3P05A

X-ray structure of pentameric hiv-1 ca
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
210
Chain Sequence
PIHQAISPRTLCCWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic-level modelling of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 CA
total genus 78
structure length 210
sequence length 219
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3p05A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3p05A02
1EM9A 4XROA 4IPYA 5HGMA 4PH3A 5I4TG 4PH1A 4COPA 4NX4C 2XGUA 4DGEC 2X82A 2LF4A 3VRLC 2GONA 1M9YC 3DS3A 1M9EC 2JO0A 2L6EA 1QRJA 1D1DA 1L6NA 1M9DC 3MGEA 1M9FC 3H4EA 2X2DD 2PXRC 2JYLA 2M8PA 4HTWA 1A43A 4COCA 3DTJA 3DS1A 3G21A 4DGAC 3LRYA 4XFYA 4U0DA 4U0FA 4INBA 5DCKA 2JPRA 4U0CA 2XDEA 2KODA 4M0IA 2M8NA 1U7KA 1G03A 3G29A 5JPAA 3G26A 2EIAA 3DS0A 2PWMA 4PH2A 4LQWC 2XGVA 2Y4ZA 4XRQA 1M9CC 2X83A 2WLVA 4XFXA 4U0BA 2GOLB 2PWOA 4U0EA 2BUOA 4QNBA 4U0AA 4E92A 3DPHA 2KGFA 3DS4A 3G1GA 5HGNA 2V4XA 2M8LA 4E91A 1A8OA 2ONTA 2XV6A 1BAJA 2XT1A 4WYMA 1EOQA 3DS2A 3G1IA 3G0VA 4J93A 1M9XC 2XGYA 3NTEA 3G28A 1P7NA 1EIAA 2WLVB 4XFZA 1AFVA 1GWPA 3P05A 5HGLA 1E6JP 1AK4C 2XXMA 3BP9A 4PH0A 5HGKA 5HGOA 3DS5A 1AUMA 4B4NA 2JYGA 3H47A
chains in the Genus database with same CATH superfamily
2XZ1C 3EJBA 5EW5E 2FQ2A 2EFJA 2K0XA 1VKUA 2MY5A 3CD6P 4IPYA 2X2BA 2MD9A 3CXCO 3VRLC 3RG2A 2LIUA 3DS3A 2KGEA 2JO0A 3CC4P 1QRJA 2GYKA 2MR7A 1M9FC 2LTEA 2CG5B 2X2DD 4CA3A 1AF8A 2N6ZA 1A43A 2FAEA 2PY8A 3G21A 2N50A 4DGAC 4U0FA 2CGQA 2XDEA 2KODA 1AYIA 1QVGO 5JPAA 3CPWO 3DS0A 3GJNA 2KGCA 2XGVA 1VQ5P 1L0IA 3HZQA 1S72P 1YI2P 3E2DA 3CCLP 2VLOA 2PEIA 2BHVA 4BPGA 4U0EA 5F2KA 3I56P 4HKGA 2N5HA 3CCRP 2OTLP 2K0YA 2Z44A 3WBHA 2M5RA 3RG6C 1CEIA 2QEXP 1GXHA 1Q7YQ 3CCEP 2JAZA 4WYMA 2KOPA 1VQ4P 1KC8Q 3DS2A 4UHPB 3G1IA 1M9XC 4MRTC 2AFEA 1EIAA 2GZEA 4NEOA 1M6NA 2L0QA 1K30A 2PEKA 2EHSA 5F2NA 2P9XA 3G71P 3EJDA 2JYGA 1EM9A 2LKIA 1M90Q 4PH3A 3LMOA 5I4TG 2EG5A 2XGUA 4QKOA 1IMPA 2KORA 1GPJA 2MF4A 2KR5A 1M9YC 1M9EC 3GKLC 1D1DA 1M9DC 3MGEA 2LL8A 2MVVA 2GDXA 1Q82Q 2JYLA 3DTJA 1NQ4A 2PEQA 4XFYA 1MZ8A 4INBA 4U0CA 4H2XC 1G03A 2CNRA 2PWMA 1RO2A 2VLQA 4F37A 4PXHB 3GZLA 2Y4ZA 4XRQA 2X83A 2WLVA 4U0BA 3CCVP 2GZJA 2N98A 3CCQP 2PWOA 2OTJP 3CC2P 2BUOA 4QNBA 3CMAP 2LOLA 3G1GA 5F2OA 5HGNA 1IUQA 2V4XA 2AVAA 2M8LA 4R0MA 1T8KA 5KP6B 1EMVA 3H0DA 1A8OA 2ONTA 1KQSO 1M74A 1KD1Q 2KGAA 2XT1A 1EOQA 3G0VA 1ZMBA 3CCJP 2KOQA 2CWOA 1P7NA 2MVUA 2KGDA 2PNGA 1VQMP 2WLVB 2K92A 3U43A 5EJDA 2CQ8A 2VSQA 2GDWA 1UJZA 1Q81Q 5BS1A 2PEMA 1AK4C 2XXMA 3BP9A 4PH0A 4H2YC 1OR5A 5HGOA 1KLPA 1AUMA 2EHTA 1YHQP 2KG8A 2DNWA 2KW2A 4XROA 2GZIA 5HVCA 7CEIA 4PH1A 4NX4C 2K93A 4DGEC 1DNYA 1IMQA 2LF4A 2GONA 1L6NA 2FVAA 1BXIA 2L9FA 1VQ7P 2PXRC 4COCA 2K0DX 3DS1A 2KG6A 3LRYA 4BPHA 2JPRA 2PEOA 1K73Q 2JQ4A 4M0IA 4GR2A 2LMLA 1N8RQ 2Z45A 1JJ2O 2L22A 4PH2A 3HYBA 1HQBA 2KG9A 1M9CC 2JU1A 4XFXA 5CZDB 2GZGA 2GOLB 2FVFA 3Q20A 1UNKA 4E92A 1RO0A 3CCMP 3CMEP 2KGFA 2MR8A 2N5IA 2FADA 3CE7A 3B5IA 1NJIQ 2GZFA 2XV6A 4PWVB 3CC7P 1YJ9P 1M1KQ 4J93A 2XGYA 1VQ6P 2ROQA 3NTEA 1Q86Q 3G28A 1HY8A 1ZNVA 4XFZA 1K8AQ 1VHNA 1K9MQ 2Z46A 2KOSA 2GDYA 1AFVA 1VQKP 1E6JP 2FHSC 1VQPP 1RNIA 5HGKA 1QVFO 4B4NA 1YITP 3H47A 3I55P 5HGMA 1DV5A 4COPA 2JB0A 2FQ1A 2N6YA 2KWLA 4GR6A 2X82A 4H2WC 2VLPA 1ACPA 2QNWA 2JBGA 2NO8A 1VQNP 2L6EA 2VLNA 2XZ0D 3H4EA 3G4SP 1YJWP 2M8PA 4HTWA 2K2QA 1VQLP 1X3OA 3EJEA 1VQ8P 2K5XA 2LIWA 4U0DA 3GZMA 5DCKA 2JU2A 2M8NA 1U7KA 2OARA 3G29A 3G26A 2JGPA 2EIAA 1M6EX 3CCSP 2PENA 4LQWC 2FVEA 3CCUP 1YJNP 2ERHA 2E1MA 1YIJP 1VQ9P 1FR2A 2L4BA 2AF8A 4U0AA 3DPHA 1VQOP 1F80D 3DS4A 1Z6MA 3M1MA 2AFDA 5BS2A 4E91A 1E0HA 3NY7B 1BAJA 1L0HA 2LPKA 4BPFA 1W2BO 2K94A 2KOOA 5HV8A 3OW2O 2QA4P 1GWPA 5KP8B 3P05A 2FQ0A 5HGLA 2FACA 2DGYA 3G6EP 4DG9A 1GXGA 3B4QA 2PEJA 2WPTA 3DS5A 4IZ6A 5KP7B
chains in the Genus database with same CATH topology
1EM9A 4XROA 2EFJA 3I55P 3CD6P 4IPYA 5HGMA 1M90Q 4PH3A 5I4TG 2EG5A 4PH1A 4COPA 4NX4C 2XGUA 4DGEC 4GR6A 3CXCO 2X82A 2LF4A 3VRLC 2GONA 1M9YC 3DS3A 1VQNP 1M9EC 2JO0A 2L6EA 3CC4P 1QRJA 1D1DA 1L6NA 1M9DC 3MGEA 1M9FC 3H4EA 3G4SP 1YJWP 1VQ7P 2X2DD 2PXRC 1Q82Q 2JYLA 2M8PA 4HTWA 1A43A 4COCA 2PY8A 3DTJA 1VQLP 3DS1A 3G21A 4DGAC 1VQ8P 3LRYA 2PEQA 4XFYA 4U0DA 4U0FA 4INBA 5DCKA 2JPRA 2PEOA 4U0CA 2XDEA 1K73Q 2KODA 4M0IA 2M8NA 1U7KA 4GR2A 1G03A 2OARA 3G29A 5JPAA 3G26A 3CPWO 1QVGO 1N8RQ 2EIAA 2Z45A 1JJ2O 3DS0A 2PWMA 1M6EX 4PH2A 1RO2A 3CCSP 2PENA 3HYBA 4LQWC 2XGVA 2Y4ZA 1VQ5P 4XRQA 1M9CC 2X83A 3HZQA 2WLVA 4XFXA 3CCUP 1YI2P 1S72P 3E2DA 1YJNP 4U0BA 3CCVP 2E1MA 1YIJP 3CCLP 2GOLB 3CCQP 2PWOA 2PEIA 3Q20A 1VQ9P 2BHVA 4U0EA 5F2KA 3CC2P 2BUOA 3I56P 2OTJP 4QNBA 4U0AA 4E92A 1RO0A 3DPHA 3CMAP 3CCMP 1VQOP 3CMEP 2KGFA 3DS4A 3CCRP 2OTLP 3G1GA 5F2OA 5HGNA 1IUQA 2Z44A 3WBHA 2V4XA 3M1MA 3RG6C 2M8LA 5BS2A 2QEXP 4E91A 1Q7YQ 3B5IA 3H0DA 1NJIQ 1A8OA 3CCEP 2ONTA 2XV6A 1M74A 1KQSO 1KD1Q 1BAJA 2XT1A 4WYMA 1VQ4P 1KC8Q 1YJ9P 3CC7P 1EOQA 3DS2A 1M1KQ 3G1IA 3G0VA 4J93A 1ZMBA 1M9XC 2XGYA 3CCJP 1VQ6P 3NTEA 2CWOA 1W2BO 3G28A 1Q86Q 1P7NA 1EIAA 1VQMP 2WLVB 4XFZA 1M6NA 3OW2O 1K8AQ 1K9MQ 2Z46A 1K30A 1AFVA 2QA4P 1GWPA 2PEKA 1VQKP 3P05A 1Q81Q 5HGLA 1E6JP 2PEMA 5BS1A 1VQPP 1AK4C 2XXMA 5F2NA 3BP9A 2DGYA 4PH0A 1RNIA 2P9XA 3G6EP 5HGKA 2PEJA 3G71P 1QVFO 5HGOA 3DS5A 1AUMA 4B4NA 1YITP 2JYGA 1YHQP 3H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EM9 A;  4XRO A;  4IPY A;  5HGM A;  4PH3 A;  5I4T G;  4PH1 A;  4COP A;  4NX4 C;  2XGU A;  4DGE C;  2X82 A;  2LF4 A;  3VRL C;  2GON A;  1M9Y C;  3DS3 A;  1M9E C;  2JO0 A;  2L6E A;  1QRJ A;  1D1D A;  1L6N A;  1M9D C;  3MGE A;  1M9F C;  3H4E A;  2X2D D;  2PXR C;  2JYL A;  2M8P A;  4HTW A;  1A43 A;  4COC A;  3DTJ A;  3DS1 A;  3G21 A;  4DGA C;  3LRY A;  4XFY A;  4U0D A;  4U0F A;  4INB A;  5DCK A;  2JPR A;  4U0C A;  2XDE A;  2KOD A;  4M0I A;  2M8N A;  1U7K A;  1G03 A;  3G29 A;  5JPA A;  3G26 A;  2EIA A;  3DS0 A;  2PWM A;  4PH2 A;  4LQW C;  2XGV A;  2Y4Z A;  4XRQ A;  1M9C C;  2X83 A;  2WLV A;  4XFX A;  4U0B A;  2GOL B;  2PWO A;  4U0E A;  2BUO A;  4QNB A;  4U0A A;  4E92 A;  3DPH A;  2KGF A;  3DS4 A;  3G1G A;  5HGN A;  2V4X A;  2M8L A;  4E91 A;  1A8O A;  2ONT A;  2XV6 A;  1BAJ A;  2XT1 A;  4WYM A;  1EOQ A;  3DS2 A;  3G1I A;  3G0V A;  4J93 A;  1M9X C;  2XGY A;  3NTE A;  3G28 A;  1P7N A;  1EIA A;  2WLV B;  4XFZ A;  1AFV A;  1GWP A;  3P05 A;  5HGL A;  1E6J P;  1AK4 C;  2XXM A;  3BP9 A;  4PH0 A;  5HGK A;  5HGO A;  3DS5 A;  1AUM A;  4B4N A;  2JYG A;  3H47 A; 
#chains in the Genus database with same CATH topology
 2XZ1 C;  3EJB A;  5EW5 E;  2FQ2 A;  2EFJ A;  2K0X A;  1VKU A;  2MY5 A;  3CD6 P;  4IPY A;  2X2B A;  2MD9 A;  3CXC O;  3VRL C;  3RG2 A;  2LIU A;  3DS3 A;  2KGE A;  2JO0 A;  3CC4 P;  1QRJ A;  2GYK A;  2MR7 A;  1M9F C;  2LTE A;  2CG5 B;  2X2D D;  4CA3 A;  1AF8 A;  2N6Z A;  1A43 A;  2FAE A;  2PY8 A;  3G21 A;  2N50 A;  4DGA C;  4U0F A;  2CGQ A;  2XDE A;  2KOD A;  1AYI A;  1QVG O;  5JPA A;  3CPW O;  3DS0 A;  3GJN A;  2KGC A;  2XGV A;  1VQ5 P;  1L0I A;  3HZQ A;  1S72 P;  1YI2 P;  3E2D A;  3CCL P;  2VLO A;  2PEI A;  2BHV A;  4BPG A;  4U0E A;  5F2K A;  3I56 P;  4HKG A;  2N5H A;  3CCR P;  2OTL P;  2K0Y A;  2Z44 A;  3WBH A;  2M5R A;  3RG6 C;  1CEI A;  2QEX P;  1GXH A;  1Q7Y Q;  3CCE P;  2JAZ A;  4WYM A;  2KOP A;  1VQ4 P;  1KC8 Q;  3DS2 A;  4UHP B;  3G1I A;  1M9X C;  4MRT C;  2AFE A;  1EIA A;  2GZE A;  4NEO A;  1M6N A;  2L0Q A;  1K30 A;  2PEK A;  2EHS A;  5F2N A;  2P9X A;  3G71 P;  3EJD A;  2JYG A;  1EM9 A;  2LKI A;  1M90 Q;  4PH3 A;  3LMO A;  5I4T G;  2EG5 A;  2XGU A;  4QKO A;  1IMP A;  2KOR A;  1GPJ A;  2MF4 A;  2KR5 A;  1M9Y C;  1M9E C;  3GKL C;  1D1D A;  1M9D C;  3MGE A;  2LL8 A;  2MVV A;  2GDX A;  1Q82 Q;  2JYL A;  3DTJ A;  1NQ4 A;  2PEQ A;  4XFY A;  1MZ8 A;  4INB A;  4U0C A;  4H2X C;  1G03 A;  2CNR A;  2PWM A;  1RO2 A;  2VLQ A;  4F37 A;  4PXH B;  3GZL A;  2Y4Z A;  4XRQ A;  2X83 A;  2WLV A;  4U0B A;  3CCV P;  2GZJ A;  2N98 A;  3CCQ P;  2PWO A;  2OTJ P;  3CC2 P;  2BUO A;  4QNB A;  3CMA P;  2LOL A;  3G1G A;  5F2O A;  5HGN A;  1IUQ A;  2V4X A;  2AVA A;  2M8L A;  4R0M A;  1T8K A;  5KP6 B;  1EMV A;  3H0D A;  1A8O A;  2ONT A;  1KQS O;  1M74 A;  1KD1 Q;  2KGA A;  2XT1 A;  1EOQ A;  3G0V A;  1ZMB A;  3CCJ P;  2KOQ A;  2CWO A;  1P7N A;  2MVU A;  2KGD A;  2PNG A;  1VQM P;  2WLV B;  2K92 A;  3U43 A;  5EJD A;  2CQ8 A;  2VSQ A;  2GDW A;  1UJZ A;  1Q81 Q;  5BS1 A;  2PEM A;  1AK4 C;  2XXM A;  3BP9 A;  4PH0 A;  4H2Y C;  1OR5 A;  5HGO A;  1KLP A;  1AUM A;  2EHT A;  1YHQ P;  2KG8 A;  2DNW A;  2KW2 A;  4XRO A;  2GZI A;  5HVC A;  7CEI A;  4PH1 A;  4NX4 C;  2K93 A;  4DGE C;  1DNY A;  1IMQ A;  2LF4 A;  2GON A;  1L6N A;  2FVA A;  1BXI A;  2L9F A;  1VQ7 P;  2PXR C;  4COC A;  2K0D X;  3DS1 A;  2KG6 A;  3LRY A;  4BPH A;  2JPR A;  2PEO A;  1K73 Q;  2JQ4 A;  4M0I A;  4GR2 A;  2LML A;  1N8R Q;  2Z45 A;  1JJ2 O;  2L22 A;  4PH2 A;  3HYB A;  1HQB A;  2KG9 A;  1M9C C;  2JU1 A;  4XFX A;  5CZD B;  2GZG A;  2GOL B;  2FVF A;  3Q20 A;  1UNK A;  4E92 A;  1RO0 A;  3CCM P;  3CME P;  2KGF A;  2MR8 A;  2N5I A;  2FAD A;  3CE7 A;  3B5I A;  1NJI Q;  2GZF A;  2XV6 A;  4PWV B;  3CC7 P;  1YJ9 P;  1M1K Q;  4J93 A;  2XGY A;  1VQ6 P;  2ROQ A;  3NTE A;  1Q86 Q;  3G28 A;  1HY8 A;  1ZNV A;  4XFZ A;  1K8A Q;  1VHN A;  1K9M Q;  2Z46 A;  2KOS A;  2GDY A;  1AFV A;  1VQK P;  1E6J P;  2FHS C;  1VQP P;  1RNI A;  5HGK A;  1QVF O;  4B4N A;  1YIT P;  3H47 A;  3I55 P;  5HGM A;  1DV5 A;  4COP A;  2JB0 A;  2FQ1 A;  2N6Y A;  2KWL A;  4GR6 A;  2X82 A;  4H2W C;  2VLP A;  1ACP A;  2QNW A;  2JBG A;  2NO8 A;  1VQN P;  2L6E A;  2VLN A;  2XZ0 D;  3H4E A;  3G4S P;  1YJW P;  2M8P A;  4HTW A;  2K2Q A;  1VQL P;  1X3O A;  3EJE A;  1VQ8 P;  2K5X A;  2LIW A;  4U0D A;  3GZM A;  5DCK A;  2JU2 A;  2M8N A;  1U7K A;  2OAR A;  3G29 A;  3G26 A;  2JGP A;  2EIA A;  1M6E X;  3CCS P;  2PEN A;  4LQW C;  2FVE A;  3CCU P;  1YJN P;  2ERH A;  2E1M A;  1YIJ P;  1VQ9 P;  1FR2 A;  2L4B A;  2AF8 A;  4U0A A;  3DPH A;  1VQO P;  1F80 D;  3DS4 A;  1Z6M A;  3M1M A;  2AFD A;  5BS2 A;  4E91 A;  1E0H A;  3NY7 B;  1BAJ A;  1L0H A;  2LPK A;  4BPF A;  1W2B O;  2K94 A;  2KOO A;  5HV8 A;  3OW2 O;  2QA4 P;  1GWP A;  5KP8 B;  3P05 A;  2FQ0 A;  5HGL A;  2FAC A;  2DGY A;  3G6E P;  4DG9 A;  1GXG A;  3B4Q A;  2PEJ A;  2WPT A;  3DS5 A;  4IZ6 A;  5KP7 B; 
#chains in the Genus database with same CATH homology
 1EM9 A;  4XRO A;  2EFJ A;  3I55 P;  3CD6 P;  4IPY A;  5HGM A;  1M90 Q;  4PH3 A;  5I4T G;  2EG5 A;  4PH1 A;  4COP A;  4NX4 C;  2XGU A;  4DGE C;  4GR6 A;  3CXC O;  2X82 A;  2LF4 A;  3VRL C;  2GON A;  1M9Y C;  3DS3 A;  1VQN P;  1M9E C;  2JO0 A;  2L6E A;  3CC4 P;  1QRJ A;  1D1D A;  1L6N A;  1M9D C;  3MGE A;  1M9F C;  3H4E A;  3G4S P;  1YJW P;  1VQ7 P;  2X2D D;  2PXR C;  1Q82 Q;  2JYL A;  2M8P A;  4HTW A;  1A43 A;  4COC A;  2PY8 A;  3DTJ A;  1VQL P;  3DS1 A;  3G21 A;  4DGA C;  1VQ8 P;  3LRY A;  2PEQ A;  4XFY A;  4U0D A;  4U0F A;  4INB A;  5DCK A;  2JPR A;  2PEO A;  4U0C A;  2XDE A;  1K73 Q;  2KOD A;  4M0I A;  2M8N A;  1U7K A;  4GR2 A;  1G03 A;  2OAR A;  3G29 A;  5JPA A;  3G26 A;  3CPW O;  1QVG O;  1N8R Q;  2EIA A;  2Z45 A;  1JJ2 O;  3DS0 A;  2PWM A;  1M6E X;  4PH2 A;  1RO2 A;  3CCS P;  2PEN A;  3HYB A;  4LQW C;  2XGV A;  2Y4Z A;  1VQ5 P;  4XRQ A;  1M9C C;  2X83 A;  3HZQ A;  2WLV A;  4XFX A;  3CCU P;  1YI2 P;  1S72 P;  3E2D A;  1YJN P;  4U0B A;  3CCV P;  2E1M A;  1YIJ P;  3CCL P;  2GOL B;  3CCQ P;  2PWO A;  2PEI A;  3Q20 A;  1VQ9 P;  2BHV A;  4U0E A;  5F2K A;  3CC2 P;  2BUO A;  3I56 P;  2OTJ P;  4QNB A;  4U0A A;  4E92 A;  1RO0 A;  3DPH A;  3CMA P;  3CCM P;  1VQO P;  3CME P;  2KGF A;  3DS4 A;  3CCR P;  2OTL P;  3G1G A;  5F2O A;  5HGN A;  1IUQ A;  2Z44 A;  3WBH A;  2V4X A;  3M1M A;  3RG6 C;  2M8L A;  5BS2 A;  2QEX P;  4E91 A;  1Q7Y Q;  3B5I A;  3H0D A;  1NJI Q;  1A8O A;  3CCE P;  2ONT A;  2XV6 A;  1M74 A;  1KQS O;  1KD1 Q;  1BAJ A;  2XT1 A;  4WYM A;  1VQ4 P;  1KC8 Q;  1YJ9 P;  3CC7 P;  1EOQ A;  3DS2 A;  1M1K Q;  3G1I A;  3G0V A;  4J93 A;  1ZMB A;  1M9X C;  2XGY A;  3CCJ P;  1VQ6 P;  3NTE A;  2CWO A;  1W2B O;  3G28 A;  1Q86 Q;  1P7N A;  1EIA A;  1VQM P;  2WLV B;  4XFZ A;  1M6N A;  3OW2 O;  1K8A Q;  1K9M Q;  2Z46 A;  1K30 A;  1AFV A;  2QA4 P;  1GWP A;  2PEK A;  1VQK P;  3P05 A;  1Q81 Q;  5HGL A;  1E6J P;  2PEM A;  5BS1 A;  1VQP P;  1AK4 C;  2XXM A;  5F2N A;  3BP9 A;  2DGY A;  4PH0 A;  1RNI A;  2P9X A;  3G6E P;  5HGK A;  2PEJ A;  3G71 P;  1QVF O;  5HGO A;  3DS5 A;  1AUM A;  4B4N A;  1YIT P;  2JYG A;  1YHQ P;  3H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...