G29A 2XDEA 1E6JP 4XFZA 2JYLA 2XT1A 3DTJA 3H47A 4XRQA 2KODA 4XROA 3G21A 1AFVA 2PWOA 3DS3A 5JPAA 4IPYA 1A8OA 2XGUA 2WLVB 3DS2A 2XV6A 2GONA 1BAJA 1L6NA 2M8LA 3DS1A 5HGMA 4M0IA 4J93A 4PH0A 4NX4C 3G1IA 2LF4A 2WLVA 3H4EA 1A43A 5HGNA 2JYGA 4DGAC 1U7KA 3BP9A 2M8PA 1P7NA 2X2DD 2XXMA 1M9EC 3P05A 2PXRC 5I4TG 4B4NA 3DS0A 1M9FC 5DCKA 4U0BA 3DS4A 2X82A 4PH1A 1D1DA 5HGLA 1G03A 3DS5A 2XGVA 1EOQA 2XGYA 3NTEA 2KGFA 3G28A 2M8NA 4HTWA 4PH3A 4COPA 4U0FA 4PH2A 3DPHA 2GOLB 3G0VA 2Y4ZA 1QRJA 1GWPA 2EIAA 2ONTA 3VRLC 2BUOA 4U0CA 4LQWC 4INBA 3G1GA 1M9XC 3MGEA 4XFYA 1M9CC 1M9YC
chains in the Genus database with same CATH superfamily
4H2WC 2L6EA 2XZ1C 3EJDA 1F80D 1KQSO 1X3OA 2CQ8A 2KOOA 1EIAA 1ACPA 1OR5A 1M9DC 1AYIA 3LRYA 1AK4C 4DGEC 2GYKA 3CCQP 2JYLA 3I56P 3DTJA 2PEJA 1M1KQ 2PEMA 2PWOA 5EW5E 2JQ4A 1MZ8A 2KG6A 2N6ZA 2XGUA 2PENA 1UJZA 1IMPA 5BS2A 1BAJA 3CC2P 1E0HA 1YITP 2FQ1A 3GZLA 3G6EP 2N5HA 2EG5A 1M90Q 3G4SP 3DS0A 1M9FC 2N98A 3DS4A 1NQ4A 2Z46A 2KWLA 2AFEA 5HGLA 1EOQA 3G28A 2N6YA 2DGYA 2K0YA 3Q20A 1YHQP 4PH3A 2GDXA 4COPA 4UHPB 4U0FA 2NO8A 2CNRA 4MRTC 3DPHA 1DV5A 4GR6A 2GDWA 2KG9A 1GXHA 2Y4ZA 2MR8A 1N8RQ 1VQ8P 1T8KA 3I55P 3CC7P 2PEQA 3E2DA 2L0QA 2L22A 2N5IA 3G1GA 4XFYA 2VLOA 1NJIQ 2OARA 4PWVB 1UNKA 5HGKA 1AUMA 4E91A 1VQMP 1VQKP 1YJNP 2LMLA 2PWMA 2JPRA 1EM9A 1M74A 5EJDA 1VQ5P 4U0DA 1W2BO 2QNWA 4QKOA 3B4QA 1Q86Q 2XDEA 3CE7A 2N50A 2KODA 2JGPA 2KR5A 3NY7B 3CCSP 3G21A 2VLQA 2PY8A 5JPAA 2JBGA 4BPFA 5F2KA 2LKIA 2MY5A 2XV6A 2GONA 2LOLA 2JU2A 2M8LA 2GZGA 1YJWP 4PH0A 3U43A 1K8AQ 4NX4C 3H4EA 1A43A 3GZMA 5BS1A 4PXHB 4DGAC 1U7KA 1P7NA 2XXMA 3P05A 1ZNVA 2MR7A 4B4NA 5DCKA 2X82A 2AF8A 4PH1A 2CG5B 2XGYA 3NTEA 3CMEP 3LMOA 2K2QA 4F37A 2PEIA 3CMAP 5HVCA 2FACA 1VHNA 4GR2A 1EMVA 4PH2A 3RG6C 2WPTA 2KOQA 1M6EX 2VSQA 1QRJA 1GWPA 3HYBA 2EIAA 2OTLP 2K94A 2X2BA 5CZDB 1QVFO 3WBHA 1VKUA 3CCUP 4INBA 2GZIA 2DNWA 3M1MA 2AVAA 1M9YC 4U0AA 4E92A 4XFXA 4COCA 5HGOA 2BHVA 2X83A 4QNBA 3G26A 2FADA 2LTEA 1QVGO 2XT1A 4BPHA 4XRQA 1S72P 2EHSA 3CCEP 2EFJA 1AFVA 2CGQA 3DS3A 2K0XA 1A8OA 2QEXP 2EHTA 1RO0A 2KGCA 1KLPA 3DS2A 3CCJP 2AFDA 1L6NA 1Z6MA 2QA4P 3OW2O 2KORA 2L9FA 3DS1A 4M0IA 3CCRP 4J93A 2FVEA 3G1IA 2LF4A 2WLVA 1RO2A 2JYGA 1VQ6P 3G71P 5HV8A 2Z44A 1YIJP 2X2DD 1VQPP 2PXRC 3GKLC 1Q81Q 5I4TG 3GJNA 3CCVP 2MVUA 2LPKA 2P9XA 1G03A 3DS5A 2XGVA 2MD9A 2K0DX 4NEOA 3CXCO 2JB0A 2KGDA 2PNGA 4HTWA 1K73Q 1M6NA 1IUQA 3EJBA 3H0DA 1AF8A 2CWOA 5KP6B 2GOLB 1HQBA 2JU1A 1VQNP 2K92A 2XZ0D 2VLNA 7CEIA 1Q7YQ 1BXIA 2JAZA 3VRLC 2BUOA 3CC4P 3CD6P 1Q82Q 1L0HA 2LIWA 4LQWC 2GZFA 2FHSC 2Z45A 1M9XC 2KG8A 2ONTA 1M9CC 1VQ4P 2V4XA 2JO0A 2KOPA 3CCLP 2L4BA 4H2YC 2GZJA 1VQ9P 1L0IA 4BPGA 4WYMA 2FVFA 2K93A 1CEIA 4U0EA 2VLPA 1K30A 4IZ6A 1VQOP 2K5XA 3G29A 1GPJA 1E6JP 1IMQA 1GXGA 4XFZA 3H47A 2MF4A 3HZQA 2OTJP 5KP8B 4XROA 2MVVA 4IPYA 2KW2A 1FR2A 5F2OA 2FQ2A 2FAEA 1HY8A 2FQ0A 2GDYA 2KOSA 5KP7B 2LIUA 4DG9A 2WLVB 2ERHA 1VQ7P 3B5IA 4R0MA 2PEOA 5HGMA 4HKGA 1JJ2O 5HGNA 1YI2P 3BP9A 2M8PA 2LL8A 1M9EC 1VQLP 4U0BA 2GZEA 2M5RA 1ZMBA 2KGAA 2PEKA 1KD1Q 2KGEA 1D1DA 3RG2A 5F2NA 2KGFA 2M8NA 2ROQA 3CPWO 1RNIA 1DNYA 1YJ9P 1KC8Q 2E1MA 3G0VA 1K9MQ 4H2XC 4CA3A 3CCMP 4U0CA 3EJEA 3MGEA 2FVAA
chains in the Genus database with same CATH topology
2V4XA 2L6EA 2JO0A 1KQSO 1NJIQ 3CCLP 2OARA 5HGKA 1AUMA 4E91A 1VQ9P 4U0AA 4E92A 1VQMP 1VQKP 4XFXA 1YJNP 1EIAA 2PWMA 4WYMA 2JPRA 4COCA 1EM9A 5HGOA 1M74A 1M9DC 4U0DA 2BHVA 1VQ5P 1W2BO 4U0EA 3LRYA 1AK4C 4DGEC 2X83A 4QNBA 1K30A 3G26A 1Q86Q 1VQOP 3CCQP 3G29A 2XDEA 1E6JP 1QVGO 4XFZA 2JYLA 2XT1A 3DTJA 3H47A 3I56P 3HZQA 4XRQA 2PEJA 2OTJP 2KODA 1S72P 3CCEP 1M1KQ 4XROA 2EFJA 3G21A 3CCSP 1AFVA 2PEMA 2PY8A 2PWOA 3DS3A 5JPAA 4IPYA 5F2OA 1A8OA 2QEXP 1RO0A 5F2KA 2XGUA 2PENA 2WLVB 3DS2A 2XV6A 2GONA 5BS2A 1VQ7P 3B5IA 1BAJA 3CCJP 2PEOA 1L6NA 3OW2O 2QA4P 2M8LA 1YJWP 3DS1A 5HGMA 4M0IA 3CCRP 3CC2P 4J93A 4PH0A 1K8AQ 1JJ2O 1YITP 4NX4C 3G1IA 3G6EP 2LF4A 2WLVA 3H4EA 1A43A 1RO2A 5HGNA 2JYGA 5BS1A 1VQ6P 3G71P 4DGAC 1YI2P 2Z44A 1U7KA 3BP9A 1YIJP 2M8PA 1P7NA 2X2DD 2EG5A 1M9EC 3P05A 2PXRC 2XXMA 1VQPP 1M90Q 1Q81Q 5I4TG 3G4SP 4B4NA 3DS0A 1M9FC 5DCKA 1VQLP 4U0BA 3CCVP 3DS4A 1ZMBA 2X82A 2P9XA 4PH1A 2PEKA 2Z46A 1KD1Q 1D1DA 5HGLA 1G03A 3DS5A 2XGVA 5F2NA 3CXCO 1EOQA 2XGYA 3NTEA 3CMEP 2KGFA 3G28A 2M8NA 3CPWO 2DGYA 2PEIA 4HTWA 3CMAP 3Q20A 1K73Q 1YHQP 4PH3A 1M6NA 1RNIA 4COPA 1IUQA 1YJ9P 4U0FA 4GR2A 3H0DA 1KC8Q 4PH2A 2CWOA 3DPHA 3RG6C 2E1MA 2GOLB 1VQNP 4GR6A 3G0VA 1M6EX 2Y4ZA 1K9MQ 1QRJA 1GWPA 1Q7YQ 3HYBA 2EIAA 1N8RQ 2OTLP 2ONTA 3VRLC 2BUOA 1VQ8P 3CCMP 3CC4P 4U0CA 1QVFO 3WBHA 3I55P 1Q82Q 3CC7P 3CD6P 3CCUP 4LQWC 2PEQA 2Z45A 4INBA 3E2DA 3G1GA 3M1MA 1M9XC 3MGEA 4XFYA 1M9CC 1VQ4P 1M9YC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V4X A;  2L6E A;  2JO0 A;  5HGK A;  1AUM A;  4E91 A;  4U0A A;  4E92 A;  4XFX A;  1EIA A;  2PWM A;  4WYM A;  2JPR A;  4COC A;  1EM9 A;  5HGO A;  1M9D C;  4U0D A;  4U0E A;  3LRY A;  1AK4 C;  4DGE C;  2X83 A;  4QNB A;  3G26 A;  3G29 A;  2XDE A;  1E6J P;  4XFZ A;  2JYL A;  2XT1 A;  3DTJ A;  3H47 A;  4XRQ A;  2KOD A;  4XRO A;  3G21 A;  1AFV A;  2PWO A;  3DS3 A;  5JPA A;  4IPY A;  1A8O A;  2XGU A;  2WLV B;  3DS2 A;  2XV6 A;  2GON A;  1BAJ A;  1L6N A;  2M8L A;  3DS1 A;  5HGM A;  4M0I A;  4J93 A;  4PH0 A;  4NX4 C;  3G1I A;  2LF4 A;  2WLV A;  3H4E A;  1A43 A;  5HGN A;  2JYG A;  4DGA C;  1U7K A;  3BP9 A;  2M8P A;  1P7N A;  2X2D D;  2XXM A;  1M9E C;  3P05 A;  2PXR C;  5I4T G;  4B4N A;  3DS0 A;  1M9F C;  5DCK A;  4U0B A;  3DS4 A;  2X82 A;  4PH1 A;  1D1D A;  5HGL A;  1G03 A;  3DS5 A;  2XGV A;  1EOQ A;  2XGY A;  3NTE A;  2KGF A;  3G28 A;  2M8N A;  4HTW A;  4PH3 A;  4COP A;  4U0F A;  4PH2 A;  3DPH A;  2GOL B;  3G0V A;  2Y4Z A;  1QRJ A;  1GWP A;  2EIA A;  2ONT A;  3VRL C;  2BUO A;  4U0C A;  4LQW C;  4INB A;  3G1G A;  1M9X C;  3MGE A;  4XFY A;  1M9C C;  1M9Y C; 
#chains in the Genus database with same CATH topology
 4H2W C;  2L6E A;  2XZ1 C;  3EJD A;  1F80 D;  1KQS O;  1X3O A;  2CQ8 A;  2KOO A;  1EIA A;  1ACP A;  1OR5 A;  1M9D C;  1AYI A;  3LRY A;  1AK4 C;  4DGE C;  2GYK A;  3CCQ P;  2JYL A;  3I56 P;  3DTJ A;  2PEJ A;  1M1K Q;  2PEM A;  2PWO A;  5EW5 E;  2JQ4 A;  1MZ8 A;  2KG6 A;  2N6Z A;  2XGU A;  2PEN A;  1UJZ A;  1IMP A;  5BS2 A;  1BAJ A;  3CC2 P;  1E0H A;  1YIT P;  2FQ1 A;  3GZL A;  3G6E P;  2N5H A;  2EG5 A;  1M90 Q;  3G4S P;  3DS0 A;  1M9F C;  2N98 A;  3DS4 A;  1NQ4 A;  2Z46 A;  2KWL A;  2AFE A;  5HGL A;  1EOQ A;  3G28 A;  2N6Y A;  2DGY A;  2K0Y A;  3Q20 A;  1YHQ P;  4PH3 A;  2GDX A;  4COP A;  4UHP B;  4U0F A;  2NO8 A;  2CNR A;  4MRT C;  3DPH A;  1DV5 A;  4GR6 A;  2GDW A;  2KG9 A;  1GXH A;  2Y4Z A;  2MR8 A;  1N8R Q;  1VQ8 P;  1T8K A;  3I55 P;  3CC7 P;  2PEQ A;  3E2D A;  2L0Q A;  2L22 A;  2N5I A;  3G1G A;  4XFY A;  2VLO A;  1NJI Q;  2OAR A;  4PWV B;  1UNK A;  5HGK A;  1AUM A;  4E91 A;  1VQM P;  1VQK P;  1YJN P;  2LML A;  2PWM A;  2JPR A;  1EM9 A;  1M74 A;  5EJD A;  1VQ5 P;  4U0D A;  1W2B O;  2QNW A;  4QKO A;  3B4Q A;  1Q86 Q;  2XDE A;  3CE7 A;  2N50 A;  2KOD A;  2JGP A;  2KR5 A;  3NY7 B;  3CCS P;  3G21 A;  2VLQ A;  2PY8 A;  5JPA A;  2JBG A;  4BPF A;  5F2K A;  2LKI A;  2MY5 A;  2XV6 A;  2GON A;  2LOL A;  2JU2 A;  2M8L A;  2GZG A;  1YJW P;  4PH0 A;  3U43 A;  1K8A Q;  4NX4 C;  3H4E A;  1A43 A;  3GZM A;  5BS1 A;  4PXH B;  4DGA C;  1U7K A;  1P7N A;  2XXM A;  3P05 A;  1ZNV A;  2MR7 A;  4B4N A;  5DCK A;  2X82 A;  2AF8 A;  4PH1 A;  2CG5 B;  2XGY A;  3NTE A;  3CME P;  3LMO A;  2K2Q A;  4F37 A;  2PEI A;  3CMA P;  5HVC A;  2FAC A;  1VHN A;  4GR2 A;  1EMV A;  4PH2 A;  3RG6 C;  2WPT A;  2KOQ A;  1M6E X;  2VSQ A;  1QRJ A;  1GWP A;  3HYB A;  2EIA A;  2OTL P;  2K94 A;  2X2B A;  5CZD B;  1QVF O;  3WBH A;  1VKU A;  3CCU P;  4INB A;  2GZI A;  2DNW A;  3M1M A;  2AVA A;  1M9Y C;  4U0A A;  4E92 A;  4XFX A;  4COC A;  5HGO A;  2BHV A;  2X83 A;  4QNB A;  3G26 A;  2FAD A;  2LTE A;  1QVG O;  2XT1 A;  4BPH A;  4XRQ A;  1S72 P;  2EHS A;  3CCE P;  2EFJ A;  1AFV A;  2CGQ A;  3DS3 A;  2K0X A;  1A8O A;  2QEX P;  2EHT A;  1RO0 A;  2KGC A;  1KLP A;  3DS2 A;  3CCJ P;  2AFD A;  1L6N A;  1Z6M A;  2QA4 P;  3OW2 O;  2KOR A;  2L9F A;  3DS1 A;  4M0I A;  3CCR P;  4J93 A;  2FVE A;  3G1I A;  2LF4 A;  2WLV A;  1RO2 A;  2JYG A;  1VQ6 P;  3G71 P;  5HV8 A;  2Z44 A;  1YIJ P;  2X2D D;  1VQP P;  2PXR C;  3GKL C;  1Q81 Q;  5I4T G;  3GJN A;  3CCV P;  2MVU A;  2LPK A;  2P9X A;  1G03 A;  3DS5 A;  2XGV A;  2MD9 A;  2K0D X;  4NEO A;  3CXC O;  2JB0 A;  2KGD A;  2PNG A;  4HTW A;  1K73 Q;  1M6N A;  1IUQ A;  3EJB A;  3H0D A;  1AF8 A;  2CWO A;  5KP6 B;  2GOL B;  1HQB A;  2JU1 A;  1VQN P;  2K92 A;  2XZ0 D;  2VLN A;  7CEI A;  1Q7Y Q;  1BXI A;  2JAZ A;  3VRL C;  2BUO A;  3CC4 P;  3CD6 P;  1Q82 Q;  1L0H A;  2LIW A;  4LQW C;  2GZF A;  2FHS C;  2Z45 A;  1M9X C;  2KG8 A;  2ONT A;  1M9C C;  1VQ4 P;  2V4X A;  2JO0 A;  2KOP A;  3CCL P;  2L4B A;  4H2Y C;  2GZJ A;  1VQ9 P;  1L0I A;  4BPG A;  4WYM A;  2FVF A;  2K93 A;  1CEI A;  4U0E A;  2VLP A;  1K30 A;  4IZ6 A;  1VQO P;  2K5X A;  3G29 A;  1GPJ A;  1E6J P;  1IMQ A;  1GXG A;  4XFZ A;  3H47 A;  2MF4 A;  3HZQ A;  2OTJ P;  5KP8 B;  4XRO A;  2MVV A;  4IPY A;  2KW2 A;  1FR2 A;  5F2O A;  2FQ2 A;  2FAE A;  1HY8 A;  2FQ0 A;  2GDY A;  2KOS A;  5KP7 B;  2LIU A;  4DG9 A;  2WLV B;  2ERH A;  1VQ7 P;  3B5I A;  4R0M A;  2PEO A;  5HGM A;  4HKG A;  1JJ2 O;  5HGN A;  1YI2 P;  3BP9 A;  2M8P A;  2LL8 A;  1M9E C;  1VQL P;  4U0B A;  2GZE A;  2M5R A;  1ZMB A;  2KGA A;  2PEK A;  1KD1 Q;  2KGE A;  1D1D A;  3RG2 A;  5F2N A;  2KGF A;  2M8N A;  2ROQ A;  3CPW O;  1RNI A;  1DNY A;  1YJ9 P;  1KC8 Q;  2E1M A;  3G0V A;  1K9M Q;  4H2X C;  4CA3 A;  3CCM P;  4U0C A;  3EJE A;  3MGE A;  2FVA A; 
#chains in the Genus database with same CATH homology
 2V4X A;  2L6E A;  2JO0 A;  1KQS O;  1NJI Q;  3CCL P;  2OAR A;  5HGK A;  1AUM A;  4E91 A;  1VQ9 P;  4U0A A;  4E92 A;  1VQM P;  1VQK P;  4XFX A;  1YJN P;  1EIA A;  2PWM A;  4WYM A;  2JPR A;  4COC A;  1EM9 A;  5HGO A;  1M74 A;  1M9D C;  4U0D A;  2BHV A;  1VQ5 P;  1W2B O;  4U0E A;  3LRY A;  1AK4 C;  4DGE C;  2X83 A;  4QNB A;  1K30 A;  3G26 A;  1Q86 Q;  1VQO P;  3CCQ P;  3G29 A;  2XDE A;  1E6J P;  1QVG O;  4XFZ A;  2JYL A;  2XT1 A;  3DTJ A;  3H47 A;  3I56 P;  3HZQ A;  4XRQ A;  2PEJ A;  2OTJ P;  2KOD A;  1S72 P;  3CCE P;  1M1K Q;  4XRO A;  2EFJ A;  3G21 A;  3CCS P;  1AFV A;  2PEM A;  2PY8 A;  2PWO A;  3DS3 A;  5JPA A;  4IPY A;  5F2O A;  1A8O A;  2QEX P;  1RO0 A;  5F2K A;  2XGU A;  2PEN A;  2WLV B;  3DS2 A;  2XV6 A;  2GON A;  5BS2 A;  1VQ7 P;  3B5I A;  1BAJ A;  3CCJ P;  2PEO A;  1L6N A;  3OW2 O;  2QA4 P;  2M8L A;  1YJW P;  3DS1 A;  5HGM A;  4M0I A;  3CCR P;  3CC2 P;  4J93 A;  4PH0 A;  1K8A Q;  1JJ2 O;  1YIT P;  4NX4 C;  3G1I A;  3G6E P;  2LF4 A;  2WLV A;  3H4E A;  1A43 A;  1RO2 A;  5HGN A;  2JYG A;  5BS1 A;  1VQ6 P;  3G71 P;  4DGA C;  1YI2 P;  2Z44 A;  1U7K A;  3BP9 A;  1YIJ P;  2M8P A;  1P7N A;  2X2D D;  2EG5 A;  1M9E C;  3P05 A;  2PXR C;  2XXM A;  1VQP P;  1M90 Q;  1Q81 Q;  5I4T G;  3G4S P;  4B4N A;  3DS0 A;  1M9F C;  5DCK A;  1VQL P;  4U0B A;  3CCV P;  3DS4 A;  1ZMB A;  2X82 A;  2P9X A;  4PH1 A;  2PEK A;  2Z46 A;  1KD1 Q;  1D1D A;  5HGL A;  1G03 A;  3DS5 A;  2XGV A;  5F2N A;  3CXC O;  1EOQ A;  2XGY A;  3NTE A;  3CME P;  2KGF A;  3G28 A;  2M8N A;  3CPW O;  2DGY A;  2PEI A;  4HTW A;  3CMA P;  3Q20 A;  1K73 Q;  1YHQ P;  4PH3 A;  1M6N A;  1RNI A;  4COP A;  1IUQ A;  1YJ9 P;  4U0F A;  4GR2 A;  3H0D A;  1KC8 Q;  4PH2 A;  2CWO A;  3DPH A;  3RG6 C;  2E1M A;  2GOL B;  1VQN P;  4GR6 A;  3G0V A;  1M6E X;  2Y4Z A;  1K9M Q;  1QRJ A;  1GWP A;  1Q7Y Q;  3HYB A;  2EIA A;  1N8R Q;  2OTL P;  2ONT A;  3VRL C;  2BUO A;  1VQ8 P;  3CCM P;  3CC4 P;  4U0C A;  1QVF O;  3WBH A;  3I55 P;  1Q82 Q;  3CC7 P;  3CD6 P;  3CCU P;  4LQW C;  2PEQ A;  2Z45 A;  4INB A;  3E2D A;  3G1G A;  3M1M A;  1M9X C;  3MGE A;  4XFY A;  1M9C C;  1VQ4 P;  1M9Y C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...