4XFZA

Structure of the native full-length hiv-1 capsid protein in complex with pf-3450074 (pf74)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
221
structure length
213
Chain Sequence
PIVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title STRUCTURAL VIROLOGY. X-ray crystal structures of native HIV-1 capsid protein reveal conformational variability.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b (isolate ny5)
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
total genus 73
structure length 213
sequence length 221
ec nomenclature
pdb deposition date 2014-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xfzA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xfzA02
1AFVA 1EM9A 4E91A 4XROA 2ONTA 1P7NA 2LF4A 1L6NA 2PWOA 4PH0A 3DS0A 1M9CC 2KODA 3G1IA 2GOLB 1M9EC 3VRLC 4LQWC 5DCKA 1AK4C 2WLVB 4PH1A 4IPYA 4U0AA 3DS3A 2L6EA 1BAJA 2PXRC 4COCA 3DPHA 4M0IA 1M9FC 1GWPA 1E6JP 4DGAC 2M8NA 5HGNA 2XGUA 2JPRA 3MGEA 1EOQA 2XGVA 3G29A 2GONA 5HGMA 4HTWA 3G21A 1M9DC 3G28A 3NTEA 3G1GA 2XDEA 4COPA 1A43A 4XRQA 3DTJA 1AUMA 2EIAA 4XFYA 4XFZA 2JO0A 4NX4C 3G26A 4PH2A 1A8OA 2Y4ZA 4U0FA 3G0VA 3LRYA 5HGLA 2BUOA 4U0DA 2XT1A 3DS2A 2V4XA 4DGEC 4XFXA 2M8LA 5HGOA 1D1DA 2X82A 1M9YC 3DS5A 2X2DD 4J93A 2WLVA 3BP9A 4B4NA 2XGYA 2XXMA 4U0CA 2JYLA 5HGKA 1U7KA 1EIAA 2M8PA 3DS1A 4U0EA 4E92A 3P05A 4U0BA 2XV6A 5I4TG 5JPAA 4QNBA 1G03A 1QRJA 3DS4A 2JYGA 2PWMA 3H47A 4INBA 2KGFA 4PH3A 1M9XC 4WYMA 2X83A 3H4EA
chains in the Genus database with same CATH superfamily
2MVUA 4GR2A 1AFVA 2L4BA 2PWOA 2KG9A 3CCRP 2CQ8A 2KGAA 2K92A 2GOLB 2N5HA 1VQ6P 2LKIA 2LOLA 2PEQA 1W2BO 4HKGA 5CZDB 4M0IA 1M9FC 1QVGO 3RG2A 2Z44A 2M8NA 2M5RA 2XGUA 2XZ1C 3B4QA 3CXCO 2KG6A 2JQ4A 1EOQA 1NJIQ 3GJNA 1YITP 2KOPA 2LMLA 1F80D 4PXHB 2KOOA 2XDEA 4COPA 3Q20A 1M90Q 4F37A 4XFYA 1EMVA 2Y4ZA 1M74A 3G4SP 3CCEP 4U0FA 3G0VA 2BUOA 2K93A 2KGDA 1KLPA 2V4XA 2AFDA 1YJWP 2AFEA 3GZMA 2X82A 1M9YC 5KP6B 2K94A 5F2OA 4J93A 1T8KA 1IMPA 1CEIA 3CCJP 2FVEA 2VLNA 2PEKA 4U0CA 1Q86Q 5EW5E 2GZJA 1GXGA 1Z6MA 5HGKA 1AYIA 2JGPA 1EIAA 2N6YA 2M8PA 3OW2O 2XV6A 2VLOA 1G03A 1YIJP 1QRJA 2VSQA 1HQBA 1MZ8A 2PWMA 2KGFA 4PH3A 2CGQA 3CE7A 1EM9A 4E91A 2P9XA 1P7NA 4GR6A 4PH0A 2EG5A 3DS0A 2KODA 1M6NA 1N8RQ 2NO8A 4PH1A 1IMQA 1UJZA 3G6EP 4H2WC 1VQKP 5HGNA 2JU1A 2BHVA 2DGYA 2LTEA 1L0HA 2FVFA 3G29A 2MR7A 3G21A 1M9DC 3NTEA 5BS2A 3G1GA 4QKOA 4XRQA 5F2KA 2PEMA 2EIAA 2KG8A 4NX4C 5EJDA 1K73Q 3H0DA 4U0DA 2XT1A 1DNYA 4DGEC 2FAEA 2M8LA 5HGOA 2FHSC 1GXHA 4IZ6A 2GZGA 2N98A 2JAZA 3RG6C 4B4NA 2XGYA 2MD9A 3HYBA 2FQ0A 1U7KA 1ZNVA 1JJ2O 4H2XC 2GZEA 4U0EA 1Q82Q 1YHQP 2N50A 7CEIA 5JPAA 3EJEA 1NQ4A 1VQ8P 1M9XC 2L22A 3GZLA 4WYMA 4CA3A 3U43A 4R0MA 3HZQA 3H4EA 5HV8A 2MY5A 2LIUA 2GZIA 3G71P 1M9EC 2KW2A 4LQWC 1L0IA 2JU2A 4IPYA 2KGEA 3DS3A 2PXRC 1E0HA 2MF4A 1VQMP 1GWPA 1E6JP 4DGAC 2JPRA 4UHPB 1GPJA 2L0QA 3CC7P 2XGVA 2AVAA 2K0XA 2PEIA 2JB0A 2PEOA 5F2NA 2PEJA 2KOQA 1BXIA 3EJDA 2GDYA 1AUMA 3EJBA 4XFZA 2KWLA 2FQ2A 1A8OA 4MRTC 4BPGA 2ROQA 2KGCA 5HGLA 2FQ1A 1VQOP 3CD6P 2FADA 1VKUA 2LIWA 3DS2A 1VQ7P 1K9MQ 2KOSA 2N5IA 2ERHA 2PY8A 4XFXA 2FVAA 3CMEP 1AF8A 1FR2A 2PNGA 2MR8A 2X2DD 2JBGA 3CCSP 1M1KQ 2CWOA 2GYKA 2K5XA 3M1MA 1VQ4P 1QVFO 4NEOA 2VLPA 1UNKA 2XXMA 3CC2P 3CCLP 4BPHA 1RNIA 2FACA 2EHTA 1S72P 5BS1A 1X3OA 5KP7B 1VQNP 3E2DA 2AF8A 2X2BA 1YJNP 3CCUP 4E92A 2LPKA 2OARA 2PENA 3P05A 4U0BA 3CMAP 5I4TG 2EFJA 2K0YA 2E1MA 1Q7YQ 4INBA 4PWVB 2X83A 1K30A 2KR5A 1KQSO 2GZFA 2EHSA 4XROA 2ONTA 2LF4A 1L6NA 1YI2P 2GDXA 1M9CC 3G1IA 3VRLC 1K8AQ 5DCKA 1AK4C 2WLVB 4U0AA 1ZMBA 2L6EA 3GKLC 1IUQA 1BAJA 2LL8A 2VLQA 4COCA 3DPHA 3CPWO 1ACPA 3B5IA 3I56P 1VQ5P 3MGEA 1VQPP 4DG9A 2CNRA 3WBHA 3LMOA 2GONA 2Z45A 2QNWA 2CG5B 5HGMA 2KORA 4HTWA 3NY7B 3G28A 2N6ZA 1VQLP 1VQ9P 5KP8B 2OTLP 1A43A 3DTJA 3I55P 2JO0A 2K0DX 3CCQP 3G26A 5HVCA 4PH2A 1RO0A 1OR5A 4BPFA 1KC8Q 3LRYA 2L9FA 1DV5A 3CC4P 1HY8A 2GDWA 1D1DA 2QEXP 3CCMP 2QA4P 3DS5A 1YJ9P 2OTJP 2K2QA 2WLVA 3BP9A 1VHNA 3CCVP 1RO2A 2DNWA 2WPTA 2JYLA 2MVVA 1M6EX 1KD1Q 3DS1A 4H2YC 4QNBA 2Z46A 3DS4A 1Q81Q 2JYGA 2XZ0D 3H47A
chains in the Genus database with same CATH topology
1K30A 1KQSO 4GR2A 1AFVA 1EM9A 4E91A 2P9XA 4XROA 2ONTA 1P7NA 2LF4A 1L6NA 1YI2P 4GR6A 2PWOA 4PH0A 2EG5A 3CCRP 3DS0A 1M9CC 2KODA 3G1IA 2GOLB 1M6NA 1M9EC 3VRLC 3G71P 1K8AQ 4LQWC 5DCKA 1VQ6P 1N8RQ 1AK4C 2WLVB 4PH1A 4IPYA 4U0AA 3DS3A 1ZMBA 2L6EA 1IUQA 1BAJA 2PEQA 2PXRC 4COCA 1W2BO 3G6EP 3DPHA 4M0IA 1M9FC 1VQMP 3CPWO 1GWPA 1QVGO 1E6JP 4DGAC 3B5IA 2Z44A 2M8NA 1VQKP 5HGNA 3I56P 2XGUA 1VQ5P 2JPRA 3MGEA 2BHVA 1VQPP 2DGYA 3CXCO 1EOQA 1NJIQ 3CC7P 2XGVA 3G29A 3WBHA 2GONA 2Z45A 1YITP 5HGMA 2PEIA 4HTWA 3G21A 1M9DC 2PEOA 3G28A 5F2NA 3NTEA 2PEJA 3G1GA 2XDEA 4COPA 5BS2A 1VQLP 1VQ9P 2OTLP 1A43A 4XRQA 3Q20A 3DTJA 1M90Q 5F2KA 1AUMA 2EIAA 4XFYA 2PEMA 4XFZA 3I55P 2JO0A 1K73Q 4NX4C 3CCQP 3H0DA 3G26A 4PH2A 1RO0A 1A8OA 2Y4ZA 1M74A 3G4SP 3CCEP 1KC8Q 4U0FA 3G0VA 3LRYA 5HGLA 2BUOA 1VQOP 4U0DA 3CD6P 3CC4P 2XT1A 3DS2A 1VQ7P 1K9MQ 2V4XA 4DGEC 2PY8A 1YJWP 4XFXA 2M8LA 5HGOA 1D1DA 3CMEP 2QEXP 3CCMP 2X82A 2QA4P 1M9YC 3DS5A 1YJ9P 2OTJP 2X2DD 5F2OA 4J93A 3RG6C 3CCSP 1M1KQ 2CWOA 2WLVA 3M1MA 1VQ4P 1QVFO 3BP9A 3CCJP 4B4NA 3CCVP 2XGYA 1RO2A 2XXMA 2PEKA 3CC2P 3CCLP 4U0CA 3HYBA 2JYLA 1Q86Q 1RNIA 5HGKA 1S72P 1M6EX 5BS1A 1VQNP 1U7KA 3E2DA 1YJNP 1EIAA 2M8PA 1KD1Q 1JJ2O 3DS1A 4U0EA 4E92A 3CCUP 1YHQP 2OARA 2PENA 1Q82Q 3P05A 4U0BA 2XV6A 3OW2O 3CMAP 5I4TG 5JPAA 2EFJA 4QNBA 1G03A 2Z46A 3HZQA 1YIJP 1QRJA 3DS4A 2E1MA 1Q81Q 2JYGA 2PWMA 1Q7YQ 3H47A 4INBA 2KGFA 4PH3A 1VQ8P 1M9XC 4WYMA 2X83A 3H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFV A;  1EM9 A;  4E91 A;  4XRO A;  2ONT A;  1P7N A;  2LF4 A;  1L6N A;  2PWO A;  4PH0 A;  3DS0 A;  1M9C C;  2KOD A;  3G1I A;  2GOL B;  1M9E C;  3VRL C;  4LQW C;  5DCK A;  1AK4 C;  2WLV B;  4PH1 A;  4IPY A;  4U0A A;  3DS3 A;  2L6E A;  1BAJ A;  2PXR C;  4COC A;  3DPH A;  4M0I A;  1M9F C;  1GWP A;  1E6J P;  4DGA C;  2M8N A;  5HGN A;  2XGU A;  2JPR A;  3MGE A;  1EOQ A;  2XGV A;  3G29 A;  2GON A;  5HGM A;  4HTW A;  3G21 A;  1M9D C;  3G28 A;  3NTE A;  3G1G A;  2XDE A;  4COP A;  1A43 A;  4XRQ A;  3DTJ A;  1AUM A;  2EIA A;  4XFY A;  4XFZ A;  2JO0 A;  4NX4 C;  3G26 A;  4PH2 A;  1A8O A;  2Y4Z A;  4U0F A;  3G0V A;  3LRY A;  5HGL A;  2BUO A;  4U0D A;  2XT1 A;  3DS2 A;  2V4X A;  4DGE C;  4XFX A;  2M8L A;  5HGO A;  1D1D A;  2X82 A;  1M9Y C;  3DS5 A;  2X2D D;  4J93 A;  2WLV A;  3BP9 A;  4B4N A;  2XGY A;  2XXM A;  4U0C A;  2JYL A;  5HGK A;  1U7K A;  1EIA A;  2M8P A;  3DS1 A;  4U0E A;  4E92 A;  3P05 A;  4U0B A;  2XV6 A;  5I4T G;  5JPA A;  4QNB A;  1G03 A;  1QRJ A;  3DS4 A;  2JYG A;  2PWM A;  3H47 A;  4INB A;  2KGF A;  4PH3 A;  1M9X C;  4WYM A;  2X83 A;  3H4E A; 
#chains in the Genus database with same CATH topology
 2MVU A;  4GR2 A;  1AFV A;  2L4B A;  2PWO A;  2KG9 A;  3CCR P;  2CQ8 A;  2KGA A;  2K92 A;  2GOL B;  2N5H A;  1VQ6 P;  2LKI A;  2LOL A;  2PEQ A;  1W2B O;  4HKG A;  5CZD B;  4M0I A;  1M9F C;  1QVG O;  3RG2 A;  2Z44 A;  2M8N A;  2M5R A;  2XGU A;  2XZ1 C;  3B4Q A;  3CXC O;  2KG6 A;  2JQ4 A;  1EOQ A;  1NJI Q;  3GJN A;  1YIT P;  2KOP A;  2LML A;  1F80 D;  4PXH B;  2KOO A;  2XDE A;  4COP A;  3Q20 A;  1M90 Q;  4F37 A;  4XFY A;  1EMV A;  2Y4Z A;  1M74 A;  3G4S P;  3CCE P;  4U0F A;  3G0V A;  2BUO A;  2K93 A;  2KGD A;  1KLP A;  2V4X A;  2AFD A;  1YJW P;  2AFE A;  3GZM A;  2X82 A;  1M9Y C;  5KP6 B;  2K94 A;  5F2O A;  4J93 A;  1T8K A;  1IMP A;  1CEI A;  3CCJ P;  2FVE A;  2VLN A;  2PEK A;  4U0C A;  1Q86 Q;  5EW5 E;  2GZJ A;  1GXG A;  1Z6M A;  5HGK A;  1AYI A;  2JGP A;  1EIA A;  2N6Y A;  2M8P A;  3OW2 O;  2XV6 A;  2VLO A;  1G03 A;  1YIJ P;  1QRJ A;  2VSQ A;  1HQB A;  1MZ8 A;  2PWM A;  2KGF A;  4PH3 A;  2CGQ A;  3CE7 A;  1EM9 A;  4E91 A;  2P9X A;  1P7N A;  4GR6 A;  4PH0 A;  2EG5 A;  3DS0 A;  2KOD A;  1M6N A;  1N8R Q;  2NO8 A;  4PH1 A;  1IMQ A;  1UJZ A;  3G6E P;  4H2W C;  1VQK P;  5HGN A;  2JU1 A;  2BHV A;  2DGY A;  2LTE A;  1L0H A;  2FVF A;  3G29 A;  2MR7 A;  3G21 A;  1M9D C;  3NTE A;  5BS2 A;  3G1G A;  4QKO A;  4XRQ A;  5F2K A;  2PEM A;  2EIA A;  2KG8 A;  4NX4 C;  5EJD A;  1K73 Q;  3H0D A;  4U0D A;  2XT1 A;  1DNY A;  4DGE C;  2FAE A;  2M8L A;  5HGO A;  2FHS C;  1GXH A;  4IZ6 A;  2GZG A;  2N98 A;  2JAZ A;  3RG6 C;  4B4N A;  2XGY A;  2MD9 A;  3HYB A;  2FQ0 A;  1U7K A;  1ZNV A;  1JJ2 O;  4H2X C;  2GZE A;  4U0E A;  1Q82 Q;  1YHQ P;  2N50 A;  7CEI A;  5JPA A;  3EJE A;  1NQ4 A;  1VQ8 P;  1M9X C;  2L22 A;  3GZL A;  4WYM A;  4CA3 A;  3U43 A;  4R0M A;  3HZQ A;  3H4E A;  5HV8 A;  2MY5 A;  2LIU A;  2GZI A;  3G71 P;  1M9E C;  2KW2 A;  4LQW C;  1L0I A;  2JU2 A;  4IPY A;  2KGE A;  3DS3 A;  2PXR C;  1E0H A;  2MF4 A;  1VQM P;  1GWP A;  1E6J P;  4DGA C;  2JPR A;  4UHP B;  1GPJ A;  2L0Q A;  3CC7 P;  2XGV A;  2AVA A;  2K0X A;  2PEI A;  2JB0 A;  2PEO A;  5F2N A;  2PEJ A;  2KOQ A;  1BXI A;  3EJD A;  2GDY A;  1AUM A;  3EJB A;  4XFZ A;  2KWL A;  2FQ2 A;  1A8O A;  4MRT C;  4BPG A;  2ROQ A;  2KGC A;  5HGL A;  2FQ1 A;  1VQO P;  3CD6 P;  2FAD A;  1VKU A;  2LIW A;  3DS2 A;  1VQ7 P;  1K9M Q;  2KOS A;  2N5I A;  2ERH A;  2PY8 A;  4XFX A;  2FVA A;  3CME P;  1AF8 A;  1FR2 A;  2PNG A;  2MR8 A;  2X2D D;  2JBG A;  3CCS P;  1M1K Q;  2CWO A;  2GYK A;  2K5X A;  3M1M A;  1VQ4 P;  1QVF O;  4NEO A;  2VLP A;  1UNK A;  2XXM A;  3CC2 P;  3CCL P;  4BPH A;  1RNI A;  2FAC A;  2EHT A;  1S72 P;  5BS1 A;  1X3O A;  5KP7 B;  1VQN P;  3E2D A;  2AF8 A;  2X2B A;  1YJN P;  3CCU P;  4E92 A;  2LPK A;  2OAR A;  2PEN A;  3P05 A;  4U0B A;  3CMA P;  5I4T G;  2EFJ A;  2K0Y A;  2E1M A;  1Q7Y Q;  4INB A;  4PWV B;  2X83 A;  1K30 A;  2KR5 A;  1KQS O;  2GZF A;  2EHS A;  4XRO A;  2ONT A;  2LF4 A;  1L6N A;  1YI2 P;  2GDX A;  1M9C C;  3G1I A;  3VRL C;  1K8A Q;  5DCK A;  1AK4 C;  2WLV B;  4U0A A;  1ZMB A;  2L6E A;  3GKL C;  1IUQ A;  1BAJ A;  2LL8 A;  2VLQ A;  4COC A;  3DPH A;  3CPW O;  1ACP A;  3B5I A;  3I56 P;  1VQ5 P;  3MGE A;  1VQP P;  4DG9 A;  2CNR A;  3WBH A;  3LMO A;  2GON A;  2Z45 A;  2QNW A;  2CG5 B;  5HGM A;  2KOR A;  4HTW A;  3NY7 B;  3G28 A;  2N6Z A;  1VQL P;  1VQ9 P;  5KP8 B;  2OTL P;  1A43 A;  3DTJ A;  3I55 P;  2JO0 A;  2K0D X;  3CCQ P;  3G26 A;  5HVC A;  4PH2 A;  1RO0 A;  1OR5 A;  4BPF A;  1KC8 Q;  3LRY A;  2L9F A;  1DV5 A;  3CC4 P;  1HY8 A;  2GDW A;  1D1D A;  2QEX P;  3CCM P;  2QA4 P;  3DS5 A;  1YJ9 P;  2OTJ P;  2K2Q A;  2WLV A;  3BP9 A;  1VHN A;  3CCV P;  1RO2 A;  2DNW A;  2WPT A;  2JYL A;  2MVV A;  1M6E X;  1KD1 Q;  3DS1 A;  4H2Y C;  4QNB A;  2Z46 A;  3DS4 A;  1Q81 Q;  2JYG A;  2XZ0 D;  3H47 A; 
#chains in the Genus database with same CATH homology
 1K30 A;  1KQS O;  4GR2 A;  1AFV A;  1EM9 A;  4E91 A;  2P9X A;  4XRO A;  2ONT A;  1P7N A;  2LF4 A;  1L6N A;  1YI2 P;  4GR6 A;  2PWO A;  4PH0 A;  2EG5 A;  3CCR P;  3DS0 A;  1M9C C;  2KOD A;  3G1I A;  2GOL B;  1M6N A;  1M9E C;  3VRL C;  3G71 P;  1K8A Q;  4LQW C;  5DCK A;  1VQ6 P;  1N8R Q;  1AK4 C;  2WLV B;  4PH1 A;  4IPY A;  4U0A A;  3DS3 A;  1ZMB A;  2L6E A;  1IUQ A;  1BAJ A;  2PEQ A;  2PXR C;  4COC A;  1W2B O;  3G6E P;  3DPH A;  4M0I A;  1M9F C;  1VQM P;  3CPW O;  1GWP A;  1QVG O;  1E6J P;  4DGA C;  3B5I A;  2Z44 A;  2M8N A;  1VQK P;  5HGN A;  3I56 P;  2XGU A;  1VQ5 P;  2JPR A;  3MGE A;  2BHV A;  1VQP P;  2DGY A;  3CXC O;  1EOQ A;  1NJI Q;  3CC7 P;  2XGV A;  3G29 A;  3WBH A;  2GON A;  2Z45 A;  1YIT P;  5HGM A;  2PEI A;  4HTW A;  3G21 A;  1M9D C;  2PEO A;  3G28 A;  5F2N A;  3NTE A;  2PEJ A;  3G1G A;  2XDE A;  4COP A;  5BS2 A;  1VQL P;  1VQ9 P;  2OTL P;  1A43 A;  4XRQ A;  3Q20 A;  3DTJ A;  1M90 Q;  5F2K A;  1AUM A;  2EIA A;  4XFY A;  2PEM A;  4XFZ A;  3I55 P;  2JO0 A;  1K73 Q;  4NX4 C;  3CCQ P;  3H0D A;  3G26 A;  4PH2 A;  1RO0 A;  1A8O A;  2Y4Z A;  1M74 A;  3G4S P;  3CCE P;  1KC8 Q;  4U0F A;  3G0V A;  3LRY A;  5HGL A;  2BUO A;  1VQO P;  4U0D A;  3CD6 P;  3CC4 P;  2XT1 A;  3DS2 A;  1VQ7 P;  1K9M Q;  2V4X A;  4DGE C;  2PY8 A;  1YJW P;  4XFX A;  2M8L A;  5HGO A;  1D1D A;  3CME P;  2QEX P;  3CCM P;  2X82 A;  2QA4 P;  1M9Y C;  3DS5 A;  1YJ9 P;  2OTJ P;  2X2D D;  5F2O A;  4J93 A;  3RG6 C;  3CCS P;  1M1K Q;  2CWO A;  2WLV A;  3M1M A;  1VQ4 P;  1QVF O;  3BP9 A;  3CCJ P;  4B4N A;  3CCV P;  2XGY A;  1RO2 A;  2XXM A;  2PEK A;  3CC2 P;  3CCL P;  4U0C A;  3HYB A;  2JYL A;  1Q86 Q;  1RNI A;  5HGK A;  1S72 P;  1M6E X;  5BS1 A;  1VQN P;  1U7K A;  3E2D A;  1YJN P;  1EIA A;  2M8P A;  1KD1 Q;  1JJ2 O;  3DS1 A;  4U0E A;  4E92 A;  3CCU P;  1YHQ P;  2OAR A;  2PEN A;  1Q82 Q;  3P05 A;  4U0B A;  2XV6 A;  3OW2 O;  3CMA P;  5I4T G;  5JPA A;  2EFJ A;  4QNB A;  1G03 A;  2Z46 A;  3HZQ A;  1YIJ P;  1QRJ A;  3DS4 A;  2E1M A;  1Q81 Q;  2JYG A;  2PWM A;  1Q7Y Q;  3H47 A;  4INB A;  2KGF A;  4PH3 A;  1VQ8 P;  1M9X C;  4WYM A;  2X83 A;  3H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...