3P05A

X-ray structure of pentameric hiv-1 ca
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
210
Chain Sequence
PIHQAISPRTLCCWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 CA
publication title Atomic-level modelling of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 78
structure length 210
sequence length 219
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3p05A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3p05A02
2PWMA 2WLVB 4U0AA 1EOQA 2GONA 2X2DD 2GOLB 1M9FC 2XV6A 1M9XC 2XXMA 5HGKA 2LF4A 3DS3A 4U0DA 2KODA 3DS4A 1EM9A 4COPA 4U0FA 1QRJA 4PH3A 3DS1A 2V4XA 1G03A 2X82A 2XT1A 4U0EA 2PWOA 4IPYA 2BUOA 3MGEA 3P05A 3DS2A 3NTEA 3G1GA 1M9CC 2M8LA 5JPAA 4U0CA 4E91A 2PXRC 2XGVA 4PH1A 4DGEC 2X83A 4E92A 1M9EC 1E6JP 2Y4ZA 4B4NA 2L6EA 2WLVA 3LRYA 5DCKA 2ONTA 2EIAA 4INBA 1EIAA 3G28A 4LQWC 1P7NA 2KGFA 5HGMA 2XDEA 5HGLA 5I4TG 2XGYA 1M9YC 4HTWA 4WYMA 4COCA 1AFVA 4M0IA 3G29A 3H47A 3H4EA 4J93A 4QNBA 4PH2A 4XRQA 4U0BA 2JPRA 4NX4C 3DPHA 3DS5A 5HGOA 1D1DA 3G26A 2JYLA 4PH0A 4DGAC 2JYGA 3G1IA 1U7KA 3BP9A 4XFXA 4XROA 1AUMA 4XFYA 3VRLC 1A43A 1L6NA 1GWPA 2XGUA 1A8OA 3G21A 3DTJA 1BAJA 1AK4C 3DS0A 1M9DC 2M8PA 2M8NA 5HGNA 3G0VA 4XFZA 2JO0A
chains in the Genus database with same CATH superfamily
2PWMA 2EG5A 1EOQA 2GONA 1VQ5P 1KQSO 2XV6A 2QA4P 1DNYA 1VQ7P 2GDWA 4U0DA 1VQOP 2GZGA 2MVUA 1OR5A 2OARA 3OW2O 3DS4A 3CC7P 1EM9A 4COPA 2PEKA 4PH3A 1G03A 2FQ2A 2X82A 4U0EA 4DG9A 2PEQA 4H2WC 2OTLP 1YIJP 2M8LA 1ACPA 4MRTC 1VQNP 4DGEC 1M9EC 3LRYA 2EIAA 1HQBA 2PY8A 4BPFA 4LQWC 1M74A 1P7NA 5HGMA 1RO0A 5HGLA 2L4BA 2XZ1C 2PEJA 4WYMA 4BPHA 3CMEP 2FACA 4M0IA 1VQPP 1QVGO 3H47A 5F2OA 3G6EP 2EHSA 2KORA 2PENA 3CD6P 4IZ6A 1L0HA 2FAEA 3DPHA 4F37A 2GZIA 2QEXP 1ZMBA 5BS1A 2KOOA 4PH0A 2MVVA 2FQ1A 2M5RA 3HYBA 1NQ4A 1VHNA 3GKLC 4XFXA 1X3OA 4XFYA 1Q86Q 1A43A 2CQ8A 2JAZA 2KOPA 1VQ6P 2KG9A 2XGUA 2JU2A 3DTJA 2Z44A 2LIWA 1K73Q 2M8NA 4XFZA 2Z46A 2LKIA 2PEOA 2LTEA 2MF4A 2X2DD 1M9FC 2LOLA 2VLQA 2EHTA 3GJNA 4UHPB 2FVFA 1GXHA 3RG6C 3DS3A 2Z45A 2L0QA 2DGYA 2VLOA 3CE7A 4U0FA 1AF8A 3DS1A 2GZJA 2CNRA 2XT1A 1KD1Q 1BXIA 2LMLA 3P05A 2FVAA 1RNIA 2K5XA 3G1GA 5JPAA 4E91A 4E92A 2L6EA 2WLVA 2JBGA 4QKOA 2JB0A 5EJDA 2KR5A 1EIAA 2KGFA 2LL8A 5I4TG 2AFEA 1N8RQ 1M90Q 1M9YC 2MY5A 1Z6MA 2KWLA 3G71P 3CC2P 4QNBA 5F2KA 3U43A 4U0BA 2JPRA 3B4QA 2K2QA 1JJ2O 4NX4C 3I56P 5EW5E 1MZ8A 3HZQA 2JYLA 1VQLP 2FADA 2K92A 3G1IA 2GZFA 3BP9A 3H0DA 4XROA 1AUMA 2KGDA 2JU1A 1T8KA 2N5IA 2AFDA 1A8OA 3B5IA 3Q20A 3CCEP 3G0VA 5HGNA 2FHSC 2KGCA 2K93A 2WLVB 4U0AA 1VQ9P 2VLNA 2PEIA 2E1MA 1M9XC 2JGPA 2LF4A 2PNGA 1RO2A 3G4SP 1YHQP 1Q81Q 2K0XA 4CA3A 4GR2A 3I55P 2V4XA 1KLPA 1K8AQ 3MGEA 5KP7B 3DS2A 1F80D 3EJDA 1M9CC 1VQKP 1UJZA 2XGVA 2FQ0A 2X2BA 2X83A 3M1MA 2Y4ZA 5DCKA 1YI2P 3CCMP 1VQ4P 2N6YA 2N5HA 2GDXA 1IUQA 1K9MQ 2EFJA 5HV8A 1ZNVA 2XDEA 3CCSP 2XGYA 2NO8A 1NJIQ 2AVAA 4HTWA 2ROQA 5F2NA 1AFVA 1UNKA 2CWOA 4XRQA 2GYKA 1IMPA 2KOSA 1Q7YQ 3G26A 2K0DX 2L22A 2VSQA 3CCVP 2CG5B 2GZEA 2JYGA 1U7KA 3CCJP 2DNWA 2P9XA 2LIUA 3CPWO 1L6NA 2KW2A 1S72P 1GWPA 1GPJA 2LPKA 3LMOA 4HKGA 3CCRP 1M9DC 3NY7B 5KP8B 4H2XC 1K30A 2KOQA 2K0YA 2MR8A 3CC4P 2GOLB 4GR6A 1DV5A 1VQMP 1IMQA 2N98A 2XXMA 1VQ8P 5HGKA 4NEOA 3EJBA 2AF8A 3GZMA 1M1KQ 3CXCO 1E0HA 2KODA 1YJWP 1EMVA 3RG2A 1QRJA 5HVCA 2QNWA 4H2YC 2L9FA 2PWOA 2PEMA 2JQ4A 3CMAP 4IPYA 2BUOA 4PXHB 2ERHA 2KGEA 3NTEA 3CCUP 2MR7A 1YJNP 4U0CA 2OTJP 4PH1A 2PXRC 1E6JP 4B4NA 3WBHA 2ONTA 2N50A 4INBA 3CCQP 3G28A 1FR2A 4R0MA 3E2DA 7CEIA 3CCLP 3EJEA 4COCA 2FVEA 2KG6A 3G29A 3H4EA 4J93A 1VKUA 1CEIA 2MD9A 2GDYA 4PH2A 2KGAA 2N6ZA 3DS5A 5HGOA 1D1DA 1M6NA 1KC8Q 1Q82Q 4DGAC 2K94A 1AYIA 1GXGA 1YJ9P 1YITP 4PWVB 3VRLC 1M6EX 2BHVA 3GZLA 5KP6B 2KG8A 1QVFO 2XZ0D 2VLPA 3G21A 1BAJA 1AK4C 2CGQA 4BPGA 5BS2A 3DS0A 1W2BO 2WPTA 1L0IA 2M8PA 1HY8A 5CZDB 2JO0A
chains in the Genus database with same CATH topology
2PWMA 2WLVB 2EG5A 4U0AA 1EOQA 1K30A 1VQ9P 2GONA 3CC4P 2X2DD 2GOLB 1M9FC 2PEIA 4GR6A 2E1MA 2XV6A 1VQ5P 1KQSO 1VQMP 1M9XC 1VQ8P 2XXMA 5HGKA 2LF4A 1VQ7P 1RO2A 3RG6C 3DS3A 3G4SP 4U0DA 1YHQP 1Q81Q 1M1KQ 2Z45A 3CXCO 3OW2O 2OARA 1VQOP 2KODA 3DS4A 3CC7P 1YJWP 1EM9A 2DGYA 4COPA 2PEKA 4U0FA 4GR2A 3I55P 1QRJA 4PH3A 3DS1A 2V4XA 1G03A 2X82A 2XT1A 4U0EA 1K8AQ 2PWOA 1KD1Q 2PEMA 3CMAP 4IPYA 2BUOA 2PEQA 3MGEA 3P05A 3DS2A 1RNIA 3NTEA 3G1GA 1M9CC 3CCUP 1VQKP 2OTLP 1YIJP 2M8LA 1YJNP 5JPAA 4U0CA 4E91A 2PXRC 2XGVA 4PH1A 1VQNP 4DGEC 2X83A 4E92A 3M1MA 1M9EC 1E6JP 2Y4ZA 4B4NA 2L6EA 2WLVA 3WBHA 3LRYA 5DCKA 2ONTA 1YI2P 2EIAA 3CCMP 2PY8A 1VQ4P 4INBA 3CCQP 1EIAA 1IUQA 4LQWC 2EFJA 1M74A 3G28A 1P7NA 2KGFA 5HGMA 1K9MQ 3E2DA 2XDEA 1RO0A 3CCSP 5HGLA 5I4TG 2XGYA 1N8RQ 1M90Q 1NJIQ 1M9YC 3CCLP 4HTWA 2PEJA 4WYMA 4COCA 5F2NA 3CMEP 1AFVA 4M0IA 1VQPP 1QVGO 3G71P 3G29A 3H47A 3H4EA 3CC2P 2CWOA 4J93A 2PENA 5F2OA 3G6EP 4QNBA 3CD6P 4PH2A 5F2KA 4XRQA 4U0BA 2JPRA 1JJ2O 4NX4C 3I56P 3DPHA 3DS5A 5HGOA 1D1DA 1Q7YQ 3HZQA 2QEXP 3G26A 1ZMBA 5BS1A 1M6NA 2JYLA 3CCVP 4PH0A 1KC8Q 1Q82Q 1VQLP 3HYBA 4DGAC 2JYGA 3G1IA 1YJ9P 1U7KA 3CCJP 3BP9A 4XFXA 1YITP 3H0DA 4XROA 1AUMA 4XFYA 1Q86Q 3VRLC 1A43A 2P9XA 1M6EX 2BHVA 3CPWO 1QVFO 1VQ6P 1L6NA 1S72P 1GWPA 2XGUA 1A8OA 3B5IA 3G21A 3DTJA 3Q20A 1BAJA 1AK4C 5BS2A 2Z44A 3DS0A 1W2BO 3CCRP 2OTJP 1M9DC 3CCEP 2M8PA 1K73Q 2M8NA 5HGNA 3G0VA 4XFZA 2Z46A 2PEOA 2QA4P 2JO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PWM A;  2WLV B;  4U0A A;  1EOQ A;  2GON A;  2X2D D;  2GOL B;  1M9F C;  2XV6 A;  1M9X C;  2XXM A;  5HGK A;  2LF4 A;  3DS3 A;  4U0D A;  2KOD A;  3DS4 A;  1EM9 A;  4COP A;  4U0F A;  1QRJ A;  4PH3 A;  3DS1 A;  2V4X A;  1G03 A;  2X82 A;  2XT1 A;  4U0E A;  2PWO A;  4IPY A;  2BUO A;  3MGE A;  3P05 A;  3DS2 A;  3NTE A;  3G1G A;  1M9C C;  2M8L A;  5JPA A;  4U0C A;  4E91 A;  2PXR C;  2XGV A;  4PH1 A;  4DGE C;  2X83 A;  4E92 A;  1M9E C;  1E6J P;  2Y4Z A;  4B4N A;  2L6E A;  2WLV A;  3LRY A;  5DCK A;  2ONT A;  2EIA A;  4INB A;  1EIA A;  3G28 A;  4LQW C;  1P7N A;  2KGF A;  5HGM A;  2XDE A;  5HGL A;  5I4T G;  2XGY A;  1M9Y C;  4HTW A;  4WYM A;  4COC A;  1AFV A;  4M0I A;  3G29 A;  3H47 A;  3H4E A;  4J93 A;  4QNB A;  4PH2 A;  4XRQ A;  4U0B A;  2JPR A;  4NX4 C;  3DPH A;  3DS5 A;  5HGO A;  1D1D A;  3G26 A;  2JYL A;  4PH0 A;  4DGA C;  2JYG A;  3G1I A;  1U7K A;  3BP9 A;  4XFX A;  4XRO A;  1AUM A;  4XFY A;  3VRL C;  1A43 A;  1L6N A;  1GWP A;  2XGU A;  1A8O A;  3G21 A;  3DTJ A;  1BAJ A;  1AK4 C;  3DS0 A;  1M9D C;  2M8P A;  2M8N A;  5HGN A;  3G0V A;  4XFZ A;  2JO0 A; 
#chains in the Genus database with same CATH topology
 2PWM A;  2EG5 A;  1EOQ A;  2GON A;  1VQ5 P;  1KQS O;  2XV6 A;  2QA4 P;  1DNY A;  1VQ7 P;  2GDW A;  4U0D A;  1VQO P;  2GZG A;  2MVU A;  1OR5 A;  2OAR A;  3OW2 O;  3DS4 A;  3CC7 P;  1EM9 A;  4COP A;  2PEK A;  4PH3 A;  1G03 A;  2FQ2 A;  2X82 A;  4U0E A;  4DG9 A;  2PEQ A;  4H2W C;  2OTL P;  1YIJ P;  2M8L A;  1ACP A;  4MRT C;  1VQN P;  4DGE C;  1M9E C;  3LRY A;  2EIA A;  1HQB A;  2PY8 A;  4BPF A;  4LQW C;  1M74 A;  1P7N A;  5HGM A;  1RO0 A;  5HGL A;  2L4B A;  2XZ1 C;  2PEJ A;  4WYM A;  4BPH A;  3CME P;  2FAC A;  4M0I A;  1VQP P;  1QVG O;  3H47 A;  5F2O A;  3G6E P;  2EHS A;  2KOR A;  2PEN A;  3CD6 P;  4IZ6 A;  1L0H A;  2FAE A;  3DPH A;  4F37 A;  2GZI A;  2QEX P;  1ZMB A;  5BS1 A;  2KOO A;  4PH0 A;  2MVV A;  2FQ1 A;  2M5R A;  3HYB A;  1NQ4 A;  1VHN A;  3GKL C;  4XFX A;  1X3O A;  4XFY A;  1Q86 Q;  1A43 A;  2CQ8 A;  2JAZ A;  2KOP A;  1VQ6 P;  2KG9 A;  2XGU A;  2JU2 A;  3DTJ A;  2Z44 A;  2LIW A;  1K73 Q;  2M8N A;  4XFZ A;  2Z46 A;  2LKI A;  2PEO A;  2LTE A;  2MF4 A;  2X2D D;  1M9F C;  2LOL A;  2VLQ A;  2EHT A;  3GJN A;  4UHP B;  2FVF A;  1GXH A;  3RG6 C;  3DS3 A;  2Z45 A;  2L0Q A;  2DGY A;  2VLO A;  3CE7 A;  4U0F A;  1AF8 A;  3DS1 A;  2GZJ A;  2CNR A;  2XT1 A;  1KD1 Q;  1BXI A;  2LML A;  3P05 A;  2FVA A;  1RNI A;  2K5X A;  3G1G A;  5JPA A;  4E91 A;  4E92 A;  2L6E A;  2WLV A;  2JBG A;  4QKO A;  2JB0 A;  5EJD A;  2KR5 A;  1EIA A;  2KGF A;  2LL8 A;  5I4T G;  2AFE A;  1N8R Q;  1M90 Q;  1M9Y C;  2MY5 A;  1Z6M A;  2KWL A;  3G71 P;  3CC2 P;  4QNB A;  5F2K A;  3U43 A;  4U0B A;  2JPR A;  3B4Q A;  2K2Q A;  1JJ2 O;  4NX4 C;  3I56 P;  5EW5 E;  1MZ8 A;  3HZQ A;  2JYL A;  1VQL P;  2FAD A;  2K92 A;  3G1I A;  2GZF A;  3BP9 A;  3H0D A;  4XRO A;  1AUM A;  2KGD A;  2JU1 A;  1T8K A;  2N5I A;  2AFD A;  1A8O A;  3B5I A;  3Q20 A;  3CCE P;  3G0V A;  5HGN A;  2FHS C;  2KGC A;  2K93 A;  2WLV B;  4U0A A;  1VQ9 P;  2VLN A;  2PEI A;  2E1M A;  1M9X C;  2JGP A;  2LF4 A;  2PNG A;  1RO2 A;  3G4S P;  1YHQ P;  1Q81 Q;  2K0X A;  4CA3 A;  4GR2 A;  3I55 P;  2V4X A;  1KLP A;  1K8A Q;  3MGE A;  5KP7 B;  3DS2 A;  1F80 D;  3EJD A;  1M9C C;  1VQK P;  1UJZ A;  2XGV A;  2FQ0 A;  2X2B A;  2X83 A;  3M1M A;  2Y4Z A;  5DCK A;  1YI2 P;  3CCM P;  1VQ4 P;  2N6Y A;  2N5H A;  2GDX A;  1IUQ A;  1K9M Q;  2EFJ A;  5HV8 A;  1ZNV A;  2XDE A;  3CCS P;  2XGY A;  2NO8 A;  1NJI Q;  2AVA A;  4HTW A;  2ROQ A;  5F2N A;  1AFV A;  1UNK A;  2CWO A;  4XRQ A;  2GYK A;  1IMP A;  2KOS A;  1Q7Y Q;  3G26 A;  2K0D X;  2L22 A;  2VSQ A;  3CCV P;  2CG5 B;  2GZE A;  2JYG A;  1U7K A;  3CCJ P;  2DNW A;  2P9X A;  2LIU A;  3CPW O;  1L6N A;  2KW2 A;  1S72 P;  1GWP A;  1GPJ A;  2LPK A;  3LMO A;  4HKG A;  3CCR P;  1M9D C;  3NY7 B;  5KP8 B;  4H2X C;  1K30 A;  2KOQ A;  2K0Y A;  2MR8 A;  3CC4 P;  2GOL B;  4GR6 A;  1DV5 A;  1VQM P;  1IMQ A;  2N98 A;  2XXM A;  1VQ8 P;  5HGK A;  4NEO A;  3EJB A;  2AF8 A;  3GZM A;  1M1K Q;  3CXC O;  1E0H A;  2KOD A;  1YJW P;  1EMV A;  3RG2 A;  1QRJ A;  5HVC A;  2QNW A;  4H2Y C;  2L9F A;  2PWO A;  2PEM A;  2JQ4 A;  3CMA P;  4IPY A;  2BUO A;  4PXH B;  2ERH A;  2KGE A;  3NTE A;  3CCU P;  2MR7 A;  1YJN P;  4U0C A;  2OTJ P;  4PH1 A;  2PXR C;  1E6J P;  4B4N A;  3WBH A;  2ONT A;  2N50 A;  4INB A;  3CCQ P;  3G28 A;  1FR2 A;  4R0M A;  3E2D A;  7CEI A;  3CCL P;  3EJE A;  4COC A;  2FVE A;  2KG6 A;  3G29 A;  3H4E A;  4J93 A;  1VKU A;  1CEI A;  2MD9 A;  2GDY A;  4PH2 A;  2KGA A;  2N6Z A;  3DS5 A;  5HGO A;  1D1D A;  1M6N A;  1KC8 Q;  1Q82 Q;  4DGA C;  2K94 A;  1AYI A;  1GXG A;  1YJ9 P;  1YIT P;  4PWV B;  3VRL C;  1M6E X;  2BHV A;  3GZL A;  5KP6 B;  2KG8 A;  1QVF O;  2XZ0 D;  2VLP A;  3G21 A;  1BAJ A;  1AK4 C;  2CGQ A;  4BPG A;  5BS2 A;  3DS0 A;  1W2B O;  2WPT A;  1L0I A;  2M8P A;  1HY8 A;  5CZD B;  2JO0 A; 
#chains in the Genus database with same CATH homology
 2PWM A;  2WLV B;  2EG5 A;  4U0A A;  1EOQ A;  1K30 A;  1VQ9 P;  2GON A;  3CC4 P;  2X2D D;  2GOL B;  1M9F C;  2PEI A;  4GR6 A;  2E1M A;  2XV6 A;  1VQ5 P;  1KQS O;  1VQM P;  1M9X C;  1VQ8 P;  2XXM A;  5HGK A;  2LF4 A;  1VQ7 P;  1RO2 A;  3RG6 C;  3DS3 A;  3G4S P;  4U0D A;  1YHQ P;  1Q81 Q;  1M1K Q;  2Z45 A;  3CXC O;  3OW2 O;  2OAR A;  1VQO P;  2KOD A;  3DS4 A;  3CC7 P;  1YJW P;  1EM9 A;  2DGY A;  4COP A;  2PEK A;  4U0F A;  4GR2 A;  3I55 P;  1QRJ A;  4PH3 A;  3DS1 A;  2V4X A;  1G03 A;  2X82 A;  2XT1 A;  4U0E A;  1K8A Q;  2PWO A;  1KD1 Q;  2PEM A;  3CMA P;  4IPY A;  2BUO A;  2PEQ A;  3MGE A;  3P05 A;  3DS2 A;  1RNI A;  3NTE A;  3G1G A;  1M9C C;  3CCU P;  1VQK P;  2OTL P;  1YIJ P;  2M8L A;  1YJN P;  5JPA A;  4U0C A;  4E91 A;  2PXR C;  2XGV A;  4PH1 A;  1VQN P;  4DGE C;  2X83 A;  4E92 A;  3M1M A;  1M9E C;  1E6J P;  2Y4Z A;  4B4N A;  2L6E A;  2WLV A;  3WBH A;  3LRY A;  5DCK A;  2ONT A;  1YI2 P;  2EIA A;  3CCM P;  2PY8 A;  1VQ4 P;  4INB A;  3CCQ P;  1EIA A;  1IUQ A;  4LQW C;  2EFJ A;  1M74 A;  3G28 A;  1P7N A;  2KGF A;  5HGM A;  1K9M Q;  3E2D A;  2XDE A;  1RO0 A;  3CCS P;  5HGL A;  5I4T G;  2XGY A;  1N8R Q;  1M90 Q;  1NJI Q;  1M9Y C;  3CCL P;  4HTW A;  2PEJ A;  4WYM A;  4COC A;  5F2N A;  3CME P;  1AFV A;  4M0I A;  1VQP P;  1QVG O;  3G71 P;  3G29 A;  3H47 A;  3H4E A;  3CC2 P;  2CWO A;  4J93 A;  2PEN A;  5F2O A;  3G6E P;  4QNB A;  3CD6 P;  4PH2 A;  5F2K A;  4XRQ A;  4U0B A;  2JPR A;  1JJ2 O;  4NX4 C;  3I56 P;  3DPH A;  3DS5 A;  5HGO A;  1D1D A;  1Q7Y Q;  3HZQ A;  2QEX P;  3G26 A;  1ZMB A;  5BS1 A;  1M6N A;  2JYL A;  3CCV P;  4PH0 A;  1KC8 Q;  1Q82 Q;  1VQL P;  3HYB A;  4DGA C;  2JYG A;  3G1I A;  1YJ9 P;  1U7K A;  3CCJ P;  3BP9 A;  4XFX A;  1YIT P;  3H0D A;  4XRO A;  1AUM A;  4XFY A;  1Q86 Q;  3VRL C;  1A43 A;  2P9X A;  1M6E X;  2BHV A;  3CPW O;  1QVF O;  1VQ6 P;  1L6N A;  1S72 P;  1GWP A;  2XGU A;  1A8O A;  3B5I A;  3G21 A;  3DTJ A;  3Q20 A;  1BAJ A;  1AK4 C;  5BS2 A;  2Z44 A;  3DS0 A;  1W2B O;  3CCR P;  2OTJ P;  1M9D C;  3CCE P;  2M8P A;  1K73 Q;  2M8N A;  5HGN A;  3G0V A;  4XFZ A;  2Z46 A;  2PEO A;  2QA4 P;  2JO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...