4XFZA

Structure of the native full-length hiv-1 capsid protein in complex with pf-3450074 (pf74)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
221
structure length
213
Chain Sequence
PIVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
total genus 73
structure length 213
sequence length 221
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfzA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfzA02
2KGFA 2EIAA 1M9CC 3H4EA 3DS3A 1P7NA 5HGMA 1BAJA 1EM9A 1M9YC 2GONA 3DS1A 4PH2A 1GWPA 4M0IA 4J93A 3G28A 4HTWA 3DS0A 4COPA 4NX4C 2XGYA 4DGEC 5JPAA 3VRLC 1E6JP 4U0AA 2X83A 4XFYA 4PH0A 2XXMA 1EIAA 2XDEA 4INBA 2Y4ZA 4B4NA 2X2DD 3DPHA 2JO0A 2L6EA 3NTEA 4COCA 2PXRC 2PWMA 2V4XA 4XROA 3G0VA 1AFVA 4E91A 4U0DA 3G1IA 2XGUA 4IPYA 3G21A 1D1DA 2BUOA 1EOQA 4U0BA 1A43A 3G1GA 4U0CA 2JYLA 2XGVA 4XRQA 4PH3A 2XV6A 2M8LA 1AUMA 4E92A 1M9FC 2M8NA 3P05A 2X82A 5I4TG 1QRJA 2WLVB 2PWOA 3MGEA 4U0EA 4XFZA 3DS5A 3DS4A 2LF4A 3H47A 4U0FA 3BP9A 2ONTA 2XT1A 3G26A 1L6NA 2JYGA 2GOLB 3DTJA 5DCKA 5HGKA 4DGAC 1U7KA 1G03A 1M9DC 2KODA 4WYMA 1AK4C 4XFXA 3G29A 3DS2A 1M9XC 5HGOA 1A8OA 4QNBA 3LRYA 2JPRA 1M9EC 4PH1A 5HGLA 2WLVA 5HGNA 2M8PA 4LQWC
chains in the Genus database with same CATH superfamily
2EIAA 3U43A 3CXCO 5HGMA 1GXGA 3GZMA 2EHTA 1Q7YQ 3CC7P 5EW5E 3DS0A 2N6ZA 5JPAA 3VRLC 2FHSC 1GPJA 7CEIA 4XFYA 2JU1A 2Y4ZA 2JAZA 3DPHA 2N6YA 2NO8A 5EJDA 2L6EA 2MR8A 2PWMA 1GXHA 2QNWA 1VQOP 1AFVA 2GZEA 2LTEA 1JJ2O 2CNRA 2DNWA 2JB0A 2JYLA 1VQLP 2XGVA 2GZJA 2XV6A 1S72P 1M9FC 2L22A 3E2DA 1YHQP 5F2OA 3CCQP 1IUQA 2MF4A 2K0XA 2PWOA 1VHNA 4H2YC 2LF4A 1T8KA 3GKLC 3CC2P 2KOQA 3I55P 2ONTA 2FVFA 3G26A 1M90Q 3B4QA 5KP8B 1ACPA 2GOLB 2AFDA 2FQ0A 5DCKA 1DV5A 1VQ5P 2FQ1A 2EG5A 2FVEA 2PENA 2KODA 1AK4C 5CZDB 2KORA 3CCEP 2GDWA 2KGDA 1M9EC 2N5HA 3CD6P 5BS1A 2M8PA 2KGFA 1QVFO 3H4EA 2PEMA 1EM9A 1M9YC 2KR5A 4PH2A 2L9FA 2VSQA 2FQ2A 4COPA 2L4BA 2XGYA 4DGEC 2JU2A 4U0AA 2KWLA 2XXMA 2N5IA 1Q82Q 1VQ9P 2PXRC 2K5XA 1KQSO 3G0VA 2WPTA 2MY5A 4E91A 4H2XC 3G1IA 2P9XA 2XGUA 4IPYA 3G21A 2PY8A 2BUOA 1A43A 2PEIA 3G1GA 3G71P 4XRQA 2PEOA 4PH3A 1AUMA 1YJNP 2X2BA 2PNGA 2MR7A 1OR5A 1UJZA 2WLVB 3MGEA 2KW2A 2VLPA 2N98A 4CA3A 3DS5A 3CCJP 1UNKA 3H47A 4IZ6A 2E1MA 2KGEA 1VQ7P 4U0FA 3WBHA 3BP9A 1L6NA 2Z46A 1VQPP 2EFJA 2MVUA 1ZMBA 5HGKA 1YI2P 3OW2O 3HZQA 1G03A 2XZ0D 2GDXA 2KG8A 4WYMA 1AYIA 2LL8A 4DG9A 4PWVB 2FACA 4UHPB 2KG9A 2K0DX 2WLVA 5HV8A 3CCRP 4LQWC 2CG5B 1M9CC 1VQMP 1K8AQ 3DS3A 2Z45A 2GONA 3DS1A 2GYKA 1HQBA 4HTWA 3GJNA 1NJIQ 3CCLP 1YIJP 2DGYA 4BPFA 1E6JP 2PEKA 3CPWO 1EMVA 1VQKP 1IMQA 1EIAA 4INBA 4BPHA 4B4NA 4NEOA 2X2DD 1QVGO 1KLPA 2JO0A 2JGPA 3NTEA 1Z6MA 4XROA 4F37A 2MVVA 5F2KA 1M74A 1M6NA 3EJEA 2LIWA 3NY7B 1ZNVA 1M6EX 2CWOA 2KG6A 1VQ6P 1DNYA 2M8LA 2N50A 2GDYA 1BXIA 4E92A 2LPKA 2QEXP 1L0IA 4MRTC 3CC4P 2CQ8A 1Q81Q 4QKOA 3P05A 2X82A 1W2BO 1F80D 5I4TG 1X3OA 1Q86Q 4U0EA 2MD9A 2K0YA 2FADA 3M1MA 3H0DA 1VQNP 2OARA 5F2NA 2XT1A 2AFEA 3CMEP 5HVCA 3CCVP 1IMPA 2KOSA 1YJ9P 2M5RA 2EHSA 2VLQA 2PEQA 3EJBA 4HKGA 5KP6B 4XFXA 3G29A 5HGOA 2ROQA 5BS2A 1A8OA 4QNBA 4PH1A 2JPRA 5HGLA 2GZGA 2FAEA 1RNIA 1P7NA 1BAJA 2K94A 3HYBA 1FR2A 1GWPA 4M0IA 4J93A 3G28A 2CGQA 1L0HA 1HY8A 3Q20A 1AF8A 1NQ4A 4NX4C 2LOLA 1RO2A 2PEJA 2Z44A 3I56P 2X83A 3B5IA 2JBGA 2KGCA 4PH0A 2LMLA 2AVAA 2QA4P 4H2WC 2JQ4A 5KP7B 2XDEA 3G4SP 1N8RQ 2OTJP 2FVAA 2OTLP 4COCA 2ERHA 1M1KQ 2V4XA 3CCUP 2LKIA 1VQ8P 2GZFA 4U0DA 2L0QA 1D1DA 3GZLA 1EOQA 2K93A 4U0BA 4U0CA 1E0HA 3RG2A 1KC8Q 2K2QA 3CCMP 1VKUA 1K30A 2XZ1C 3RG6C 4R0MA 3EJDA 2M8NA 4BPGA 2VLOA 1QRJA 1K9MQ 4XFZA 1KD1Q 3DS4A 4GR6A 1YJWP 2KOPA 1K73Q 1VQ4P 2AF8A 1YITP 2JYGA 1MZ8A 2BHVA 3DTJA 3LMOA 2KOOA 2VLNA 4DGAC 1RO0A 2LIUA 1U7KA 1CEIA 1M9DC 4PXHB 2K92A 4GR2A 2KGAA 3DS2A 3CE7A 3G6EP 1M9XC 2GZIA 3LRYA 3CCSP 5HGNA 3CMAP
chains in the Genus database with same CATH topology
2KGFA 1QVFO 2EIAA 1M9CC 1VQMP 3H4EA 1RNIA 1K8AQ 2PEMA 1P7NA 3DS3A 5HGMA 1BAJA 2Z45A 3CXCO 1EM9A 3HYBA 1M9YC 2GONA 1Q7YQ 3DS1A 3CC7P 4PH2A 1GWPA 4M0IA 4J93A 3G28A 4HTWA 3DS0A 4COPA 3Q20A 4NX4C 2XGYA 4DGEC 1NJIQ 3CCLP 1RO2A 1YIJP 5JPAA 2DGYA 3VRLC 1E6JP 2PEJA 2PEKA 2Z44A 4U0AA 3I56P 2X83A 4XFYA 3B5IA 3CPWO 4PH0A 2XXMA 1VQKP 2QA4P 1EIAA 2XDEA 4INBA 2Y4ZA 4B4NA 3G4SP 1N8RQ 2OTJP 1Q82Q 2X2DD 3DPHA 1QVGO 2JO0A 1VQ9P 2OTLP 2L6EA 3NTEA 4COCA 2PXRC 2PWMA 1M1KQ 2V4XA 1KQSO 4XROA 3G0VA 3CCUP 1VQOP 1VQ8P 1AFVA 4E91A 4U0DA 3G1IA 2P9XA 2XGUA 4IPYA 1M74A 5F2KA 1JJ2O 1M6NA 3G21A 1D1DA 2PY8A 2BUOA 1EOQA 4U0BA 1A43A 2PEIA 1M6EX 3G1GA 4U0CA 2CWOA 2JYLA 1VQLP 2XGVA 1VQ6P 3G71P 4XRQA 2PEOA 4PH3A 2XV6A 1S72P 2M8LA 1AUMA 1KC8Q 4E92A 3CCMP 1YJNP 2QEXP 1M9FC 1K30A 3CC4P 3RG6C 1Q81Q 3E2DA 1YHQP 5F2OA 2M8NA 3P05A 3CCQP 2X82A 1W2BO 5I4TG 1IUQA 1QRJA 1Q86Q 2WLVB 2PWOA 3MGEA 4U0EA 1K9MQ 4XFZA 1KD1Q 3DS5A 3DS4A 3CCJP 4GR6A 2LF4A 3H47A 1YJWP 2E1MA 1K73Q 1VQ4P 3CC2P 3M1MA 3H0DA 1VQNP 2OARA 5F2NA 1VQ7P 4U0FA 3WBHA 3I55P 3BP9A 2ONTA 2XT1A 3G26A 1M90Q 1L6NA 1YITP 2JYGA 2Z46A 2BHVA 3CMEP 2GOLB 3DTJA 1VQPP 5DCKA 2EFJA 1ZMBA 5HGKA 1YI2P 4DGAC 1RO0A 3OW2O 1VQ5P 1U7KA 3HZQA 1G03A 2EG5A 3CCVP 2PENA 3CMAP 1M9DC 1YJ9P 2KODA 4WYMA 1AK4C 4GR2A 3CCEP 2PEQA 4XFXA 3G29A 3DS2A 3G6EP 1M9XC 5HGOA 5BS2A 1A8OA 4QNBA 3LRYA 2JPRA 1M9EC 4PH1A 3CCSP 5HGLA 2WLVA 5HGNA 3CCRP 3CD6P 5BS1A 2M8PA 4LQWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KGF A;  2EIA A;  1M9C C;  3H4E A;  3DS3 A;  1P7N A;  5HGM A;  1BAJ A;  1EM9 A;  1M9Y C;  2GON A;  3DS1 A;  4PH2 A;  1GWP A;  4M0I A;  4J93 A;  3G28 A;  4HTW A;  3DS0 A;  4COP A;  4NX4 C;  2XGY A;  4DGE C;  5JPA A;  3VRL C;  1E6J P;  4U0A A;  2X83 A;  4XFY A;  4PH0 A;  2XXM A;  1EIA A;  2XDE A;  4INB A;  2Y4Z A;  4B4N A;  2X2D D;  3DPH A;  2JO0 A;  2L6E A;  3NTE A;  4COC A;  2PXR C;  2PWM A;  2V4X A;  4XRO A;  3G0V A;  1AFV A;  4E91 A;  4U0D A;  3G1I A;  2XGU A;  4IPY A;  3G21 A;  1D1D A;  2BUO A;  1EOQ A;  4U0B A;  1A43 A;  3G1G A;  4U0C A;  2JYL A;  2XGV A;  4XRQ A;  4PH3 A;  2XV6 A;  2M8L A;  1AUM A;  4E92 A;  1M9F C;  2M8N A;  3P05 A;  2X82 A;  5I4T G;  1QRJ A;  2WLV B;  2PWO A;  3MGE A;  4U0E A;  4XFZ A;  3DS5 A;  3DS4 A;  2LF4 A;  3H47 A;  4U0F A;  3BP9 A;  2ONT A;  2XT1 A;  3G26 A;  1L6N A;  2JYG A;  2GOL B;  3DTJ A;  5DCK A;  5HGK A;  4DGA C;  1U7K A;  1G03 A;  1M9D C;  2KOD A;  4WYM A;  1AK4 C;  4XFX A;  3G29 A;  3DS2 A;  1M9X C;  5HGO A;  1A8O A;  4QNB A;  3LRY A;  2JPR A;  1M9E C;  4PH1 A;  5HGL A;  2WLV A;  5HGN A;  2M8P A;  4LQW C; 
#chains in the Genus database with same CATH topology
 2EIA A;  3U43 A;  3CXC O;  5HGM A;  1GXG A;  3GZM A;  2EHT A;  1Q7Y Q;  3CC7 P;  5EW5 E;  3DS0 A;  2N6Z A;  5JPA A;  3VRL C;  2FHS C;  1GPJ A;  7CEI A;  4XFY A;  2JU1 A;  2Y4Z A;  2JAZ A;  3DPH A;  2N6Y A;  2NO8 A;  5EJD A;  2L6E A;  2MR8 A;  2PWM A;  1GXH A;  2QNW A;  1VQO P;  1AFV A;  2GZE A;  2LTE A;  1JJ2 O;  2CNR A;  2DNW A;  2JB0 A;  2JYL A;  1VQL P;  2XGV A;  2GZJ A;  2XV6 A;  1S72 P;  1M9F C;  2L22 A;  3E2D A;  1YHQ P;  5F2O A;  3CCQ P;  1IUQ A;  2MF4 A;  2K0X A;  2PWO A;  1VHN A;  4H2Y C;  2LF4 A;  1T8K A;  3GKL C;  3CC2 P;  2KOQ A;  3I55 P;  2ONT A;  2FVF A;  3G26 A;  1M90 Q;  3B4Q A;  5KP8 B;  1ACP A;  2GOL B;  2AFD A;  2FQ0 A;  5DCK A;  1DV5 A;  1VQ5 P;  2FQ1 A;  2EG5 A;  2FVE A;  2PEN A;  2KOD A;  1AK4 C;  5CZD B;  2KOR A;  3CCE P;  2GDW A;  2KGD A;  1M9E C;  2N5H A;  3CD6 P;  5BS1 A;  2M8P A;  2KGF A;  1QVF O;  3H4E A;  2PEM A;  1EM9 A;  1M9Y C;  2KR5 A;  4PH2 A;  2L9F A;  2VSQ A;  2FQ2 A;  4COP A;  2L4B A;  2XGY A;  4DGE C;  2JU2 A;  4U0A A;  2KWL A;  2XXM A;  2N5I A;  1Q82 Q;  1VQ9 P;  2PXR C;  2K5X A;  1KQS O;  3G0V A;  2WPT A;  2MY5 A;  4E91 A;  4H2X C;  3G1I A;  2P9X A;  2XGU A;  4IPY A;  3G21 A;  2PY8 A;  2BUO A;  1A43 A;  2PEI A;  3G1G A;  3G71 P;  4XRQ A;  2PEO A;  4PH3 A;  1AUM A;  1YJN P;  2X2B A;  2PNG A;  2MR7 A;  1OR5 A;  1UJZ A;  2WLV B;  3MGE A;  2KW2 A;  2VLP A;  2N98 A;  4CA3 A;  3DS5 A;  3CCJ P;  1UNK A;  3H47 A;  4IZ6 A;  2E1M A;  2KGE A;  1VQ7 P;  4U0F A;  3WBH A;  3BP9 A;  1L6N A;  2Z46 A;  1VQP P;  2EFJ A;  2MVU A;  1ZMB A;  5HGK A;  1YI2 P;  3OW2 O;  3HZQ A;  1G03 A;  2XZ0 D;  2GDX A;  2KG8 A;  4WYM A;  1AYI A;  2LL8 A;  4DG9 A;  4PWV B;  2FAC A;  4UHP B;  2KG9 A;  2K0D X;  2WLV A;  5HV8 A;  3CCR P;  4LQW C;  2CG5 B;  1M9C C;  1VQM P;  1K8A Q;  3DS3 A;  2Z45 A;  2GON A;  3DS1 A;  2GYK A;  1HQB A;  4HTW A;  3GJN A;  1NJI Q;  3CCL P;  1YIJ P;  2DGY A;  4BPF A;  1E6J P;  2PEK A;  3CPW O;  1EMV A;  1VQK P;  1IMQ A;  1EIA A;  4INB A;  4BPH A;  4B4N A;  4NEO A;  2X2D D;  1QVG O;  1KLP A;  2JO0 A;  2JGP A;  3NTE A;  1Z6M A;  4XRO A;  4F37 A;  2MVV A;  5F2K A;  1M74 A;  1M6N A;  3EJE A;  2LIW A;  3NY7 B;  1ZNV A;  1M6E X;  2CWO A;  2KG6 A;  1VQ6 P;  1DNY A;  2M8L A;  2N50 A;  2GDY A;  1BXI A;  4E92 A;  2LPK A;  2QEX P;  1L0I A;  4MRT C;  3CC4 P;  2CQ8 A;  1Q81 Q;  4QKO A;  3P05 A;  2X82 A;  1W2B O;  1F80 D;  5I4T G;  1X3O A;  1Q86 Q;  4U0E A;  2MD9 A;  2K0Y A;  2FAD A;  3M1M A;  3H0D A;  1VQN P;  2OAR A;  5F2N A;  2XT1 A;  2AFE A;  3CME P;  5HVC A;  3CCV P;  1IMP A;  2KOS A;  1YJ9 P;  2M5R A;  2EHS A;  2VLQ A;  2PEQ A;  3EJB A;  4HKG A;  5KP6 B;  4XFX A;  3G29 A;  5HGO A;  2ROQ A;  5BS2 A;  1A8O A;  4QNB A;  4PH1 A;  2JPR A;  5HGL A;  2GZG A;  2FAE A;  1RNI A;  1P7N A;  1BAJ A;  2K94 A;  3HYB A;  1FR2 A;  1GWP A;  4M0I A;  4J93 A;  3G28 A;  2CGQ A;  1L0H A;  1HY8 A;  3Q20 A;  1AF8 A;  1NQ4 A;  4NX4 C;  2LOL A;  1RO2 A;  2PEJ A;  2Z44 A;  3I56 P;  2X83 A;  3B5I A;  2JBG A;  2KGC A;  4PH0 A;  2LML A;  2AVA A;  2QA4 P;  4H2W C;  2JQ4 A;  5KP7 B;  2XDE A;  3G4S P;  1N8R Q;  2OTJ P;  2FVA A;  2OTL P;  4COC A;  2ERH A;  1M1K Q;  2V4X A;  3CCU P;  2LKI A;  1VQ8 P;  2GZF A;  4U0D A;  2L0Q A;  1D1D A;  3GZL A;  1EOQ A;  2K93 A;  4U0B A;  4U0C A;  1E0H A;  3RG2 A;  1KC8 Q;  2K2Q A;  3CCM P;  1VKU A;  1K30 A;  2XZ1 C;  3RG6 C;  4R0M A;  3EJD A;  2M8N A;  4BPG A;  2VLO A;  1QRJ A;  1K9M Q;  4XFZ A;  1KD1 Q;  3DS4 A;  4GR6 A;  1YJW P;  2KOP A;  1K73 Q;  1VQ4 P;  2AF8 A;  1YIT P;  2JYG A;  1MZ8 A;  2BHV A;  3DTJ A;  3LMO A;  2KOO A;  2VLN A;  4DGA C;  1RO0 A;  2LIU A;  1U7K A;  1CEI A;  1M9D C;  4PXH B;  2K92 A;  4GR2 A;  2KGA A;  3DS2 A;  3CE7 A;  3G6E P;  1M9X C;  2GZI A;  3LRY A;  3CCS P;  5HGN A;  3CMA P; 
#chains in the Genus database with same CATH homology
 2KGF A;  1QVF O;  2EIA A;  1M9C C;  1VQM P;  3H4E A;  1RNI A;  1K8A Q;  2PEM A;  1P7N A;  3DS3 A;  5HGM A;  1BAJ A;  2Z45 A;  3CXC O;  1EM9 A;  3HYB A;  1M9Y C;  2GON A;  1Q7Y Q;  3DS1 A;  3CC7 P;  4PH2 A;  1GWP A;  4M0I A;  4J93 A;  3G28 A;  4HTW A;  3DS0 A;  4COP A;  3Q20 A;  4NX4 C;  2XGY A;  4DGE C;  1NJI Q;  3CCL P;  1RO2 A;  1YIJ P;  5JPA A;  2DGY A;  3VRL C;  1E6J P;  2PEJ A;  2PEK A;  2Z44 A;  4U0A A;  3I56 P;  2X83 A;  4XFY A;  3B5I A;  3CPW O;  4PH0 A;  2XXM A;  1VQK P;  2QA4 P;  1EIA A;  2XDE A;  4INB A;  2Y4Z A;  4B4N A;  3G4S P;  1N8R Q;  2OTJ P;  1Q82 Q;  2X2D D;  3DPH A;  1QVG O;  2JO0 A;  1VQ9 P;  2OTL P;  2L6E A;  3NTE A;  4COC A;  2PXR C;  2PWM A;  1M1K Q;  2V4X A;  1KQS O;  4XRO A;  3G0V A;  3CCU P;  1VQO P;  1VQ8 P;  1AFV A;  4E91 A;  4U0D A;  3G1I A;  2P9X A;  2XGU A;  4IPY A;  1M74 A;  5F2K A;  1JJ2 O;  1M6N A;  3G21 A;  1D1D A;  2PY8 A;  2BUO A;  1EOQ A;  4U0B A;  1A43 A;  2PEI A;  1M6E X;  3G1G A;  4U0C A;  2CWO A;  2JYL A;  1VQL P;  2XGV A;  1VQ6 P;  3G71 P;  4XRQ A;  2PEO A;  4PH3 A;  2XV6 A;  1S72 P;  2M8L A;  1AUM A;  1KC8 Q;  4E92 A;  3CCM P;  1YJN P;  2QEX P;  1M9F C;  1K30 A;  3CC4 P;  3RG6 C;  1Q81 Q;  3E2D A;  1YHQ P;  5F2O A;  2M8N A;  3P05 A;  3CCQ P;  2X82 A;  1W2B O;  5I4T G;  1IUQ A;  1QRJ A;  1Q86 Q;  2WLV B;  2PWO A;  3MGE A;  4U0E A;  1K9M Q;  4XFZ A;  1KD1 Q;  3DS5 A;  3DS4 A;  3CCJ P;  4GR6 A;  2LF4 A;  3H47 A;  1YJW P;  2E1M A;  1K73 Q;  1VQ4 P;  3CC2 P;  3M1M A;  3H0D A;  1VQN P;  2OAR A;  5F2N A;  1VQ7 P;  4U0F A;  3WBH A;  3I55 P;  3BP9 A;  2ONT A;  2XT1 A;  3G26 A;  1M90 Q;  1L6N A;  1YIT P;  2JYG A;  2Z46 A;  2BHV A;  3CME P;  2GOL B;  3DTJ A;  1VQP P;  5DCK A;  2EFJ A;  1ZMB A;  5HGK A;  1YI2 P;  4DGA C;  1RO0 A;  3OW2 O;  1VQ5 P;  1U7K A;  3HZQ A;  1G03 A;  2EG5 A;  3CCV P;  2PEN A;  3CMA P;  1M9D C;  1YJ9 P;  2KOD A;  4WYM A;  1AK4 C;  4GR2 A;  3CCE P;  2PEQ A;  4XFX A;  3G29 A;  3DS2 A;  3G6E P;  1M9X C;  5HGO A;  5BS2 A;  1A8O A;  4QNB A;  3LRY A;  2JPR A;  1M9E C;  4PH1 A;  3CCS P;  5HGL A;  2WLV A;  5HGN A;  3CCR P;  3CD6 P;  5BS1 A;  2M8P A;  4LQW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...