2EIAA

X-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
PRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAPPQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKPKAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EIAV CAPSID PROTEIN P26
publication title Model for lentivirus capsid core assembly based on crystal dimers of EIAV p26.
pubmed doi rcsb
source organism Equine infectious anemia virus
molecule tags Viral protein
total genus 75
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2eiaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eiaA02
1L6NA 5HGOA 2XXMA 1M9DC 2XGUA 4COPA 4XFZA 3DS1A 1D1DA 3G26A 4PH3A 2Y4ZA 2JYGA 2XV6A 2PWMA 2L6EA 4PH2A 3DS3A 2EIAA 4B4NA 2PXRC 2KODA 4DGEC 4U0FA 3NTEA 3H4EA 1EIAA 3DS2A 4INBA 2GOLB 4U0CA 2KGFA 2X83A 4QNBA 4U0DA 3DS0A 3DS4A 1M9YC 2LF4A 1BAJA 2XGVA 4E91A 1A8OA 2M8PA 1EOQA 5DCKA 4U0AA 1QRJA 1G03A 2JO0A 4U0BA 4XRQA 3LRYA 3VRLC 3G1IA 2WLVA 2WLVB 4XFYA 2PWOA 3G21A 4E92A 2M8LA 5I4TG 4WYMA 1M9FC 4M0IA 2GONA 4LQWC 1GWPA 2XT1A 3DPHA 5JPAA 5HGMA 4XFXA 4PH0A 3G29A 3DTJA 4XROA 2XGYA 1AUMA 1EM9A 4PH1A 1AFVA 1M9XC 2M8NA 3DS5A 1M9CC 3G0VA 4IPYA 2BUOA 4NX4C 3P05A 1U7KA 2JYLA 4U0EA 5HGNA 5HGLA 4COCA 4DGAC 5HGKA 1E6JP 2XDEA 3G28A 1P7NA 2ONTA 2JPRA 2X2DD 3H47A 2X82A 3G1GA 3BP9A 1A43A 1AK4C 4HTWA 1M9EC 3MGEA 2V4XA 4J93A
chains in the Genus database with same CATH superfamily
2PEIA 2K0DX 1M9DC 2XGUA 2MF4A 1VQ4P 2GZFA 1RNIA 3HZQA 2Y4ZA 2XV6A 3RG2A 3OW2O 2PXRC 2KODA 3CMAP 2KGDA 2GDXA 2XZ1C 3CPWO 3DS2A 3CE7A 2GOLB 2K0XA 2ROQA 2KR5A 4U0CA 2KGFA 2AVAA 2Z45A 3CCJP 2KG8A 4BPFA 1L0IA 1YJNP 4QKOA 1K30A 1M6NA 2K0YA 2FAEA 3LRYA 1N8RQ 3G1IA 2FVEA 4XFYA 5KP8B 1DNYA 4WYMA 1GPJA 2P9XA 3CC4P 2JB0A 3CMEP 2BHVA 2LL8A 5HVCA 2MR7A 2X2BA 3G6EP 2GONA 4R0MA 2FQ0A 3GZLA 3B5IA 4GR2A 4PH0A 2FQ2A 3G29A 2K93A 3DTJA 3CC7P 3GJNA 1AUMA 1EM9A 2N98A 1AFVA 1M9XC 2M8NA 1IUQA 3DS5A 3CCLP 3U43A 1UJZA 1GXGA 2LMLA 2JBGA 2FADA 1YJ9P 1U7KA 3CD6P 1KQSO 2WPTA 2KGAA 5HGKA 1HQBA 1E6JP 2XDEA 2LTEA 2L4BA 1P7NA 3Q20A 1EMVA 1W2BO 3G1GA 5CZDB 1YI2P 1KC8Q 1VQMP 4GR6A 3RG6C 1M74A 2XZ0D 1VQKP 1K73Q 2CWOA 2OTJP 1QVGO 2GZEA 2VSQA 1YHQP 2E1MA 2JYGA 2PENA 2AFDA 2LKIA 4DGEC 1Q7YQ 4U0FA 2MVVA 2KOSA 3H4EA 3CXCO 5KP6B 1ZNVA 2FVFA 1VQPP 4QNBA 2PEJA 2NO8A 2GZJA 4E91A 2M8PA 5DCKA 4XRQA 2N5IA 1M1KQ 2MY5A 3G21A 4NEOA 4IZ6A 1HY8A 2JU2A 2XT1A 5HGMA 5F2NA 2VLOA 1VKUA 2MR8A 2OTLP 1RO2A 3G0VA 1JJ2O 2EFJA 2MD9A 2L9FA 2AF8A 2JYLA 5HGNA 2VLQA 2PEMA 4COCA 2KOPA 5BS2A 1VQ6P 4DGAC 1CEIA 1AYIA 1VHNA 2GDYA 3I55P 2KG9A 1Q86Q 1T8KA 4F37A 1K8AQ 2X82A 2CQ8A 5BS1A 2M5RA 2CNRA 2PEQA 1X3OA 2LPKA 4HTWA 1M9EC 2K2QA 4J93A 5HGOA 2XXMA 2LIWA 2DNWA 4XFZA 1FR2A 4UHPB 2EG5A 1D1DA 3G26A 2EHTA 4PWVB 2PWMA 2L6EA 4PH2A 3DS3A 1Q82Q 2N5HA 1UNKA 2KGCA 3NTEA 2GYKA 1NJIQ 1VQ9P 1EIAA 2KOOA 2KWLA 1YITP 1IMQA 2MVUA 2X83A 4U0DA 3DS0A 1S72P 3DS4A 2K94A 1M9YC 2LF4A 1BAJA 2XGVA 1A8OA 3G4SP 1EOQA 4U0AA 1QRJA 2JO0A 4U0BA 1VQLP 4H2XC 3VRLC 2WLVB 2PWOA 3HYBA 4E92A 5I4TG 2K5XA 1M9FC 3E2DA 2FACA 3B4QA 4M0IA 1VQNP 2GZIA 4LQWC 1VQ8P 5EW5E 4XFXA 5KP7B 3I56P 1VQ5P 2XGYA 1M6EX 4BPGA 4PH1A 4DG9A 2AFEA 2FVAA 1F80D 2PNGA 5F2KA 2K92A 3GKLC 3CCMP 1VQ7P 4NX4C 2EHSA 1YIJP 1KD1Q 3EJEA 3P05A 4U0EA 5HV8A 1E0HA 2Z46A 3G28A 1NQ4A 3WBHA 1IMPA 1KLPA 1M90Q 2QEXP 2ONTA 2JPRA 4PXHB 3H47A 1Z6MA 2JAZA 1A43A 3CCEP 1MZ8A 2KGEA 2OARA 2L22A 2JQ4A 3EJBA 3MGEA 2V4XA 4MRTC 1L6NA 3CCVP 2PEKA 4COPA 3DS1A 4PH3A 1Q81Q 1RO0A 2QNWA 1L0HA 2GZGA 5F2OA 2EIAA 4B4NA 3EJDA 4BPHA 2PY8A 2ERHA 4INBA 1OR5A 1VQOP 2FHSC 1ACPA 2L0QA 4H2WC 3CCSP 2JGPA 2VLPA 1BXIA 4HKGA 1G03A 2LIUA 1K9MQ 2WLVA 3NY7B 2M8LA 2DGYA 2LOLA 1AF8A 2VLNA 3CCQP 3G71P 2CGQA 2KORA 1GWPA 1ZMBA 3DPHA 5JPAA 2GDWA 5EJDA 1YJWP 4XROA 3LMOA 2N6ZA 1M9CC 3M1MA 4IPYA 2BUOA 2FQ1A 2KG6A 2N50A 2CG5B 2Z44A 3H0DA 1QVFO 5HGLA 2JU1A 2N6YA 1DV5A 7CEIA 2KOQA 2X2DD 3CCRP 3BP9A 4H2YC 1GXHA 2KW2A 3GZMA 2PEOA 1AK4C 2QA4P 4CA3A 3CC2P 3CCUP
chains in the Genus database with same CATH topology
1L6NA 5HGOA 2PEIA 1QVGO 3CCVP 2PEKA 2XXMA 1M9DC 2XGUA 4COPA 4XFZA 1VQ4P 3DS1A 2EG5A 1D1DA 1RNIA 3G26A 4PH3A 3HZQA 1YHQP 2Y4ZA 2E1MA 2JYGA 2XV6A 1Q81Q 2PWMA 2L6EA 1RO0A 5F2OA 4PH2A 3DS3A 2EIAA 4B4NA 2PENA 1Q82Q 3OW2O 2PXRC 2KODA 4DGEC 3CMAP 1Q7YQ 4U0FA 3NTEA 2PY8A 3CPWO 3H4EA 3CXCO 1NJIQ 1VQ9P 1EIAA 3DS2A 4INBA 2GOLB 1YITP 1VQOP 4U0CA 2KGFA 2X83A 2Z45A 1VQPP 4QNBA 3CCJP 4U0DA 3DS0A 3CCSP 1S72P 2PEJA 3DS4A 1M9YC 2LF4A 1BAJA 1YJNP 2XGVA 4E91A 1A8OA 1K30A 3G4SP 1M6NA 2M8PA 1EOQA 5DCKA 4U0AA 1QRJA 1G03A 2JO0A 4U0BA 1VQLP 4XRQA 3LRYA 3VRLC 1N8RQ 3G1IA 1M1KQ 1K9MQ 2WLVA 2WLVB 4XFYA 2PWOA 3G21A 3HYBA 4E92A 2M8LA 2DGYA 5I4TG 4WYMA 2P9XA 3CC4P 1M9FC 3E2DA 3CMEP 2BHVA 3CCQP 3G71P 4M0IA 3G6EP 1VQNP 2GONA 4LQWC 1GWPA 1ZMBA 2XT1A 3DPHA 5JPAA 1VQ8P 5HGMA 2OTJP 3B5IA 4GR2A 4XFXA 4PH0A 5F2NA 3I56P 3G29A 3DTJA 1YJWP 3CC7P 1VQ5P 4XROA 2XGYA 1AUMA 1EM9A 1M6EX 4PH1A 1AFVA 2OTLP 1M9XC 1RO2A 2M8NA 1IUQA 3DS5A 1M9CC 3G0VA 5F2KA 3M1MA 4IPYA 1JJ2O 2BUOA 2EFJA 3CCLP 3CCMP 1VQ7P 4NX4C 1YIJP 1KD1Q 3P05A 1YJ9P 1U7KA 2JYLA 2Z44A 3H0DA 4U0EA 5HGNA 1QVFO 5HGLA 2Z46A 2PEMA 4COCA 3CD6P 5BS2A 1KQSO 1VQ6P 4DGAC 5HGKA 1E6JP 2XDEA 3G28A 3I55P 3WBHA 1M90Q 1P7NA 2QEXP 1Q86Q 3Q20A 1K8AQ 2ONTA 2JPRA 2X2DD 3H47A 1W2BO 3CCRP 2X82A 3G1GA 1YI2P 5BS1A 3BP9A 1KC8Q 2PEQA 2PEOA 1A43A 1AK4C 1VQMP 2QA4P 4GR6A 3CCEP 2OARA 3RG6C 1M74A 4HTWA 1M9EC 3MGEA 2V4XA 3CC2P 1VQKP 1K73Q 2CWOA 3CCUP 4J93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6N A;  5HGO A;  2XXM A;  1M9D C;  2XGU A;  4COP A;  4XFZ A;  3DS1 A;  1D1D A;  3G26 A;  4PH3 A;  2Y4Z A;  2JYG A;  2XV6 A;  2PWM A;  2L6E A;  4PH2 A;  3DS3 A;  2EIA A;  4B4N A;  2PXR C;  2KOD A;  4DGE C;  4U0F A;  3NTE A;  3H4E A;  1EIA A;  3DS2 A;  4INB A;  2GOL B;  4U0C A;  2KGF A;  2X83 A;  4QNB A;  4U0D A;  3DS0 A;  3DS4 A;  1M9Y C;  2LF4 A;  1BAJ A;  2XGV A;  4E91 A;  1A8O A;  2M8P A;  1EOQ A;  5DCK A;  4U0A A;  1QRJ A;  1G03 A;  2JO0 A;  4U0B A;  4XRQ A;  3LRY A;  3VRL C;  3G1I A;  2WLV A;  2WLV B;  4XFY A;  2PWO A;  3G21 A;  4E92 A;  2M8L A;  5I4T G;  4WYM A;  1M9F C;  4M0I A;  2GON A;  4LQW C;  1GWP A;  2XT1 A;  3DPH A;  5JPA A;  5HGM A;  4XFX A;  4PH0 A;  3G29 A;  3DTJ A;  4XRO A;  2XGY A;  1AUM A;  1EM9 A;  4PH1 A;  1AFV A;  1M9X C;  2M8N A;  3DS5 A;  1M9C C;  3G0V A;  4IPY A;  2BUO A;  4NX4 C;  3P05 A;  1U7K A;  2JYL A;  4U0E A;  5HGN A;  5HGL A;  4COC A;  4DGA C;  5HGK A;  1E6J P;  2XDE A;  3G28 A;  1P7N A;  2ONT A;  2JPR A;  2X2D D;  3H47 A;  2X82 A;  3G1G A;  3BP9 A;  1A43 A;  1AK4 C;  4HTW A;  1M9E C;  3MGE A;  2V4X A;  4J93 A; 
#chains in the Genus database with same CATH topology
 2PEI A;  2K0D X;  1M9D C;  2XGU A;  2MF4 A;  1VQ4 P;  2GZF A;  1RNI A;  3HZQ A;  2Y4Z A;  2XV6 A;  3RG2 A;  3OW2 O;  2PXR C;  2KOD A;  3CMA P;  2KGD A;  2GDX A;  2XZ1 C;  3CPW O;  3DS2 A;  3CE7 A;  2GOL B;  2K0X A;  2ROQ A;  2KR5 A;  4U0C A;  2KGF A;  2AVA A;  2Z45 A;  3CCJ P;  2KG8 A;  4BPF A;  1L0I A;  1YJN P;  4QKO A;  1K30 A;  1M6N A;  2K0Y A;  2FAE A;  3LRY A;  1N8R Q;  3G1I A;  2FVE A;  4XFY A;  5KP8 B;  1DNY A;  4WYM A;  1GPJ A;  2P9X A;  3CC4 P;  2JB0 A;  3CME P;  2BHV A;  2LL8 A;  5HVC A;  2MR7 A;  2X2B A;  3G6E P;  2GON A;  4R0M A;  2FQ0 A;  3GZL A;  3B5I A;  4GR2 A;  4PH0 A;  2FQ2 A;  3G29 A;  2K93 A;  3DTJ A;  3CC7 P;  3GJN A;  1AUM A;  1EM9 A;  2N98 A;  1AFV A;  1M9X C;  2M8N A;  1IUQ A;  3DS5 A;  3CCL P;  3U43 A;  1UJZ A;  1GXG A;  2LML A;  2JBG A;  2FAD A;  1YJ9 P;  1U7K A;  3CD6 P;  1KQS O;  2WPT A;  2KGA A;  5HGK A;  1HQB A;  1E6J P;  2XDE A;  2LTE A;  2L4B A;  1P7N A;  3Q20 A;  1EMV A;  1W2B O;  3G1G A;  5CZD B;  1YI2 P;  1KC8 Q;  1VQM P;  4GR6 A;  3RG6 C;  1M74 A;  2XZ0 D;  1VQK P;  1K73 Q;  2CWO A;  2OTJ P;  1QVG O;  2GZE A;  2VSQ A;  1YHQ P;  2E1M A;  2JYG A;  2PEN A;  2AFD A;  2LKI A;  4DGE C;  1Q7Y Q;  4U0F A;  2MVV A;  2KOS A;  3H4E A;  3CXC O;  5KP6 B;  1ZNV A;  2FVF A;  1VQP P;  4QNB A;  2PEJ A;  2NO8 A;  2GZJ A;  4E91 A;  2M8P A;  5DCK A;  4XRQ A;  2N5I A;  1M1K Q;  2MY5 A;  3G21 A;  4NEO A;  4IZ6 A;  1HY8 A;  2JU2 A;  2XT1 A;  5HGM A;  5F2N A;  2VLO A;  1VKU A;  2MR8 A;  2OTL P;  1RO2 A;  3G0V A;  1JJ2 O;  2EFJ A;  2MD9 A;  2L9F A;  2AF8 A;  2JYL A;  5HGN A;  2VLQ A;  2PEM A;  4COC A;  2KOP A;  5BS2 A;  1VQ6 P;  4DGA C;  1CEI A;  1AYI A;  1VHN A;  2GDY A;  3I55 P;  2KG9 A;  1Q86 Q;  1T8K A;  4F37 A;  1K8A Q;  2X82 A;  2CQ8 A;  5BS1 A;  2M5R A;  2CNR A;  2PEQ A;  1X3O A;  2LPK A;  4HTW A;  1M9E C;  2K2Q A;  4J93 A;  5HGO A;  2XXM A;  2LIW A;  2DNW A;  4XFZ A;  1FR2 A;  4UHP B;  2EG5 A;  1D1D A;  3G26 A;  2EHT A;  4PWV B;  2PWM A;  2L6E A;  4PH2 A;  3DS3 A;  1Q82 Q;  2N5H A;  1UNK A;  2KGC A;  3NTE A;  2GYK A;  1NJI Q;  1VQ9 P;  1EIA A;  2KOO A;  2KWL A;  1YIT P;  1IMQ A;  2MVU A;  2X83 A;  4U0D A;  3DS0 A;  1S72 P;  3DS4 A;  2K94 A;  1M9Y C;  2LF4 A;  1BAJ A;  2XGV A;  1A8O A;  3G4S P;  1EOQ A;  4U0A A;  1QRJ A;  2JO0 A;  4U0B A;  1VQL P;  4H2X C;  3VRL C;  2WLV B;  2PWO A;  3HYB A;  4E92 A;  5I4T G;  2K5X A;  1M9F C;  3E2D A;  2FAC A;  3B4Q A;  4M0I A;  1VQN P;  2GZI A;  4LQW C;  1VQ8 P;  5EW5 E;  4XFX A;  5KP7 B;  3I56 P;  1VQ5 P;  2XGY A;  1M6E X;  4BPG A;  4PH1 A;  4DG9 A;  2AFE A;  2FVA A;  1F80 D;  2PNG A;  5F2K A;  2K92 A;  3GKL C;  3CCM P;  1VQ7 P;  4NX4 C;  2EHS A;  1YIJ P;  1KD1 Q;  3EJE A;  3P05 A;  4U0E A;  5HV8 A;  1E0H A;  2Z46 A;  3G28 A;  1NQ4 A;  3WBH A;  1IMP A;  1KLP A;  1M90 Q;  2QEX P;  2ONT A;  2JPR A;  4PXH B;  3H47 A;  1Z6M A;  2JAZ A;  1A43 A;  3CCE P;  1MZ8 A;  2KGE A;  2OAR A;  2L22 A;  2JQ4 A;  3EJB A;  3MGE A;  2V4X A;  4MRT C;  1L6N A;  3CCV P;  2PEK A;  4COP A;  3DS1 A;  4PH3 A;  1Q81 Q;  1RO0 A;  2QNW A;  1L0H A;  2GZG A;  5F2O A;  2EIA A;  4B4N A;  3EJD A;  4BPH A;  2PY8 A;  2ERH A;  4INB A;  1OR5 A;  1VQO P;  2FHS C;  1ACP A;  2L0Q A;  4H2W C;  3CCS P;  2JGP A;  2VLP A;  1BXI A;  4HKG A;  1G03 A;  2LIU A;  1K9M Q;  2WLV A;  3NY7 B;  2M8L A;  2DGY A;  2LOL A;  1AF8 A;  2VLN A;  3CCQ P;  3G71 P;  2CGQ A;  2KOR A;  1GWP A;  1ZMB A;  3DPH A;  5JPA A;  2GDW A;  5EJD A;  1YJW P;  4XRO A;  3LMO A;  2N6Z A;  1M9C C;  3M1M A;  4IPY A;  2BUO A;  2FQ1 A;  2KG6 A;  2N50 A;  2CG5 B;  2Z44 A;  3H0D A;  1QVF O;  5HGL A;  2JU1 A;  2N6Y A;  1DV5 A;  7CEI A;  2KOQ A;  2X2D D;  3CCR P;  3BP9 A;  4H2Y C;  1GXH A;  2KW2 A;  3GZM A;  2PEO A;  1AK4 C;  2QA4 P;  4CA3 A;  3CC2 P;  3CCU P; 
#chains in the Genus database with same CATH homology
 1L6N A;  5HGO A;  2PEI A;  1QVG O;  3CCV P;  2PEK A;  2XXM A;  1M9D C;  2XGU A;  4COP A;  4XFZ A;  1VQ4 P;  3DS1 A;  2EG5 A;  1D1D A;  1RNI A;  3G26 A;  4PH3 A;  3HZQ A;  1YHQ P;  2Y4Z A;  2E1M A;  2JYG A;  2XV6 A;  1Q81 Q;  2PWM A;  2L6E A;  1RO0 A;  5F2O A;  4PH2 A;  3DS3 A;  2EIA A;  4B4N A;  2PEN A;  1Q82 Q;  3OW2 O;  2PXR C;  2KOD A;  4DGE C;  3CMA P;  1Q7Y Q;  4U0F A;  3NTE A;  2PY8 A;  3CPW O;  3H4E A;  3CXC O;  1NJI Q;  1VQ9 P;  1EIA A;  3DS2 A;  4INB A;  2GOL B;  1YIT P;  1VQO P;  4U0C A;  2KGF A;  2X83 A;  2Z45 A;  1VQP P;  4QNB A;  3CCJ P;  4U0D A;  3DS0 A;  3CCS P;  1S72 P;  2PEJ A;  3DS4 A;  1M9Y C;  2LF4 A;  1BAJ A;  1YJN P;  2XGV A;  4E91 A;  1A8O A;  1K30 A;  3G4S P;  1M6N A;  2M8P A;  1EOQ A;  5DCK A;  4U0A A;  1QRJ A;  1G03 A;  2JO0 A;  4U0B A;  1VQL P;  4XRQ A;  3LRY A;  3VRL C;  1N8R Q;  3G1I A;  1M1K Q;  1K9M Q;  2WLV A;  2WLV B;  4XFY A;  2PWO A;  3G21 A;  3HYB A;  4E92 A;  2M8L A;  2DGY A;  5I4T G;  4WYM A;  2P9X A;  3CC4 P;  1M9F C;  3E2D A;  3CME P;  2BHV A;  3CCQ P;  3G71 P;  4M0I A;  3G6E P;  1VQN P;  2GON A;  4LQW C;  1GWP A;  1ZMB A;  2XT1 A;  3DPH A;  5JPA A;  1VQ8 P;  5HGM A;  2OTJ P;  3B5I A;  4GR2 A;  4XFX A;  4PH0 A;  5F2N A;  3I56 P;  3G29 A;  3DTJ A;  1YJW P;  3CC7 P;  1VQ5 P;  4XRO A;  2XGY A;  1AUM A;  1EM9 A;  1M6E X;  4PH1 A;  1AFV A;  2OTL P;  1M9X C;  1RO2 A;  2M8N A;  1IUQ A;  3DS5 A;  1M9C C;  3G0V A;  5F2K A;  3M1M A;  4IPY A;  1JJ2 O;  2BUO A;  2EFJ A;  3CCL P;  3CCM P;  1VQ7 P;  4NX4 C;  1YIJ P;  1KD1 Q;  3P05 A;  1YJ9 P;  1U7K A;  2JYL A;  2Z44 A;  3H0D A;  4U0E A;  5HGN A;  1QVF O;  5HGL A;  2Z46 A;  2PEM A;  4COC A;  3CD6 P;  5BS2 A;  1KQS O;  1VQ6 P;  4DGA C;  5HGK A;  1E6J P;  2XDE A;  3G28 A;  3I55 P;  3WBH A;  1M90 Q;  1P7N A;  2QEX P;  1Q86 Q;  3Q20 A;  1K8A Q;  2ONT A;  2JPR A;  2X2D D;  3H47 A;  1W2B O;  3CCR P;  2X82 A;  3G1G A;  1YI2 P;  5BS1 A;  3BP9 A;  1KC8 Q;  2PEQ A;  2PEO A;  1A43 A;  1AK4 C;  1VQM P;  2QA4 P;  4GR6 A;  3CCE P;  2OAR A;  3RG6 C;  1M74 A;  4HTW A;  1M9E C;  3MGE A;  2V4X A;  3CC2 P;  1VQK P;  1K73 Q;  2CWO A;  3CCU P;  4J93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...