3P05A

X-ray structure of pentameric hiv-1 ca
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
210
Chain Sequence
PIHQAISPRTLCCWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 CA
publication title Atomic-level modelling of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 78
structure length 210
sequence length 219
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3p05A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3p05A02
4LQWC 1EOQA 3BP9A 1AK4C 4XFXA 2WLVB 2Y4ZA 2JO0A 4IPYA 3P05A 3H4EA 2ONTA 3DS5A 2M8PA 2L6EA 3G29A 4U0AA 1M9EC 2GOLB 4U0BA 1QRJA 2PWOA 3DS3A 4PH1A 2XXMA 1EIAA 4E91A 3LRYA 4J93A 4DGAC 4PH3A 2XDEA 4INBA 2PWMA 4U0FA 3VRLC 3G28A 2GONA 1A8OA 1U7KA 1GWPA 5I4TG 3DS2A 4XFYA 4E92A 4NX4C 3G1GA 4XFZA 5HGNA 4U0EA 3NTEA 1EM9A 4U0CA 3G26A 4XROA 2BUOA 1E6JP 1A43A 2X2DD 3DS4A 3G0VA 2EIAA 2X82A 1M9CC 2WLVA 4M0IA 5HGOA 5HGLA 2XV6A 3DS1A 2M8LA 2JYLA 5HGMA 2XGVA 1AFVA 4QNBA 1M9YC 4PH2A 2XT1A 4COPA 5HGKA 3G21A 4HTWA 3G1IA 1M9DC 2X83A 2M8NA 4U0DA 5JPAA 4DGEC 1P7NA 4XRQA 1M9XC 1M9FC 2KODA 3MGEA 5DCKA 2XGUA 2LF4A 1D1DA 3H47A 1BAJA 1AUMA 1G03A 4COCA 2KGFA 3DS0A 3DTJA 4WYMA 2PXRC 2JYGA 2JPRA 2XGYA 4PH0A 1L6NA 3DPHA 2V4XA 4B4NA
chains in the Genus database with same CATH superfamily
3BP9A 2PNGA 1AK4C 2N5HA 1IMPA 3GJNA 4GR2A 1ZMBA 2AFEA 1YHQP 3P05A 3DS5A 5HV8A 5HVCA 2M8PA 3GKLC 2WPTA 3G29A 4IZ6A 4U0AA 2GOLB 4U0BA 1EMVA 3DS3A 2PEOA 4R0MA 1HY8A 4J93A 2JAZA 3EJBA 3OW2O 1Q81Q 1K8AQ 4H2YC 1YJWP 5F2OA 4GR6A 4INBA 1N8RQ 2KGEA 3VRLC 3NY7B 3G28A 5KP6B 2GONA 2ROQA 1GWPA 5I4TG 2DGYA 2MVUA 3RG2A 3M1MA 2L22A 2LTEA 3WBHA 2Z44A 2FVFA 1AF8A 2OTJP 2K2QA 2VLPA 4XROA 3CCLP 3U43A 2FHSC 3EJDA 1VKUA 2K0YA 3G0VA 2AF8A 2XZ1C 5HGOA 3DS1A 2PEMA 2JU1A 2JU2A 4QNBA 2K0DX 1GXHA 2FACA 2L4BA 2P9XA 1RO2A 2GYKA 2X83A 1P7NA 1AYIA 5DCKA 1D1DA 2L9FA 3H47A 1X3OA 1VQPP 2LL8A 2FQ2A 1S72P 2K93A 1VQMP 3DTJA 3GZMA 2JYGA 1W2BO 3DPHA 2V4XA 4B4NA 2KOSA 1EOQA 2LIUA 1IUQA 1NJIQ 2QEXP 3B5IA 2Y4ZA 2X2BA 2JO0A 3CCSP 3H4EA 2MF4A 1FR2A 4NEOA 1QRJA 2PWOA 4PH1A 2XXMA 1EIAA 4PH3A 2JBGA 2LMLA 2MVVA 1F80D 2PWMA 1KC8Q 1VQKP 1A8OA 1Q82Q 1VQOP 1YJ9P 2KOQA 3CCQP 1ACPA 2E1MA 4E92A 2PEQA 2M5RA 5HGNA 1EM9A 4U0CA 2BUOA 1E6JP 1VQ8P 1M90Q 2EHSA 3G71P 3DS4A 1M9CC 4MRTC 2EFJA 3EJEA 1K30A 2N6YA 2VLNA 2Z46A 5HGKA 3G21A 1CEIA 2K5XA 1M9DC 5JPAA 3HZQA 3CMAP 1M9FC 2KOPA 2XZ0D 2PEIA 2LPKA 2XGUA 3GZLA 3B4QA 3H0DA 3Q20A 1BAJA 2N50A 1OR5A 1G03A 5BS2A 1KD1Q 2MR8A 5F2NA 2QNWA 2KGFA 4H2WC 3CCRP 2PXRC 2JPRA 4PH0A 1L6NA 1T8KA 4LQWC 4PWVB 2VLOA 4XFXA 4DG9A 1MZ8A 1NQ4A 3CCEP 2WLVB 3HYBA 1VQ4P 1VQ7P 5KP8B 2Z45A 4BPHA 3CC7P 1VQNP 2EHTA 2GDXA 2L6EA 1M9EC 2BHVA 2PENA 2JQ4A 3LRYA 5BS1A 1L0HA 4DGAC 2XDEA 1ZNVA 1VQLP 2K92A 2GDWA 2GZJA 5EJDA 2EG5A 2KORA 3CCUP 1U7KA 2CQ8A 5CZDB 1IMQA 4XFYA 2JB0A 2KW2A 2QA4P 4XFZA 2MD9A 3I56P 2LKIA 4U0EA 1VQ6P 3NTEA 2VLQA 1KLPA 7CEIA 2PY8A 1A43A 2X2DD 2X82A 1BXIA 2CG5B 2WLVA 5EW5E 4M0IA 1RO0A 2PEKA 2XV6A 1M1KQ 5HGMA 2XGVA 1HQBA 2KWLA 1AFVA 2DNWA 1M9YC 4PH2A 2XT1A 1QVGO 1UJZA 5KP7B 4HTWA 2VSQA 4U0DA 4XRQA 1M9XC 2KG9A 3CPWO 2CGQA 1M74A 2ERHA 2K0XA 4BPGA 1RNIA 3G4SP 1M6EX 4WYMA 2GZEA 2FQ1A 2XGYA 4F37A 1YJNP 4UHPB 2CNRA 2LIWA 3CMEP 4IPYA 2ONTA 2KGCA 1L0IA 1Q7YQ 2KOOA 3CCVP 2N6ZA 2FVEA 2KG6A 2OARA 2FADA 3E2DA 2GZFA 4E91A 2JGPA 2FQ0A 4HKGA 1VHNA 1QVFO 1Q86Q 2GZIA 2FVAA 2K94A 2PEJA 2OTLP 4U0FA 3DS2A 4PXHB 1K9MQ 3G6EP 4NX4C 3G1GA 1Z6MA 1GPJA 3CCMP 3CC2P 4QKOA 3G26A 1YIJP 1YITP 5F2KA 3CD6P 2NO8A 3CC4P 3CXCO 1K73Q 2EIAA 1GXGA 3LMOA 1VQ5P 3CE7A 2GZGA 5HGLA 2M8LA 2JYLA 1DV5A 3CCJP 2MR7A 4COPA 4BPFA 2L0QA 3G1IA 1UNKA 1VQ9P 2M8NA 2AFDA 4DGEC 2KG8A 4CA3A 2KODA 2GDYA 1M6NA 2MY5A 3MGEA 2KGDA 1KQSO 2LF4A 2KR5A 2N5IA 1JJ2O 2CWOA 2N98A 1E0HA 2FAEA 1DNYA 1AUMA 1YI2P 2KGAA 4H2XC 3RG6C 4COCA 2AVAA 3DS0A 2LOLA 3I55P
chains in the Genus database with same CATH topology
4LQWC 1EOQA 3BP9A 1IUQA 1NJIQ 1AK4C 2QEXP 4XFXA 3CCEP 3B5IA 2WLVB 3HYBA 4GR2A 1ZMBA 3CMEP 2Y4ZA 1YHQP 2JO0A 4IPYA 1VQ4P 1VQ7P 3CCSP 3P05A 3H4EA 2ONTA 3DS5A 1Q7YQ 2M8PA 2Z45A 3CC7P 3CCVP 1VQNP 2L6EA 2OARA 3G29A 4U0AA 1M9EC 2GOLB 4U0BA 3E2DA 1QRJA 2PWOA 3DS3A 2BHVA 4PH1A 2PENA 2PEOA 2XXMA 1EIAA 4E91A 3LRYA 5BS1A 4J93A 4DGAC 3OW2O 4PH3A 1QVFO 1Q81Q 2XDEA 1Q86Q 1K8AQ 1VQLP 1YJWP 2PEJA 5F2OA 2OTLP 2EG5A 4INBA 4GR6A 1N8RQ 2PWMA 4U0FA 3VRLC 3G28A 1KC8Q 3CCUP 1VQKP 2GONA 1A8OA 1U7KA 1GWPA 5I4TG 1Q82Q 3DS2A 2DGYA 1VQOP 1YJ9P 1K9MQ 3G6EP 3CCQP 2E1MA 4XFYA 4E92A 4NX4C 3M1MA 3G1GA 2QA4P 3WBHA 2PEQA 2Z44A 4XFZA 5HGNA 2OTJP 3I56P 4U0EA 1VQ6P 3CCMP 3CC2P 3NTEA 1EM9A 4U0CA 3G26A 1YIJP 4XROA 1YITP 3CCLP 2BUOA 2PY8A 1E6JP 1A43A 5F2KA 2X2DD 1VQ8P 3CD6P 1M90Q 3G71P 3DS4A 3CC4P 3CXCO 1K73Q 3G0VA 2EIAA 2X82A 1M9CC 1VQ5P 2EFJA 2WLVA 4M0IA 1RO0A 5HGOA 2PEKA 5HGLA 2XV6A 1K30A 2PEMA 3DS1A 1M1KQ 2M8LA 2JYLA 5HGMA 2XGVA 1AFVA 4QNBA 3CCJP 1M9YC 4PH2A 2XT1A 4COPA 1QVGO 2Z46A 5HGKA 3G21A 2P9XA 1RO2A 4HTWA 3G1IA 1VQ9P 1M9DC 2X83A 2M8NA 4U0DA 5JPAA 4DGEC 3HZQA 1P7NA 4XRQA 3CMAP 1M9XC 1M9FC 2KODA 1M6NA 2PEIA 3MGEA 5DCKA 2XGUA 1KQSO 2LF4A 3CPWO 1D1DA 3H0DA 3Q20A 3H47A 1JJ2O 2CWOA 1BAJA 1M74A 1VQPP 1AUMA 1YI2P 1G03A 5BS2A 1S72P 1KD1Q 1VQMP 5F2NA 3RG6C 4COCA 1RNIA 3G4SP 1M6EX 2KGFA 3DS0A 3DTJA 3CCRP 3I55P 4WYMA 2PXRC 2JYGA 2JPRA 2XGYA 1W2BO 4PH0A 1L6NA 3DPHA 2V4XA 4B4NA 1YJNP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LQW C;  1EOQ A;  3BP9 A;  1AK4 C;  4XFX A;  2WLV B;  2Y4Z A;  2JO0 A;  4IPY A;  3P05 A;  3H4E A;  2ONT A;  3DS5 A;  2M8P A;  2L6E A;  3G29 A;  4U0A A;  1M9E C;  2GOL B;  4U0B A;  1QRJ A;  2PWO A;  3DS3 A;  4PH1 A;  2XXM A;  1EIA A;  4E91 A;  3LRY A;  4J93 A;  4DGA C;  4PH3 A;  2XDE A;  4INB A;  2PWM A;  4U0F A;  3VRL C;  3G28 A;  2GON A;  1A8O A;  1U7K A;  1GWP A;  5I4T G;  3DS2 A;  4XFY A;  4E92 A;  4NX4 C;  3G1G A;  4XFZ A;  5HGN A;  4U0E A;  3NTE A;  1EM9 A;  4U0C A;  3G26 A;  4XRO A;  2BUO A;  1E6J P;  1A43 A;  2X2D D;  3DS4 A;  3G0V A;  2EIA A;  2X82 A;  1M9C C;  2WLV A;  4M0I A;  5HGO A;  5HGL A;  2XV6 A;  3DS1 A;  2M8L A;  2JYL A;  5HGM A;  2XGV A;  1AFV A;  4QNB A;  1M9Y C;  4PH2 A;  2XT1 A;  4COP A;  5HGK A;  3G21 A;  4HTW A;  3G1I A;  1M9D C;  2X83 A;  2M8N A;  4U0D A;  5JPA A;  4DGE C;  1P7N A;  4XRQ A;  1M9X C;  1M9F C;  2KOD A;  3MGE A;  5DCK A;  2XGU A;  2LF4 A;  1D1D A;  3H47 A;  1BAJ A;  1AUM A;  1G03 A;  4COC A;  2KGF A;  3DS0 A;  3DTJ A;  4WYM A;  2PXR C;  2JYG A;  2JPR A;  2XGY A;  4PH0 A;  1L6N A;  3DPH A;  2V4X A;  4B4N A; 
#chains in the Genus database with same CATH topology
 3BP9 A;  2PNG A;  1AK4 C;  2N5H A;  1IMP A;  3GJN A;  4GR2 A;  1ZMB A;  2AFE A;  1YHQ P;  3P05 A;  3DS5 A;  5HV8 A;  5HVC A;  2M8P A;  3GKL C;  2WPT A;  3G29 A;  4IZ6 A;  4U0A A;  2GOL B;  4U0B A;  1EMV A;  3DS3 A;  2PEO A;  4R0M A;  1HY8 A;  4J93 A;  2JAZ A;  3EJB A;  3OW2 O;  1Q81 Q;  1K8A Q;  4H2Y C;  1YJW P;  5F2O A;  4GR6 A;  4INB A;  1N8R Q;  2KGE A;  3VRL C;  3NY7 B;  3G28 A;  5KP6 B;  2GON A;  2ROQ A;  1GWP A;  5I4T G;  2DGY A;  2MVU A;  3RG2 A;  3M1M A;  2L22 A;  2LTE A;  3WBH A;  2Z44 A;  2FVF A;  1AF8 A;  2OTJ P;  2K2Q A;  2VLP A;  4XRO A;  3CCL P;  3U43 A;  2FHS C;  3EJD A;  1VKU A;  2K0Y A;  3G0V A;  2AF8 A;  2XZ1 C;  5HGO A;  3DS1 A;  2PEM A;  2JU1 A;  2JU2 A;  4QNB A;  2K0D X;  1GXH A;  2FAC A;  2L4B A;  2P9X A;  1RO2 A;  2GYK A;  2X83 A;  1P7N A;  1AYI A;  5DCK A;  1D1D A;  2L9F A;  3H47 A;  1X3O A;  1VQP P;  2LL8 A;  2FQ2 A;  1S72 P;  2K93 A;  1VQM P;  3DTJ A;  3GZM A;  2JYG A;  1W2B O;  3DPH A;  2V4X A;  4B4N A;  2KOS A;  1EOQ A;  2LIU A;  1IUQ A;  1NJI Q;  2QEX P;  3B5I A;  2Y4Z A;  2X2B A;  2JO0 A;  3CCS P;  3H4E A;  2MF4 A;  1FR2 A;  4NEO A;  1QRJ A;  2PWO A;  4PH1 A;  2XXM A;  1EIA A;  4PH3 A;  2JBG A;  2LML A;  2MVV A;  1F80 D;  2PWM A;  1KC8 Q;  1VQK P;  1A8O A;  1Q82 Q;  1VQO P;  1YJ9 P;  2KOQ A;  3CCQ P;  1ACP A;  2E1M A;  4E92 A;  2PEQ A;  2M5R A;  5HGN A;  1EM9 A;  4U0C A;  2BUO A;  1E6J P;  1VQ8 P;  1M90 Q;  2EHS A;  3G71 P;  3DS4 A;  1M9C C;  4MRT C;  2EFJ A;  3EJE A;  1K30 A;  2N6Y A;  2VLN A;  2Z46 A;  5HGK A;  3G21 A;  1CEI A;  2K5X A;  1M9D C;  5JPA A;  3HZQ A;  3CMA P;  1M9F C;  2KOP A;  2XZ0 D;  2PEI A;  2LPK A;  2XGU A;  3GZL A;  3B4Q A;  3H0D A;  3Q20 A;  1BAJ A;  2N50 A;  1OR5 A;  1G03 A;  5BS2 A;  1KD1 Q;  2MR8 A;  5F2N A;  2QNW A;  2KGF A;  4H2W C;  3CCR P;  2PXR C;  2JPR A;  4PH0 A;  1L6N A;  1T8K A;  4LQW C;  4PWV B;  2VLO A;  4XFX A;  4DG9 A;  1MZ8 A;  1NQ4 A;  3CCE P;  2WLV B;  3HYB A;  1VQ4 P;  1VQ7 P;  5KP8 B;  2Z45 A;  4BPH A;  3CC7 P;  1VQN P;  2EHT A;  2GDX A;  2L6E A;  1M9E C;  2BHV A;  2PEN A;  2JQ4 A;  3LRY A;  5BS1 A;  1L0H A;  4DGA C;  2XDE A;  1ZNV A;  1VQL P;  2K92 A;  2GDW A;  2GZJ A;  5EJD A;  2EG5 A;  2KOR A;  3CCU P;  1U7K A;  2CQ8 A;  5CZD B;  1IMQ A;  4XFY A;  2JB0 A;  2KW2 A;  2QA4 P;  4XFZ A;  2MD9 A;  3I56 P;  2LKI A;  4U0E A;  1VQ6 P;  3NTE A;  2VLQ A;  1KLP A;  7CEI A;  2PY8 A;  1A43 A;  2X2D D;  2X82 A;  1BXI A;  2CG5 B;  2WLV A;  5EW5 E;  4M0I A;  1RO0 A;  2PEK A;  2XV6 A;  1M1K Q;  5HGM A;  2XGV A;  1HQB A;  2KWL A;  1AFV A;  2DNW A;  1M9Y C;  4PH2 A;  2XT1 A;  1QVG O;  1UJZ A;  5KP7 B;  4HTW A;  2VSQ A;  4U0D A;  4XRQ A;  1M9X C;  2KG9 A;  3CPW O;  2CGQ A;  1M74 A;  2ERH A;  2K0X A;  4BPG A;  1RNI A;  3G4S P;  1M6E X;  4WYM A;  2GZE A;  2FQ1 A;  2XGY A;  4F37 A;  1YJN P;  4UHP B;  2CNR A;  2LIW A;  3CME P;  4IPY A;  2ONT A;  2KGC A;  1L0I A;  1Q7Y Q;  2KOO A;  3CCV P;  2N6Z A;  2FVE A;  2KG6 A;  2OAR A;  2FAD A;  3E2D A;  2GZF A;  4E91 A;  2JGP A;  2FQ0 A;  4HKG A;  1VHN A;  1QVF O;  1Q86 Q;  2GZI A;  2FVA A;  2K94 A;  2PEJ A;  2OTL P;  4U0F A;  3DS2 A;  4PXH B;  1K9M Q;  3G6E P;  4NX4 C;  3G1G A;  1Z6M A;  1GPJ A;  3CCM P;  3CC2 P;  4QKO A;  3G26 A;  1YIJ P;  1YIT P;  5F2K A;  3CD6 P;  2NO8 A;  3CC4 P;  3CXC O;  1K73 Q;  2EIA A;  1GXG A;  3LMO A;  1VQ5 P;  3CE7 A;  2GZG A;  5HGL A;  2M8L A;  2JYL A;  1DV5 A;  3CCJ P;  2MR7 A;  4COP A;  4BPF A;  2L0Q A;  3G1I A;  1UNK A;  1VQ9 P;  2M8N A;  2AFD A;  4DGE C;  2KG8 A;  4CA3 A;  2KOD A;  2GDY A;  1M6N A;  2MY5 A;  3MGE A;  2KGD A;  1KQS O;  2LF4 A;  2KR5 A;  2N5I A;  1JJ2 O;  2CWO A;  2N98 A;  1E0H A;  2FAE A;  1DNY A;  1AUM A;  1YI2 P;  2KGA A;  4H2X C;  3RG6 C;  4COC A;  2AVA A;  3DS0 A;  2LOL A;  3I55 P; 
#chains in the Genus database with same CATH homology
 4LQW C;  1EOQ A;  3BP9 A;  1IUQ A;  1NJI Q;  1AK4 C;  2QEX P;  4XFX A;  3CCE P;  3B5I A;  2WLV B;  3HYB A;  4GR2 A;  1ZMB A;  3CME P;  2Y4Z A;  1YHQ P;  2JO0 A;  4IPY A;  1VQ4 P;  1VQ7 P;  3CCS P;  3P05 A;  3H4E A;  2ONT A;  3DS5 A;  1Q7Y Q;  2M8P A;  2Z45 A;  3CC7 P;  3CCV P;  1VQN P;  2L6E A;  2OAR A;  3G29 A;  4U0A A;  1M9E C;  2GOL B;  4U0B A;  3E2D A;  1QRJ A;  2PWO A;  3DS3 A;  2BHV A;  4PH1 A;  2PEN A;  2PEO A;  2XXM A;  1EIA A;  4E91 A;  3LRY A;  5BS1 A;  4J93 A;  4DGA C;  3OW2 O;  4PH3 A;  1QVF O;  1Q81 Q;  2XDE A;  1Q86 Q;  1K8A Q;  1VQL P;  1YJW P;  2PEJ A;  5F2O A;  2OTL P;  2EG5 A;  4INB A;  4GR6 A;  1N8R Q;  2PWM A;  4U0F A;  3VRL C;  3G28 A;  1KC8 Q;  3CCU P;  1VQK P;  2GON A;  1A8O A;  1U7K A;  1GWP A;  5I4T G;  1Q82 Q;  3DS2 A;  2DGY A;  1VQO P;  1YJ9 P;  1K9M Q;  3G6E P;  3CCQ P;  2E1M A;  4XFY A;  4E92 A;  4NX4 C;  3M1M A;  3G1G A;  2QA4 P;  3WBH A;  2PEQ A;  2Z44 A;  4XFZ A;  5HGN A;  2OTJ P;  3I56 P;  4U0E A;  1VQ6 P;  3CCM P;  3CC2 P;  3NTE A;  1EM9 A;  4U0C A;  3G26 A;  1YIJ P;  4XRO A;  1YIT P;  3CCL P;  2BUO A;  2PY8 A;  1E6J P;  1A43 A;  5F2K A;  2X2D D;  1VQ8 P;  3CD6 P;  1M90 Q;  3G71 P;  3DS4 A;  3CC4 P;  3CXC O;  1K73 Q;  3G0V A;  2EIA A;  2X82 A;  1M9C C;  1VQ5 P;  2EFJ A;  2WLV A;  4M0I A;  1RO0 A;  5HGO A;  2PEK A;  5HGL A;  2XV6 A;  1K30 A;  2PEM A;  3DS1 A;  1M1K Q;  2M8L A;  2JYL A;  5HGM A;  2XGV A;  1AFV A;  4QNB A;  3CCJ P;  1M9Y C;  4PH2 A;  2XT1 A;  4COP A;  1QVG O;  2Z46 A;  5HGK A;  3G21 A;  2P9X A;  1RO2 A;  4HTW A;  3G1I A;  1VQ9 P;  1M9D C;  2X83 A;  2M8N A;  4U0D A;  5JPA A;  4DGE C;  3HZQ A;  1P7N A;  4XRQ A;  3CMA P;  1M9X C;  1M9F C;  2KOD A;  1M6N A;  2PEI A;  3MGE A;  5DCK A;  2XGU A;  1KQS O;  2LF4 A;  3CPW O;  1D1D A;  3H0D A;  3Q20 A;  3H47 A;  1JJ2 O;  2CWO A;  1BAJ A;  1M74 A;  1VQP P;  1AUM A;  1YI2 P;  1G03 A;  5BS2 A;  1S72 P;  1KD1 Q;  1VQM P;  5F2N A;  3RG6 C;  4COC A;  1RNI A;  3G4S P;  1M6E X;  2KGF A;  3DS0 A;  3DTJ A;  3CCR P;  3I55 P;  4WYM A;  2PXR C;  2JYG A;  2JPR A;  2XGY A;  1W2B O;  4PH0 A;  1L6N A;  3DPH A;  2V4X A;  4B4N A;  1YJN P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...