3P05A

X-ray structure of pentameric hiv-1 ca
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
219
structure length
210
Chain Sequence
b'PIHQAISPRTLCCWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 CA
publication title Atomic-level modelling of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 78
structure length 210
sequence length 219
chains with identical sequence B, C, D, E
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-09-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3p05A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3p05A02
1G03A 5HGNA 3DS5A 4DGAC 1M9EC 1GWPA 5DCKA 4PH3A 2PXRC 1EIAA 2BUOA 4U0BA 2LF4A 2X83A 4XFXA 4IPYA 4LQWC 4M0IA 2JYLA 1QRJA 2X2DD 5HGMA 4E91A 5I4TG 1U7KA 4XFZA 5JPAA 2M8NA 1A8OA 1EM9A 2JO0A 2KODA 2XT1A 2GONA 3G28A 5HGKA 1BAJA 3NTEA 3H47A 4E92A 3G26A 4XRQA 2XGYA 4J93A 2L6EA 4COPA 1D1DA 3G1IA 1A43A 3G29A 2X82A 3G21A 2JPRA 1L6NA 1AK4C 4PH0A 1AFVA 4DGEC 3VRLC 3DTJA 5HGLA 3P05A 3MGEA 2PWOA 2WLVB 1M9XC 3DS3A 4U0DA 3DS1A 2M8LA 4B4NA 2XXMA 2GOLB 2ONTA 4QNBA 4INBA 4PH2A 4XFYA 1AUMA 4U0EA 2EIAA 3H4EA 1EOQA 2XDEA 3DS2A 1E6JP 4COCA 4WYMA 4U0AA 3G1GA 1P7NA 2JYGA 2XGUA 3BP9A 4NX4C 4U0FA 4HTWA 3DS4A 2XGVA 1M9FC 1M9DC 3DPHA 2KGFA 1M9CC 2V4XA 2PWMA 2XV6A 4PH1A 4XROA 2Y4ZA 2M8PA 5HGOA 2WLVA 4U0CA 3DS0A 1M9YC 3G0VA 3LRYA
chains in the Genus database with same CATH superfamily
5HGNA 3H0DA 1QVGO 1M9EC 1GWPA 3CD6P 3EJDA 5F2OA 2EHSA 2ERHA 2X83A 1YJNP 1VQOP 4LQWC 1M1KQ 1QRJA 2X2DD 1Q86Q 2LIUA 3CCVP 2M8NA 1VQMP 2EFJA 1A8OA 2JO0A 3G28A 2GONA 4PXHB 1L0HA 3NTEA 4IZ6A 4E92A 4XRQA 2CG5B 2EHTA 2FVFA 1A43A 3G1IA 3G29A 2NO8A 4UHPB 2BHVA 1L6NA 4H2WC 2PENA 1K9MQ 1YHQP 1VQ5P 4DGEC 2KWLA 5HGLA 7CEIA 1GXHA 2GZGA 1Q82Q 3CCQP 1IMQA 1VQPP 2PEOA 2PWOA 1M9XC 4U0DA 2DGYA 1DV5A 1VQ9P 3G4SP 1KC8Q 4PH2A 4XFYA 4U0EA 5HV8A 3H4EA 2N98A 4BPGA 1T8KA 3GZLA 2K92A 2KOSA 1JJ2O 2LIWA 4NX4C 2VSQA 4U0FA 1K73Q 3DS4A 1M9FC 2CGQA 3CC4P 4R0MA 2GZEA 3DPHA 1GPJA 2KGFA 2FACA 2KGAA 2E1MA 2N6ZA 2PWMA 4GR6A 2DNWA 4XROA 1Z6MA 2K94A 2Y4ZA 2M8PA 3CMEP 3DS0A 1M9YC 1VQ7P 2JB0A 2PEQA 2JBGA 4DGAC 3NY7B 1ZMBA 4PH3A 1YIJP 2PXRC 5F2KA 2BUOA 3EJEA 2L4BA 5KP7B 2LF4A 4XFXA 2GZIA 4H2XC 4H2YC 3LMOA 1F80D 3B4QA 3CPWO 1EM9A 2MR7A 3G6EP 4F37A 1QVFO 2K0DX 2PY8A 2KG8A 1M6NA 2L6EA 2MR8A 1D1DA 2JPRA 2OTLP 2LTEA 4DG9A 1EMVA 2QNWA 2OTJP 3VRLC 2PEMA 1NQ4A 2PEIA 4NEOA 1YITP 1VHNA 1ACPA 2WLVB 2FVEA 1RO2A 3DS1A 2M8LA 4B4NA 2XXMA 5BS1A 1VQ4P 4MRTC 4QNBA 1YJWP 4BPHA 2FQ1A 2FQ2A 2GDXA 1AF8A 2L0QA 4U0AA 1AYIA 3G1GA 2GDWA 2JYGA 3BP9A 3I55P 1MZ8A 2VLPA 2XGVA 2KGDA 1W2BO 2L9FA 1M9DC 5EJDA 2QA4P 2GYKA 3I56P 2EG5A 5F2NA 1G03A 3DS5A 3CCUP 2XZ1C 2MVVA 1EIAA 2FQ0A 1HY8A 4HKGA 2JU1A 1VQLP 1E0HA 1M90Q 4M0IA 2JAZA 2JQ4A 5HGMA 4E91A 5I4TG 1M74A 1U7KA 2MVUA 2WPTA 2KOPA 3G71P 2KODA 3WBHA 2XT1A 1CEIA 2AFDA 3OW2O 2Z44A 2CWOA 1KQSO 1Q7YQ 3EJBA 3H47A 2LPKA 1K8AQ 3G26A 1UNKA 2AVAA 2PEKA 3M1MA 4J93A 4COPA 2GZJA 1RO0A 4BPFA 1KD1Q 4GR2A 3GZMA 3E2DA 3G21A 5CZDB 2LL8A 1YI2P 3CCEP 4PH0A 2MY5A 2N6YA 3GJNA 1YJ9P 2CNRA 2M5RA 3MGEA 1M6EX 1VQNP 2VLNA 3DS3A 2N5HA 2GOLB 2FVAA 3CE7A 4INBA 2AFEA 2GDYA 2KGEA 2KORA 2LOLA 3RG6C 1EOQA 2XDEA 1E6JP 4COCA 1P7NA 1KLPA 2XGUA 2Z46A 1VKUA 3CCRP 3CXCO 1N8RQ 2VLQA 5KP8B 1M9CC 2V4XA 1ZNVA 4PH1A 2KOOA 1BXIA 2N50A 2WLVA 4U0CA 3CMAP 1IUQA 5DCKA 1X3OA 2OARA 3Q20A 4U0BA 5HVCA 2N5IA 4IPYA 1S72P 2JYLA 4XFZA 5JPAA 3U43A 5KP6B 2JU2A 5EW5E 2KG9A 3CCSP 1L0IA 3HZQA 3CC7P 2LKIA 5HGKA 2FAEA 1BAJA 2PEJA 3B5IA 4CA3A 2QEXP 5BS2A 2K5XA 3HYBA 2XGYA 2ROQA 2LMLA 1FR2A 2KR5A 3CCJP 1RNIA 2X82A 1VQ8P 3RG2A 1AK4C 1HQBA 1VQKP 4QKOA 1AFVA 2PNGA 2GZFA 2K2QA 3DTJA 4PWVB 3CC2P 2KGCA 3P05A 1IMPA 2MD9A 2CQ8A 2K93A 1K30A 2Z45A 1DNYA 2MF4A 2JGPA 2KG6A 2ONTA 1VQ6P 2X2BA 2KW2A 3CCMP 1NJIQ 1AUMA 2EIAA 2XZ0D 2KOQA 3DS2A 4WYMA 2K0XA 2FADA 4HTWA 3CCLP 2AF8A 2FHSC 1Q81Q 2K0YA 2XV6A 2L22A 3GKLC 2P9XA 2VLOA 1OR5A 5HGOA 1UJZA 1GXGA 3G0VA 3LRYA
chains in the Genus database with same CATH topology
2PEQA 1IUQA 1G03A 5HGNA 3DS5A 3CCUP 4DGAC 3H0DA 1QVGO 1M9EC 1GWPA 3CD6P 5DCKA 1ZMBA 4PH3A 1YIJP 2PXRC 1EIAA 5F2KA 2BUOA 5F2OA 2OARA 3Q20A 4U0BA 2LF4A 2X83A 4XFXA 4IPYA 1VQLP 1M90Q 1YJNP 1VQOP 4LQWC 4M0IA 1S72P 1M1KQ 2JYLA 1QRJA 2X2DD 5HGMA 4E91A 5I4TG 1Q86Q 1M74A 1U7KA 4XFZA 5JPAA 3CCVP 3G71P 2M8NA 3CPWO 1VQMP 2EFJA 1A8OA 1EM9A 2JO0A 2KODA 3WBHA 2XT1A 2GONA 3G28A 3OW2O 3CCSP 2Z44A 2CWOA 3HZQA 3G6EP 1KQSO 3CC7P 1Q7YQ 5HGKA 1QVFO 2PY8A 1BAJA 3NTEA 3H47A 2PEJA 3B5IA 1K8AQ 2QEXP 5BS2A 3CMAP 4E92A 3G26A 3HYBA 4XRQA 2XGYA 2PEKA 3M1MA 4J93A 1M6NA 2L6EA 4COPA 1D1DA 1RO0A 1KD1Q 3G1IA 1A43A 4GR2A 3CCJP 3G29A 1RNIA 2X82A 3E2DA 3G21A 2JPRA 1VQ8P 1YI2P 3CCEP 2BHVA 1L6NA 1AK4C 2OTLP 1VQKP 2PENA 4PH0A 1AFVA 1K9MQ 1YHQP 2OTJP 1YJ9P 1VQ5P 4DGEC 3VRLC 2PEMA 3DTJA 3CC2P 5HGLA 3P05A 2PEIA 3MGEA 1Q82Q 3CCQP 1M6EX 1VQPP 1YITP 1VQNP 2PEOA 2PWOA 2WLVB 1M9XC 1K30A 2Z45A 3DS3A 4U0DA 1RO2A 3DS1A 2M8LA 4B4NA 2DGYA 2XXMA 2GOLB 5BS1A 1VQ4P 1VQ9P 2ONTA 3G4SP 4QNBA 1VQ6P 1KC8Q 1YJWP 4INBA 4PH2A 4XFYA 3CCMP 1NJIQ 1AUMA 4U0EA 2EIAA 3H4EA 3RG6C 1EOQA 2XDEA 3DS2A 1E6JP 4COCA 4WYMA 4U0AA 3G1GA 1P7NA 2JYGA 2XGUA 3BP9A 1JJ2O 4NX4C 3I55P 4U0FA 2Z46A 1K73Q 4HTWA 3DS4A 2XGVA 1M9FC 3CCRP 1W2BO 3CXCO 3CC4P 1M9DC 1N8RQ 3DPHA 3CCLP 2KGFA 2QA4P 1M9CC 3I56P 2E1MA 1Q81Q 2V4XA 2PWMA 4GR6A 2XV6A 2EG5A 4PH1A 4XROA 2Y4ZA 2P9XA 2M8PA 5F2NA 5HGOA 2WLVA 4U0CA 3CMEP 3DS0A 1M9YC 3G0VA 1VQ7P 3LRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G03 A;  5HGN A;  3DS5 A;  4DGA C;  1M9E C;  1GWP A;  5DCK A;  4PH3 A;  2PXR C;  1EIA A;  2BUO A;  4U0B A;  2LF4 A;  2X83 A;  4XFX A;  4IPY A;  4LQW C;  4M0I A;  2JYL A;  1QRJ A;  2X2D D;  5HGM A;  4E91 A;  5I4T G;  1U7K A;  4XFZ A;  5JPA A;  2M8N A;  1A8O A;  1EM9 A;  2JO0 A;  2KOD A;  2XT1 A;  2GON A;  3G28 A;  5HGK A;  1BAJ A;  3NTE A;  3H47 A;  4E92 A;  3G26 A;  4XRQ A;  2XGY A;  4J93 A;  2L6E A;  4COP A;  1D1D A;  3G1I A;  1A43 A;  3G29 A;  2X82 A;  3G21 A;  2JPR A;  1L6N A;  1AK4 C;  4PH0 A;  1AFV A;  4DGE C;  3VRL C;  3DTJ A;  5HGL A;  3P05 A;  3MGE A;  2PWO A;  2WLV B;  1M9X C;  3DS3 A;  4U0D A;  3DS1 A;  2M8L A;  4B4N A;  2XXM A;  2GOL B;  2ONT A;  4QNB A;  4INB A;  4PH2 A;  4XFY A;  1AUM A;  4U0E A;  2EIA A;  3H4E A;  1EOQ A;  2XDE A;  3DS2 A;  1E6J P;  4COC A;  4WYM A;  4U0A A;  3G1G A;  1P7N A;  2JYG A;  2XGU A;  3BP9 A;  4NX4 C;  4U0F A;  4HTW A;  3DS4 A;  2XGV A;  1M9F C;  1M9D C;  3DPH A;  2KGF A;  1M9C C;  2V4X A;  2PWM A;  2XV6 A;  4PH1 A;  4XRO A;  2Y4Z A;  2M8P A;  5HGO A;  2WLV A;  4U0C A;  3DS0 A;  1M9Y C;  3G0V A;  3LRY A; 
#chains in the Genus database with same CATH topology
 5HGN A;  3H0D A;  1QVG O;  1M9E C;  1GWP A;  3CD6 P;  3EJD A;  5F2O A;  2EHS A;  2ERH A;  2X83 A;  1YJN P;  1VQO P;  4LQW C;  1M1K Q;  1QRJ A;  2X2D D;  1Q86 Q;  2LIU A;  3CCV P;  2M8N A;  1VQM P;  2EFJ A;  1A8O A;  2JO0 A;  3G28 A;  2GON A;  4PXH B;  1L0H A;  3NTE A;  4IZ6 A;  4E92 A;  4XRQ A;  2CG5 B;  2EHT A;  2FVF A;  1A43 A;  3G1I A;  3G29 A;  2NO8 A;  4UHP B;  2BHV A;  1L6N A;  4H2W C;  2PEN A;  1K9M Q;  1YHQ P;  1VQ5 P;  4DGE C;  2KWL A;  5HGL A;  7CEI A;  1GXH A;  2GZG A;  1Q82 Q;  3CCQ P;  1IMQ A;  1VQP P;  2PEO A;  2PWO A;  1M9X C;  4U0D A;  2DGY A;  1DV5 A;  1VQ9 P;  3G4S P;  1KC8 Q;  4PH2 A;  4XFY A;  4U0E A;  5HV8 A;  3H4E A;  2N98 A;  4BPG A;  1T8K A;  3GZL A;  2K92 A;  2KOS A;  1JJ2 O;  2LIW A;  4NX4 C;  2VSQ A;  4U0F A;  1K73 Q;  3DS4 A;  1M9F C;  2CGQ A;  3CC4 P;  4R0M A;  2GZE A;  3DPH A;  1GPJ A;  2KGF A;  2FAC A;  2KGA A;  2E1M A;  2N6Z A;  2PWM A;  4GR6 A;  2DNW A;  4XRO A;  1Z6M A;  2K94 A;  2Y4Z A;  2M8P A;  3CME P;  3DS0 A;  1M9Y C;  1VQ7 P;  2JB0 A;  2PEQ A;  2JBG A;  4DGA C;  3NY7 B;  1ZMB A;  4PH3 A;  1YIJ P;  2PXR C;  5F2K A;  2BUO A;  3EJE A;  2L4B A;  5KP7 B;  2LF4 A;  4XFX A;  2GZI A;  4H2X C;  4H2Y C;  3LMO A;  1F80 D;  3B4Q A;  3CPW O;  1EM9 A;  2MR7 A;  3G6E P;  4F37 A;  1QVF O;  2K0D X;  2PY8 A;  2KG8 A;  1M6N A;  2L6E A;  2MR8 A;  1D1D A;  2JPR A;  2OTL P;  2LTE A;  4DG9 A;  1EMV A;  2QNW A;  2OTJ P;  3VRL C;  2PEM A;  1NQ4 A;  2PEI A;  4NEO A;  1YIT P;  1VHN A;  1ACP A;  2WLV B;  2FVE A;  1RO2 A;  3DS1 A;  2M8L A;  4B4N A;  2XXM A;  5BS1 A;  1VQ4 P;  4MRT C;  4QNB A;  1YJW P;  4BPH A;  2FQ1 A;  2FQ2 A;  2GDX A;  1AF8 A;  2L0Q A;  4U0A A;  1AYI A;  3G1G A;  2GDW A;  2JYG A;  3BP9 A;  3I55 P;  1MZ8 A;  2VLP A;  2XGV A;  2KGD A;  1W2B O;  2L9F A;  1M9D C;  5EJD A;  2QA4 P;  2GYK A;  3I56 P;  2EG5 A;  5F2N A;  1G03 A;  3DS5 A;  3CCU P;  2XZ1 C;  2MVV A;  1EIA A;  2FQ0 A;  1HY8 A;  4HKG A;  2JU1 A;  1VQL P;  1E0H A;  1M90 Q;  4M0I A;  2JAZ A;  2JQ4 A;  5HGM A;  4E91 A;  5I4T G;  1M74 A;  1U7K A;  2MVU A;  2WPT A;  2KOP A;  3G71 P;  2KOD A;  3WBH A;  2XT1 A;  1CEI A;  2AFD A;  3OW2 O;  2Z44 A;  2CWO A;  1KQS O;  1Q7Y Q;  3EJB A;  3H47 A;  2LPK A;  1K8A Q;  3G26 A;  1UNK A;  2AVA A;  2PEK A;  3M1M A;  4J93 A;  4COP A;  2GZJ A;  1RO0 A;  4BPF A;  1KD1 Q;  4GR2 A;  3GZM A;  3E2D A;  3G21 A;  5CZD B;  2LL8 A;  1YI2 P;  3CCE P;  4PH0 A;  2MY5 A;  2N6Y A;  3GJN A;  1YJ9 P;  2CNR A;  2M5R A;  3MGE A;  1M6E X;  1VQN P;  2VLN A;  3DS3 A;  2N5H A;  2GOL B;  2FVA A;  3CE7 A;  4INB A;  2AFE A;  2GDY A;  2KGE A;  2KOR A;  2LOL A;  3RG6 C;  1EOQ A;  2XDE A;  1E6J P;  4COC A;  1P7N A;  1KLP A;  2XGU A;  2Z46 A;  1VKU A;  3CCR P;  3CXC O;  1N8R Q;  2VLQ A;  5KP8 B;  1M9C C;  2V4X A;  1ZNV A;  4PH1 A;  2KOO A;  1BXI A;  2N50 A;  2WLV A;  4U0C A;  3CMA P;  1IUQ A;  5DCK A;  1X3O A;  2OAR A;  3Q20 A;  4U0B A;  5HVC A;  2N5I A;  4IPY A;  1S72 P;  2JYL A;  4XFZ A;  5JPA A;  3U43 A;  5KP6 B;  2JU2 A;  5EW5 E;  2KG9 A;  3CCS P;  1L0I A;  3HZQ A;  3CC7 P;  2LKI A;  5HGK A;  2FAE A;  1BAJ A;  2PEJ A;  3B5I A;  4CA3 A;  2QEX P;  5BS2 A;  2K5X A;  3HYB A;  2XGY A;  2ROQ A;  2LML A;  1FR2 A;  2KR5 A;  3CCJ P;  1RNI A;  2X82 A;  1VQ8 P;  3RG2 A;  1AK4 C;  1HQB A;  1VQK P;  4QKO A;  1AFV A;  2PNG A;  2GZF A;  2K2Q A;  3DTJ A;  4PWV B;  3CC2 P;  2KGC A;  3P05 A;  1IMP A;  2MD9 A;  2CQ8 A;  2K93 A;  1K30 A;  2Z45 A;  1DNY A;  2MF4 A;  2JGP A;  2KG6 A;  2ONT A;  1VQ6 P;  2X2B A;  2KW2 A;  3CCM P;  1NJI Q;  1AUM A;  2EIA A;  2XZ0 D;  2KOQ A;  3DS2 A;  4WYM A;  2K0X A;  2FAD A;  4HTW A;  3CCL P;  2AF8 A;  2FHS C;  1Q81 Q;  2K0Y A;  2XV6 A;  2L22 A;  3GKL C;  2P9X A;  2VLO A;  1OR5 A;  5HGO A;  1UJZ A;  1GXG A;  3G0V A;  3LRY A; 
#chains in the Genus database with same CATH homology
 2PEQ A;  1IUQ A;  1G03 A;  5HGN A;  3DS5 A;  3CCU P;  4DGA C;  3H0D A;  1QVG O;  1M9E C;  1GWP A;  3CD6 P;  5DCK A;  1ZMB A;  4PH3 A;  1YIJ P;  2PXR C;  1EIA A;  5F2K A;  2BUO A;  5F2O A;  2OAR A;  3Q20 A;  4U0B A;  2LF4 A;  2X83 A;  4XFX A;  4IPY A;  1VQL P;  1M90 Q;  1YJN P;  1VQO P;  4LQW C;  4M0I A;  1S72 P;  1M1K Q;  2JYL A;  1QRJ A;  2X2D D;  5HGM A;  4E91 A;  5I4T G;  1Q86 Q;  1M74 A;  1U7K A;  4XFZ A;  5JPA A;  3CCV P;  3G71 P;  2M8N A;  3CPW O;  1VQM P;  2EFJ A;  1A8O A;  1EM9 A;  2JO0 A;  2KOD A;  3WBH A;  2XT1 A;  2GON A;  3G28 A;  3OW2 O;  3CCS P;  2Z44 A;  2CWO A;  3HZQ A;  3G6E P;  1KQS O;  3CC7 P;  1Q7Y Q;  5HGK A;  1QVF O;  2PY8 A;  1BAJ A;  3NTE A;  3H47 A;  2PEJ A;  3B5I A;  1K8A Q;  2QEX P;  5BS2 A;  3CMA P;  4E92 A;  3G26 A;  3HYB A;  4XRQ A;  2XGY A;  2PEK A;  3M1M A;  4J93 A;  1M6N A;  2L6E A;  4COP A;  1D1D A;  1RO0 A;  1KD1 Q;  3G1I A;  1A43 A;  4GR2 A;  3CCJ P;  3G29 A;  1RNI A;  2X82 A;  3E2D A;  3G21 A;  2JPR A;  1VQ8 P;  1YI2 P;  3CCE P;  2BHV A;  1L6N A;  1AK4 C;  2OTL P;  1VQK P;  2PEN A;  4PH0 A;  1AFV A;  1K9M Q;  1YHQ P;  2OTJ P;  1YJ9 P;  1VQ5 P;  4DGE C;  3VRL C;  2PEM A;  3DTJ A;  3CC2 P;  5HGL A;  3P05 A;  2PEI A;  3MGE A;  1Q82 Q;  3CCQ P;  1M6E X;  1VQP P;  1YIT P;  1VQN P;  2PEO A;  2PWO A;  2WLV B;  1M9X C;  1K30 A;  2Z45 A;  3DS3 A;  4U0D A;  1RO2 A;  3DS1 A;  2M8L A;  4B4N A;  2DGY A;  2XXM A;  2GOL B;  5BS1 A;  1VQ4 P;  1VQ9 P;  2ONT A;  3G4S P;  4QNB A;  1VQ6 P;  1KC8 Q;  1YJW P;  4INB A;  4PH2 A;  4XFY A;  3CCM P;  1NJI Q;  1AUM A;  4U0E A;  2EIA A;  3H4E A;  3RG6 C;  1EOQ A;  2XDE A;  3DS2 A;  1E6J P;  4COC A;  4WYM A;  4U0A A;  3G1G A;  1P7N A;  2JYG A;  2XGU A;  3BP9 A;  1JJ2 O;  4NX4 C;  3I55 P;  4U0F A;  2Z46 A;  1K73 Q;  4HTW A;  3DS4 A;  2XGV A;  1M9F C;  3CCR P;  1W2B O;  3CXC O;  3CC4 P;  1M9D C;  1N8R Q;  3DPH A;  3CCL P;  2KGF A;  2QA4 P;  1M9C C;  3I56 P;  2E1M A;  1Q81 Q;  2V4X A;  2PWM A;  4GR6 A;  2XV6 A;  2EG5 A;  4PH1 A;  4XRO A;  2Y4Z A;  2P9X A;  2M8P A;  5F2N A;  5HGO A;  2WLV A;  4U0C A;  3CME P;  3DS0 A;  1M9Y C;  3G0V A;  1VQ7 P;  3LRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...