4XFZA

Structure of the native full-length hiv-1 capsid protein in complex with pf-3450074 (pf74)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
221
structure length
213
Chain Sequence
b'PIVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 capsid protein
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
total genus 73
structure length 213
sequence length 221
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfzA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfzA02
1GWPA 3DS3A 3G1IA 1P7NA 3NTEA 4INBA 1A43A 4PH1A 5HGLA 2BUOA 1M9CC 3G29A 2LF4A 4XFXA 4E91A 3G1GA 2JPRA 2WLVB 2X82A 4NX4C 2XT1A 4U0EA 1L6NA 4COCA 2PWMA 1M9YC 4U0FA 1AK4C 3DS2A 5JPAA 2PWOA 4M0IA 4XROA 2XXMA 5HGNA 2JYGA 4XRQA 2L6EA 5DCKA 1D1DA 5I4TG 2M8LA 3G26A 1U7KA 3G21A 5HGOA 4DGAC 3LRYA 2WLVA 4COPA 2XDEA 3DS1A 1EM9A 3G28A 2KODA 3VRLC 4HTWA 4J93A 5HGMA 4LQWC 3DS5A 1A8OA 2Y4ZA 4U0AA 2XGUA 4U0BA 4XFYA 1M9EC 2V4XA 2ONTA 1M9DC 3DS4A 2M8PA 2X83A 4DGEC 1BAJA 4B4NA 2JO0A 2GONA 4WYMA 3H47A 3DS0A 2X2DD 4PH2A 4QNBA 1M9XC 3BP9A 1EIAA 4PH3A 1AFVA 3MGEA 1QRJA 2GOLB 1M9FC 5HGKA 3H4EA 4PH0A 4U0DA 1AUMA 3P05A 1G03A 3DPHA 4U0CA 4XFZA 2M8NA 3G0VA 2XGVA 1E6JP 4E92A 1EOQA 2EIAA 2PXRC 2KGFA 4IPYA 2XV6A 3DTJA 2XGYA 2JYLA
chains in the Genus database with same CATH superfamily
2GZJA 1FR2A 3M1MA 2JGPA 3G1IA 3NTEA 2N6ZA 4PXHB 3B5IA 2GZFA 5F2OA 1VQ5P 4XFXA 4E91A 1RNIA 1OR5A 1YIJP 2JPRA 5KP7B 2XT1A 2X2BA 4U0FA 1UNKA 3EJBA 3CE7A 3WBHA 1K73Q 2FAEA 4GR2A 2M8LA 3CXCO 1VQNP 2L0QA 2JAZA 1U7KA 2PEJA 2K0XA 1VQPP 4MRTC 2KWLA 2PEOA 2PNGA 3CCRP 1CEIA 2VLPA 4J93A 2JBGA 3GZLA 2N98A 3HZQA 3DS5A 3LMOA 1YI2P 1M6EX 2BHVA 3NY7B 1KLPA 2PEMA 1YJ9P 2P9XA 3DS4A 2X83A 3CD6P 3DS0A 2LTEA 2N5HA 1L0IA 3BP9A 1AFVA 3MGEA 1QRJA 1QVFO 4F37A 5HGKA 4U0DA 1T8KA 3P05A 3G71P 3CCEP 2OTJP 1VKUA 1JJ2O 3CMEP 1BXIA 1M90Q 2CG5B 4IPYA 2GDWA 2QNWA 3DTJA 2GDXA 2VLOA 2MR8A 1VQLP 3CC4P 2K94A 4INBA 1EMVA 1A43A 2GDYA 2ERHA 2LF4A 1M6NA 4H2YC 2K93A 2WLVB 2X82A 4UHPB 1S72P 1RO2A 1DNYA 4U0EA 4COCA 3Q20A 3CCLP 2DNWA 1M9YC 1ZMBA 1AK4C 2CGQA 2EG5A 1Q82Q 4XROA 2XXMA 5HGNA 1F80D 4XRQA 3CMAP 5I4TG 3CCJP 5EW5E 1DV5A 3CCUP 3RG2A 2GZEA 5F2NA 1NJIQ 1ZNVA 2WLVA 3LRYA 2JQ4A 1VQOP 2KG9A 1W2BO 2MD9A 2E1MA 2MY5A 3CC7P 3VRLC 2LKIA 2QEXP 1K8AQ 3I55P 1A8OA 4U0AA 2GZIA 2OARA 2LIWA 3GJNA 1M9EC 1HQBA 2OTLP 1GXGA 1M9DC 2M8PA 4DGEC 3CCMP 3OW2O 2K0DX 2KOSA 3E2DA 4B4NA 1E0HA 2JO0A 1MZ8A 2EFJA 2LOLA 3H47A 1VQ7P 2X2DD 1M9XC 4PH3A 1M9FC 1AYIA 1Q86Q 2AFEA 2KGAA 3H4EA 1AUMA 4BPFA 2FQ0A 1G03A 3DPHA 2KOPA 2KGCA 2N6YA 3G4SP 2MVVA 2VSQA 2PENA 2XV6A 2Z44A 3CPWO 5CZDB 1YHQP 2GZGA 2JYLA 4DG9A 1AF8A 2KGEA 3RG6C 1GWPA 3GKLC 3G6EP 1P7NA 4PH1A 5HGLA 2KW2A 3GZMA 2CNRA 4H2WC 4NX4C 4PWVB 7CEIA 1L6NA 2LL8A 2VLQA 2PWOA 2EHTA 2KOQA 1M1KQ 2JYGA 1VQ4P 2L6EA 1D1DA 2PEQA 2CQ8A 1UJZA 1VQ9P 4BPHA 1YJWP 2EHSA 1VQ8P 2K5XA 2DGYA 5HGOA 4HKGA 2KG6A 1NQ4A 2XDEA 1EM9A 4QKOA 1IMPA 4BPGA 2FHSC 2L4BA 2LIUA 5BS2A 1IMQA 3I56P 4U0BA 5KP6B 1N8RQ 1ACPA 1X3OA 2LMLA 2ONTA 1HY8A 4H2XC 2FACA 3EJEA 1BAJA 2KG8A 1Q7YQ 2GONA 4WYMA 2LPKA 1YJNP 1KQSO 4QNBA 3CCQP 2FADA 1EIAA 2PY8A 5BS1A 1VQMP 2FVAA 1VHNA 2XZ1C 2Z46A 3G0VA 2XGVA 1E6JP 1RO0A 1VQKP 2VLNA 2KGFA 1YITP 1L0HA 2FQ2A 3HYBA 5EJDA 2K2QA 2QA4P 1VQ6P 2GYKA 3CC2P 2AF8A 3DS3A 2BUOA 2MF4A 2WPTA 1M9CC 2N5IA 3G29A 3G1GA 2FQ1A 1K9MQ 2XZ0D 1GPJA 5HVCA 2PWMA 2AVAA 2ROQA 3DS2A 2K0YA 5JPAA 2FVFA 4M0IA 2PEIA 2KGDA 5DCKA 3G26A 2JU1A 5HV8A 2JU2A 3G21A 2MR7A 1GXHA 4DGAC 1Z6MA 2M5RA 4COPA 1IUQA 3DS1A 3G28A 3EJDA 4GR6A 2CWOA 2KODA 2KOOA 4HTWA 5HGMA 2KORA 4LQWC 2Y4ZA 1K30A 2XGUA 4XFYA 2V4XA 2L9FA 3H0DA 1Q81Q 4PH2A 2L22A 2N50A 5F2KA 2GOLB 3CCVP 1KD1Q 2FVEA 4PH0A 2PEKA 5KP8B 4U0CA 4XFZA 2NO8A 2M8NA 4E92A 1EOQA 2AFDA 2JB0A 3CCSP 3U43A 2KR5A 2EIAA 2MVUA 2Z45A 2PXRC 4IZ6A 4NEOA 4CA3A 1KC8Q 2XGYA 1QVGO 4R0MA 2K92A 3B4QA 1M74A
chains in the Genus database with same CATH topology
3RG6C 1GWPA 3M1MA 1VQLP 3CC4P 3DS3A 3G1IA 3G6EP 1P7NA 3NTEA 4INBA 1A43A 3B5IA 5HGLA 4PH1A 2BUOA 1M9CC 3G29A 2LF4A 5F2OA 1VQ5P 4XFXA 4E91A 1M6NA 1RNIA 3G1GA 1YIJP 2JPRA 2WLVB 2X82A 1S72P 1K9MQ 4NX4C 1RO2A 2XT1A 4U0EA 1L6NA 4COCA 3Q20A 3CCLP 2PWMA 1M9YC 1ZMBA 4U0FA 1AK4C 3DS2A 2EG5A 5JPAA 2PWOA 4M0IA 1Q82Q 2PEIA 3WBHA 4XROA 2XXMA 1M1KQ 5HGNA 1K73Q 2JYGA 1VQ4P 4XRQA 3CMAP 2L6EA 5DCKA 1D1DA 5I4TG 3CCJP 2PEQA 4GR2A 2M8LA 3G26A 3CXCO 1VQNP 1VQ9P 3CCUP 1YJWP 1VQ8P 1U7KA 2PEJA 2DGYA 3G21A 5HGOA 5F2NA 1NJIQ 1VQPP 4DGAC 3LRYA 2WLVA 4COPA 2XDEA 1IUQA 1VQOP 3DS1A 1EM9A 3G28A 4GR6A 2CWOA 2PEOA 1W2BO 2E1MA 2KODA 3CCRP 3CC7P 3VRLC 4HTWA 4J93A 5HGMA 4LQWC 2QEXP 1K8AQ 5BS2A 3HZQA 3I55P 3DS5A 1A8OA 2Y4ZA 4U0AA 1K30A 3I56P 2XGUA 1YI2P 1M6EX 2OARA 4U0BA 4XFYA 2BHVA 1M9EC 1N8RQ 2PEMA 2OTLP 2V4XA 1YJ9P 2P9XA 2ONTA 1M9DC 3DS4A 2M8PA 2X83A 4DGEC 3H0DA 3CCMP 3OW2O 1BAJA 3E2DA 1Q81Q 4B4NA 2JO0A 1Q7YQ 2GONA 4WYMA 3CD6P 2EFJA 3H47A 3DS0A 1VQ7P 2X2DD 4PH2A 1YJNP 1KQSO 4QNBA 3CCQP 1M9XC 3BP9A 1EIAA 4PH3A 1AFVA 3MGEA 1QRJA 2PY8A 5F2KA 5BS1A 2GOLB 3CCVP 1VQMP 1QVFO 1M9FC 5HGKA 1Q86Q 1KD1Q 3H4EA 4PH0A 4U0DA 1AUMA 2PEKA 3P05A 3G71P 3CCEP 1G03A 3DPHA 2OTJP 4U0CA 4XFZA 2M8NA 2Z46A 2XGVA 1E6JP 4E92A 1EOQA 3G0VA 3CCSP 1RO0A 1JJ2O 1VQKP 3CMEP 2EIAA 2Z45A 2PXRC 1M90Q 2KGFA 3G4SP 4IPYA 1YITP 2PENA 1KC8Q 2XV6A 2Z44A 3DTJA 3CPWO 2XGYA 3HYBA 1YHQP 2JYLA 1QVGO 2QA4P 1VQ6P 1M74A 3CC2P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GWP A;  3DS3 A;  3G1I A;  1P7N A;  3NTE A;  4INB A;  1A43 A;  4PH1 A;  5HGL A;  2BUO A;  1M9C C;  3G29 A;  2LF4 A;  4XFX A;  4E91 A;  3G1G A;  2JPR A;  2WLV B;  2X82 A;  4NX4 C;  2XT1 A;  4U0E A;  1L6N A;  4COC A;  2PWM A;  1M9Y C;  4U0F A;  1AK4 C;  3DS2 A;  5JPA A;  2PWO A;  4M0I A;  4XRO A;  2XXM A;  5HGN A;  2JYG A;  4XRQ A;  2L6E A;  5DCK A;  1D1D A;  5I4T G;  2M8L A;  3G26 A;  1U7K A;  3G21 A;  5HGO A;  4DGA C;  3LRY A;  2WLV A;  4COP A;  2XDE A;  3DS1 A;  1EM9 A;  3G28 A;  2KOD A;  3VRL C;  4HTW A;  4J93 A;  5HGM A;  4LQW C;  3DS5 A;  1A8O A;  2Y4Z A;  4U0A A;  2XGU A;  4U0B A;  4XFY A;  1M9E C;  2V4X A;  2ONT A;  1M9D C;  3DS4 A;  2M8P A;  2X83 A;  4DGE C;  1BAJ A;  4B4N A;  2JO0 A;  2GON A;  4WYM A;  3H47 A;  3DS0 A;  2X2D D;  4PH2 A;  4QNB A;  1M9X C;  3BP9 A;  1EIA A;  4PH3 A;  1AFV A;  3MGE A;  1QRJ A;  2GOL B;  1M9F C;  5HGK A;  3H4E A;  4PH0 A;  4U0D A;  1AUM A;  3P05 A;  1G03 A;  3DPH A;  4U0C A;  4XFZ A;  2M8N A;  3G0V A;  2XGV A;  1E6J P;  4E92 A;  1EOQ A;  2EIA A;  2PXR C;  2KGF A;  4IPY A;  2XV6 A;  3DTJ A;  2XGY A;  2JYL A; 
#chains in the Genus database with same CATH topology
 2GZJ A;  1FR2 A;  3M1M A;  2JGP A;  3G1I A;  3NTE A;  2N6Z A;  4PXH B;  3B5I A;  2GZF A;  5F2O A;  1VQ5 P;  4XFX A;  4E91 A;  1RNI A;  1OR5 A;  1YIJ P;  2JPR A;  5KP7 B;  2XT1 A;  2X2B A;  4U0F A;  1UNK A;  3EJB A;  3CE7 A;  3WBH A;  1K73 Q;  2FAE A;  4GR2 A;  2M8L A;  3CXC O;  1VQN P;  2L0Q A;  2JAZ A;  1U7K A;  2PEJ A;  2K0X A;  1VQP P;  4MRT C;  2KWL A;  2PEO A;  2PNG A;  3CCR P;  1CEI A;  2VLP A;  4J93 A;  2JBG A;  3GZL A;  2N98 A;  3HZQ A;  3DS5 A;  3LMO A;  1YI2 P;  1M6E X;  2BHV A;  3NY7 B;  1KLP A;  2PEM A;  1YJ9 P;  2P9X A;  3DS4 A;  2X83 A;  3CD6 P;  3DS0 A;  2LTE A;  2N5H A;  1L0I A;  3BP9 A;  1AFV A;  3MGE A;  1QRJ A;  1QVF O;  4F37 A;  5HGK A;  4U0D A;  1T8K A;  3P05 A;  3G71 P;  3CCE P;  2OTJ P;  1VKU A;  1JJ2 O;  3CME P;  1BXI A;  1M90 Q;  2CG5 B;  4IPY A;  2GDW A;  2QNW A;  3DTJ A;  2GDX A;  2VLO A;  2MR8 A;  1VQL P;  3CC4 P;  2K94 A;  4INB A;  1EMV A;  1A43 A;  2GDY A;  2ERH A;  2LF4 A;  1M6N A;  4H2Y C;  2K93 A;  2WLV B;  2X82 A;  4UHP B;  1S72 P;  1RO2 A;  1DNY A;  4U0E A;  4COC A;  3Q20 A;  3CCL P;  2DNW A;  1M9Y C;  1ZMB A;  1AK4 C;  2CGQ A;  2EG5 A;  1Q82 Q;  4XRO A;  2XXM A;  5HGN A;  1F80 D;  4XRQ A;  3CMA P;  5I4T G;  3CCJ P;  5EW5 E;  1DV5 A;  3CCU P;  3RG2 A;  2GZE A;  5F2N A;  1NJI Q;  1ZNV A;  2WLV A;  3LRY A;  2JQ4 A;  1VQO P;  2KG9 A;  1W2B O;  2MD9 A;  2E1M A;  2MY5 A;  3CC7 P;  3VRL C;  2LKI A;  2QEX P;  1K8A Q;  3I55 P;  1A8O A;  4U0A A;  2GZI A;  2OAR A;  2LIW A;  3GJN A;  1M9E C;  1HQB A;  2OTL P;  1GXG A;  1M9D C;  2M8P A;  4DGE C;  3CCM P;  3OW2 O;  2K0D X;  2KOS A;  3E2D A;  4B4N A;  1E0H A;  2JO0 A;  1MZ8 A;  2EFJ A;  2LOL A;  3H47 A;  1VQ7 P;  2X2D D;  1M9X C;  4PH3 A;  1M9F C;  1AYI A;  1Q86 Q;  2AFE A;  2KGA A;  3H4E A;  1AUM A;  4BPF A;  2FQ0 A;  1G03 A;  3DPH A;  2KOP A;  2KGC A;  2N6Y A;  3G4S P;  2MVV A;  2VSQ A;  2PEN A;  2XV6 A;  2Z44 A;  3CPW O;  5CZD B;  1YHQ P;  2GZG A;  2JYL A;  4DG9 A;  1AF8 A;  2KGE A;  3RG6 C;  1GWP A;  3GKL C;  3G6E P;  1P7N A;  4PH1 A;  5HGL A;  2KW2 A;  3GZM A;  2CNR A;  4H2W C;  4NX4 C;  4PWV B;  7CEI A;  1L6N A;  2LL8 A;  2VLQ A;  2PWO A;  2EHT A;  2KOQ A;  1M1K Q;  2JYG A;  1VQ4 P;  2L6E A;  1D1D A;  2PEQ A;  2CQ8 A;  1UJZ A;  1VQ9 P;  4BPH A;  1YJW P;  2EHS A;  1VQ8 P;  2K5X A;  2DGY A;  5HGO A;  4HKG A;  2KG6 A;  1NQ4 A;  2XDE A;  1EM9 A;  4QKO A;  1IMP A;  4BPG A;  2FHS C;  2L4B A;  2LIU A;  5BS2 A;  1IMQ A;  3I56 P;  4U0B A;  5KP6 B;  1N8R Q;  1ACP A;  1X3O A;  2LML A;  2ONT A;  1HY8 A;  4H2X C;  2FAC A;  3EJE A;  1BAJ A;  2KG8 A;  1Q7Y Q;  2GON A;  4WYM A;  2LPK A;  1YJN P;  1KQS O;  4QNB A;  3CCQ P;  2FAD A;  1EIA A;  2PY8 A;  5BS1 A;  1VQM P;  2FVA A;  1VHN A;  2XZ1 C;  2Z46 A;  3G0V A;  2XGV A;  1E6J P;  1RO0 A;  1VQK P;  2VLN A;  2KGF A;  1YIT P;  1L0H A;  2FQ2 A;  3HYB A;  5EJD A;  2K2Q A;  2QA4 P;  1VQ6 P;  2GYK A;  3CC2 P;  2AF8 A;  3DS3 A;  2BUO A;  2MF4 A;  2WPT A;  1M9C C;  2N5I A;  3G29 A;  3G1G A;  2FQ1 A;  1K9M Q;  2XZ0 D;  1GPJ A;  5HVC A;  2PWM A;  2AVA A;  2ROQ A;  3DS2 A;  2K0Y A;  5JPA A;  2FVF A;  4M0I A;  2PEI A;  2KGD A;  5DCK A;  3G26 A;  2JU1 A;  5HV8 A;  2JU2 A;  3G21 A;  2MR7 A;  1GXH A;  4DGA C;  1Z6M A;  2M5R A;  4COP A;  1IUQ A;  3DS1 A;  3G28 A;  3EJD A;  4GR6 A;  2CWO A;  2KOD A;  2KOO A;  4HTW A;  5HGM A;  2KOR A;  4LQW C;  2Y4Z A;  1K30 A;  2XGU A;  4XFY A;  2V4X A;  2L9F A;  3H0D A;  1Q81 Q;  4PH2 A;  2L22 A;  2N50 A;  5F2K A;  2GOL B;  3CCV P;  1KD1 Q;  2FVE A;  4PH0 A;  2PEK A;  5KP8 B;  4U0C A;  4XFZ A;  2NO8 A;  2M8N A;  4E92 A;  1EOQ A;  2AFD A;  2JB0 A;  3CCS P;  3U43 A;  2KR5 A;  2EIA A;  2MVU A;  2Z45 A;  2PXR C;  4IZ6 A;  4NEO A;  4CA3 A;  1KC8 Q;  2XGY A;  1QVG O;  4R0M A;  2K92 A;  3B4Q A;  1M74 A; 
#chains in the Genus database with same CATH homology
 3RG6 C;  1GWP A;  3M1M A;  1VQL P;  3CC4 P;  3DS3 A;  3G1I A;  3G6E P;  1P7N A;  3NTE A;  4INB A;  1A43 A;  3B5I A;  5HGL A;  4PH1 A;  2BUO A;  1M9C C;  3G29 A;  2LF4 A;  5F2O A;  1VQ5 P;  4XFX A;  4E91 A;  1M6N A;  1RNI A;  3G1G A;  1YIJ P;  2JPR A;  2WLV B;  2X82 A;  1S72 P;  1K9M Q;  4NX4 C;  1RO2 A;  2XT1 A;  4U0E A;  1L6N A;  4COC A;  3Q20 A;  3CCL P;  2PWM A;  1M9Y C;  1ZMB A;  4U0F A;  1AK4 C;  3DS2 A;  2EG5 A;  5JPA A;  2PWO A;  4M0I A;  1Q82 Q;  2PEI A;  3WBH A;  4XRO A;  2XXM A;  1M1K Q;  5HGN A;  1K73 Q;  2JYG A;  1VQ4 P;  4XRQ A;  3CMA P;  2L6E A;  5DCK A;  1D1D A;  5I4T G;  3CCJ P;  2PEQ A;  4GR2 A;  2M8L A;  3G26 A;  3CXC O;  1VQN P;  1VQ9 P;  3CCU P;  1YJW P;  1VQ8 P;  1U7K A;  2PEJ A;  2DGY A;  3G21 A;  5HGO A;  5F2N A;  1NJI Q;  1VQP P;  4DGA C;  3LRY A;  2WLV A;  4COP A;  2XDE A;  1IUQ A;  1VQO P;  3DS1 A;  1EM9 A;  3G28 A;  4GR6 A;  2CWO A;  2PEO A;  1W2B O;  2E1M A;  2KOD A;  3CCR P;  3CC7 P;  3VRL C;  4HTW A;  4J93 A;  5HGM A;  4LQW C;  2QEX P;  1K8A Q;  5BS2 A;  3HZQ A;  3I55 P;  3DS5 A;  1A8O A;  2Y4Z A;  4U0A A;  1K30 A;  3I56 P;  2XGU A;  1YI2 P;  1M6E X;  2OAR A;  4U0B A;  4XFY A;  2BHV A;  1M9E C;  1N8R Q;  2PEM A;  2OTL P;  2V4X A;  1YJ9 P;  2P9X A;  2ONT A;  1M9D C;  3DS4 A;  2M8P A;  2X83 A;  4DGE C;  3H0D A;  3CCM P;  3OW2 O;  1BAJ A;  3E2D A;  1Q81 Q;  4B4N A;  2JO0 A;  1Q7Y Q;  2GON A;  4WYM A;  3CD6 P;  2EFJ A;  3H47 A;  3DS0 A;  1VQ7 P;  2X2D D;  4PH2 A;  1YJN P;  1KQS O;  4QNB A;  3CCQ P;  1M9X C;  3BP9 A;  1EIA A;  4PH3 A;  1AFV A;  3MGE A;  1QRJ A;  2PY8 A;  5F2K A;  5BS1 A;  2GOL B;  3CCV P;  1VQM P;  1QVF O;  1M9F C;  5HGK A;  1Q86 Q;  1KD1 Q;  3H4E A;  4PH0 A;  4U0D A;  1AUM A;  2PEK A;  3P05 A;  3G71 P;  3CCE P;  1G03 A;  3DPH A;  2OTJ P;  4U0C A;  4XFZ A;  2M8N A;  2Z46 A;  2XGV A;  1E6J P;  4E92 A;  1EOQ A;  3G0V A;  3CCS P;  1RO0 A;  1JJ2 O;  1VQK P;  3CME P;  2EIA A;  2Z45 A;  2PXR C;  1M90 Q;  2KGF A;  3G4S P;  4IPY A;  1YIT P;  2PEN A;  1KC8 Q;  2XV6 A;  2Z44 A;  3DTJ A;  3CPW O;  2XGY A;  3HYB A;  1YHQ P;  2JYL A;  1QVG O;  2QA4 P;  1VQ6 P;  1M74 A;  3CC2 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...