2EIAA

X-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
b'PRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAPPQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKPKAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EIAV CAPSID PROTEIN P26
molecule tags Viral protein
source organism Equine infectious anemia virus
publication title Model for lentivirus capsid core assembly based on crystal dimers of EIAV p26.
pubmed doi rcsb
total genus 75
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2eiaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eiaA02
4PH1A 2JPRA 2X83A 4XFXA 4NX4C 4U0CA 2GONA 2BUOA 4U0FA 3G0VA 4PH3A 4B4NA 4PH0A 2M8NA 2PWMA 2XT1A 1M9CC 3NTEA 3DS2A 2JYLA 1A43A 2XGUA 4DGAC 3MGEA 3H4EA 4E92A 2M8LA 1GWPA 4U0BA 4LQWC 4U0EA 2XV6A 3BP9A 4QNBA 1G03A 5HGMA 3DPHA 4IPYA 1EM9A 1E6JP 2M8PA 3P05A 1M9DC 2EIAA 3G21A 5I4TG 4XRQA 2V4XA 1BAJA 3DS4A 2GOLB 3LRYA 3DS3A 4COCA 1M9EC 2XXMA 3H47A 2XGYA 2WLVB 4INBA 4U0DA 3G26A 3DS1A 1AK4C 4J93A 2JYGA 2WLVA 1P7NA 5HGKA 4HTWA 2PXRC 1M9XC 3DTJA 1AUMA 2L6EA 2Y4ZA 4M0IA 4XFYA 2LF4A 1M9FC 4WYMA 3G29A 1M9YC 2KODA 1QRJA 5HGOA 3DS0A 2X82A 3G1GA 2ONTA 3DS5A 5DCKA 1AFVA 2X2DD 4DGEC 2JO0A 4E91A 1EIAA 4U0AA 5HGLA 1D1DA 1U7KA 4XFZA 1EOQA 4COPA 5HGNA 2KGFA 2PWOA 1A8OA 3G28A 3VRLC 2XGVA 3G1IA 2XDEA 5JPAA 1L6NA 4PH2A 4XROA
chains in the Genus database with same CATH superfamily
1VQOP 4XFXA 2GONA 2BUOA 3G0VA 2FHSC 2PEQA 2MF4A 2KGEA 4B4NA 2PWMA 3NTEA 3DS2A 2Z44A 2AFEA 5CZDB 3GKLC 3H4EA 2XV6A 2L0QA 3BP9A 4BPHA 2LOLA 4QNBA 4CA3A 1G03A 2OTLP 5HGMA 3DPHA 3H0DA 2K93A 1E6JP 2FVFA 1RNIA 2GZFA 3G21A 3DS4A 1CEIA 3LRYA 3DS3A 1Q81Q 4F37A 3H47A 2MY5A 3EJDA 3LMOA 3GZLA 3DS1A 2PNGA 2VLOA 3GZMA 3I56P 2M5RA 1K8AQ 3GJNA 5HGKA 2KG6A 2N5IA 2Y4ZA 3CCEP 1YITP 3HYBA 3CCJP 1VHNA 1M9FC 3G29A 1M9YC 2K0XA 1VKUA 3CD6P 3Q20A 2PEJA 2KGCA 1L6NA 3G1GA 2ONTA 2AVAA 3DS5A 2FVAA 4MRTC 2CGQA 4GR6A 3E2DA 3RG2A 1T8KA 2LIUA 1EIAA 2GZGA 4COPA 2K0YA 1YIJP 5HGNA 2KGFA 2PWOA 1EMVA 2X2BA 4UHPB 2KG8A 2XGVA 1HY8A 2PEIA 2XDEA 4DG9A 5JPAA 2CNRA 3NY7B 2CWOA 4PH1A 2JPRA 3CC7P 4NX4C 4U0CA 5F2NA 4U0FA 3U43A 3CCUP 2EG5A 1DNYA 1RO2A 2DGYA 3MGEA 4U0BA 4LQWC 2XZ1C 1M74A 1VQMP 2Z45A 1EM9A 4H2WC 5BS1A 2KW2A 2OARA 3P05A 3EJEA 2KWLA 1BAJA 4COCA 2L4BA 3CCQP 1K73Q 2P9XA 3G6EP 2JGPA 1ACPA 4J93A 3CCMP 2JYGA 2OTJP 2ERHA 1N8RQ 2GZJA 1X3OA 2FACA 5EW5E 2LTEA 1UNKA 1AUMA 2PEKA 1BXIA 2K94A 2XZ0D 3I55P 2EHSA 1KQSO 1QRJA 3CC4P 1IUQA 1GPJA 2GZEA 2MD9A 1NJIQ 5DCKA 2X2DD 1YJNP 2AFDA 1GXGA 1VQ4P 2JO0A 2L9FA 2K5XA 5HGLA 1D1DA 1Q82Q 5KP7B 1VQ5P 2KOQA 3G28A 7CEIA 1YI2P 1VQKP 1AF8A 1YHQP 3EJBA 3CCVP 2PEMA 1K30A 1F80D 1KLPA 2JAZA 5F2KA 4PH0A 3CCSP 2JYLA 4DGAC 1M6NA 4GR2A 4H2XC 4E92A 1GWPA 1FR2A 4U0EA 1RO0A 2PEOA 1HQBA 2AF8A 2DNWA 2MR7A 1ZMBA 2L22A 1DV5A 2NO8A 2M8PA 2MVVA 2EIAA 4XRQA 2V4XA 2MVUA 1GXHA 2GDXA 2GZIA 1E0HA 4PXHB 1M9EC 2JB0A 2XXMA 2K92A 1AYIA 1MZ8A 4U0DA 3G26A 3CCRP 3CE7A 1VQLP 2FAEA 1P7NA 2QEXP 4HTWA 2PXRC 1M9XC 3DTJA 1QVGO 2Z46A 2K0DX 4M0IA 3CCLP 2KOOA 1K9MQ 3CMEP 4WYMA 1W2BO 2MR8A 2PY8A 2N6YA 1VQ9P 5HVCA 2N50A 2LMLA 1OR5A 2CG5B 4IZ6A 1AFVA 1KC8Q 1Q7YQ 2CQ8A 2GDYA 4U0AA 1VQ8P 1EOQA 1NQ4A 2N98A 5EJDA 1A8OA 2FQ2A 2KG9A 3VRLC 3G4SP 1Q86Q 1QVFO 3G1IA 5F2OA 1M6EX 2LL8A 4PH2A 2X83A 2JU2A 1L0IA 3M1MA 4PH3A 2JBGA 3RG6C 2M8NA 1M9CC 4NEOA 4QKOA 1YJWP 2N5HA 1A43A 3B5IA 2XGUA 1VQNP 2VLQA 4BPFA 1M90Q 2VSQA 2M8LA 1L0HA 5KP6B 2JU1A 1UJZA 2GDWA 2VLNA 4IPYA 2QA4P 1IMQA 2E1MA 3HZQA 1M9DC 1ZNVA 3OW2O 5I4TG 2PENA 2JQ4A 2GOLB 5KP8B 4INBA 2XGYA 2WLVB 1Z6MA 1IMPA 1AK4C 2FADA 2N6ZA 3CMAP 2WLVA 4PWVB 3G71P 2KR5A 1JJ2O 3CC2P 2BHVA 1VQ6P 2L6EA 2LIWA 5BS2A 1VQ7P 2QNWA 4XFYA 2LF4A 2KODA 1KD1Q 2KGDA 5HGOA 3DS0A 2X82A 2LPKA 4H2YC 3B4QA 1YJ9P 2VLPA 2FVEA 2EHTA 3WBHA 3CXCO 4DGEC 1S72P 2FQ0A 5HV8A 1M1KQ 4HKGA 2KOPA 2KORA 4E91A 2K2QA 2GYKA 2ROQA 1U7KA 4XFZA 2KGAA 4R0MA 3CPWO 2FQ1A 2KOSA 2WPTA 4BPGA 1VQPP 2EFJA 2LKIA 2XT1A 4XROA
chains in the Genus database with same CATH topology
1K30A 2CWOA 4PH1A 2JPRA 2X83A 1VQOP 3CC7P 4XFXA 3M1MA 4NX4C 4U0CA 2GONA 5F2NA 5F2KA 2BUOA 4U0FA 3G0VA 4PH3A 2PEQA 3RG6C 4B4NA 4PH0A 2M8NA 2PWMA 3CCSP 2XT1A 1M9CC 3NTEA 3CCUP 2EG5A 3DS2A 1YJWP 2JYLA 3B5IA 1A43A 2Z44A 2XGUA 1VQNP 4DGAC 1RO2A 2DGYA 1M6NA 4GR2A 3MGEA 3H4EA 1M90Q 4E92A 2M8LA 1GWPA 4U0BA 4LQWC 4U0EA 2XV6A 3BP9A 1RO0A 4QNBA 1M74A 2PEOA 1VQMP 2Z45A 1G03A 2OTLP 5HGMA 3DPHA 4IPYA 3H0DA 1EM9A 2QA4P 1ZMBA 5BS1A 2E1MA 1E6JP 2M8PA 2OARA 1RNIA 3HZQA 3P05A 1M9DC 2EIAA 3G21A 5I4TG 4XRQA 2V4XA 2PENA 1BAJA 3DS4A 3OW2O 2GOLB 3LRYA 3DS3A 1Q81Q 4COCA 1M9EC 2XXMA 3CCQP 3H47A 2XGYA 2WLVB 4INBA 2P9XA 3G6EP 1K73Q 4U0DA 3G26A 3DS1A 3CCRP 1AK4C 1VQLP 4J93A 3CCMP 2JYGA 3I56P 2OTJP 3CMAP 1K8AQ 2WLVA 1P7NA 3G71P 2QEXP 5HGKA 1N8RQ 4HTWA 2PXRC 1M9XC 1JJ2O 3CC2P 3DTJA 2BHVA 1AUMA 1VQ6P 2L6EA 2Y4ZA 2Z46A 1QVGO 4M0IA 2PEKA 3CCEP 5BS2A 1YITP 3CCLP 3HYBA 3CCJP 1VQ7P 1K9MQ 3CMEP 4XFYA 2LF4A 1M9FC 4WYMA 3G29A 3I55P 1M9YC 2KODA 1W2BO 3CD6P 1KD1Q 1KQSO 2PY8A 3Q20A 1QRJA 3CC4P 1IUQA 2PEJA 1VQ9P 5HGOA 3DS0A 2X82A 3G1GA 2ONTA 1NJIQ 1YJ9P 3DS5A 5DCKA 3WBHA 3CXCO 1AFVA 1KC8Q 2X2DD 4DGEC 4GR6A 1S72P 1YJNP 1M1KQ 3E2DA 1Q7YQ 1VQ4P 2JO0A 4E91A 1EIAA 4U0AA 5HGLA 1D1DA 1Q82Q 1VQ8P 1U7KA 4XFZA 1EOQA 1VQ5P 4COPA 3CPWO 1YIJP 5HGNA 2KGFA 2PWOA 1A8OA 3G28A 1YI2P 1VQKP 1VQPP 1YHQP 3VRLC 3G4SP 1Q86Q 2EFJA 2XGVA 3G1IA 5F2OA 1QVFO 2PEIA 2XDEA 1M6EX 3CCVP 5JPAA 2PEMA 1L6NA 4PH2A 4XROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PH1 A;  2JPR A;  2X83 A;  4XFX A;  4NX4 C;  4U0C A;  2GON A;  2BUO A;  4U0F A;  3G0V A;  4PH3 A;  4B4N A;  4PH0 A;  2M8N A;  2PWM A;  2XT1 A;  1M9C C;  3NTE A;  3DS2 A;  2JYL A;  1A43 A;  2XGU A;  4DGA C;  3MGE A;  3H4E A;  4E92 A;  2M8L A;  1GWP A;  4U0B A;  4LQW C;  4U0E A;  2XV6 A;  3BP9 A;  4QNB A;  1G03 A;  5HGM A;  3DPH A;  4IPY A;  1EM9 A;  1E6J P;  2M8P A;  3P05 A;  1M9D C;  2EIA A;  3G21 A;  5I4T G;  4XRQ A;  2V4X A;  1BAJ A;  3DS4 A;  2GOL B;  3LRY A;  3DS3 A;  4COC A;  1M9E C;  2XXM A;  3H47 A;  2XGY A;  2WLV B;  4INB A;  4U0D A;  3G26 A;  3DS1 A;  1AK4 C;  4J93 A;  2JYG A;  2WLV A;  1P7N A;  5HGK A;  4HTW A;  2PXR C;  1M9X C;  3DTJ A;  1AUM A;  2L6E A;  2Y4Z A;  4M0I A;  4XFY A;  2LF4 A;  1M9F C;  4WYM A;  3G29 A;  1M9Y C;  2KOD A;  1QRJ A;  5HGO A;  3DS0 A;  2X82 A;  3G1G A;  2ONT A;  3DS5 A;  5DCK A;  1AFV A;  2X2D D;  4DGE C;  2JO0 A;  4E91 A;  1EIA A;  4U0A A;  5HGL A;  1D1D A;  1U7K A;  4XFZ A;  1EOQ A;  4COP A;  5HGN A;  2KGF A;  2PWO A;  1A8O A;  3G28 A;  3VRL C;  2XGV A;  3G1I A;  2XDE A;  5JPA A;  1L6N A;  4PH2 A;  4XRO A; 
#chains in the Genus database with same CATH topology
 1VQO P;  4XFX A;  2GON A;  2BUO A;  3G0V A;  2FHS C;  2PEQ A;  2MF4 A;  2KGE A;  4B4N A;  2PWM A;  3NTE A;  3DS2 A;  2Z44 A;  2AFE A;  5CZD B;  3GKL C;  3H4E A;  2XV6 A;  2L0Q A;  3BP9 A;  4BPH A;  2LOL A;  4QNB A;  4CA3 A;  1G03 A;  2OTL P;  5HGM A;  3DPH A;  3H0D A;  2K93 A;  1E6J P;  2FVF A;  1RNI A;  2GZF A;  3G21 A;  3DS4 A;  1CEI A;  3LRY A;  3DS3 A;  1Q81 Q;  4F37 A;  3H47 A;  2MY5 A;  3EJD A;  3LMO A;  3GZL A;  3DS1 A;  2PNG A;  2VLO A;  3GZM A;  3I56 P;  2M5R A;  1K8A Q;  3GJN A;  5HGK A;  2KG6 A;  2N5I A;  2Y4Z A;  3CCE P;  1YIT P;  3HYB A;  3CCJ P;  1VHN A;  1M9F C;  3G29 A;  1M9Y C;  2K0X A;  1VKU A;  3CD6 P;  3Q20 A;  2PEJ A;  2KGC A;  1L6N A;  3G1G A;  2ONT A;  2AVA A;  3DS5 A;  2FVA A;  4MRT C;  2CGQ A;  4GR6 A;  3E2D A;  3RG2 A;  1T8K A;  2LIU A;  1EIA A;  2GZG A;  4COP A;  2K0Y A;  1YIJ P;  5HGN A;  2KGF A;  2PWO A;  1EMV A;  2X2B A;  4UHP B;  2KG8 A;  2XGV A;  1HY8 A;  2PEI A;  2XDE A;  4DG9 A;  5JPA A;  2CNR A;  3NY7 B;  2CWO A;  4PH1 A;  2JPR A;  3CC7 P;  4NX4 C;  4U0C A;  5F2N A;  4U0F A;  3U43 A;  3CCU P;  2EG5 A;  1DNY A;  1RO2 A;  2DGY A;  3MGE A;  4U0B A;  4LQW C;  2XZ1 C;  1M74 A;  1VQM P;  2Z45 A;  1EM9 A;  4H2W C;  5BS1 A;  2KW2 A;  2OAR A;  3P05 A;  3EJE A;  2KWL A;  1BAJ A;  4COC A;  2L4B A;  3CCQ P;  1K73 Q;  2P9X A;  3G6E P;  2JGP A;  1ACP A;  4J93 A;  3CCM P;  2JYG A;  2OTJ P;  2ERH A;  1N8R Q;  2GZJ A;  1X3O A;  2FAC A;  5EW5 E;  2LTE A;  1UNK A;  1AUM A;  2PEK A;  1BXI A;  2K94 A;  2XZ0 D;  3I55 P;  2EHS A;  1KQS O;  1QRJ A;  3CC4 P;  1IUQ A;  1GPJ A;  2GZE A;  2MD9 A;  1NJI Q;  5DCK A;  2X2D D;  1YJN P;  2AFD A;  1GXG A;  1VQ4 P;  2JO0 A;  2L9F A;  2K5X A;  5HGL A;  1D1D A;  1Q82 Q;  5KP7 B;  1VQ5 P;  2KOQ A;  3G28 A;  7CEI A;  1YI2 P;  1VQK P;  1AF8 A;  1YHQ P;  3EJB A;  3CCV P;  2PEM A;  1K30 A;  1F80 D;  1KLP A;  2JAZ A;  5F2K A;  4PH0 A;  3CCS P;  2JYL A;  4DGA C;  1M6N A;  4GR2 A;  4H2X C;  4E92 A;  1GWP A;  1FR2 A;  4U0E A;  1RO0 A;  2PEO A;  1HQB A;  2AF8 A;  2DNW A;  2MR7 A;  1ZMB A;  2L22 A;  1DV5 A;  2NO8 A;  2M8P A;  2MVV A;  2EIA A;  4XRQ A;  2V4X A;  2MVU A;  1GXH A;  2GDX A;  2GZI A;  1E0H A;  4PXH B;  1M9E C;  2JB0 A;  2XXM A;  2K92 A;  1AYI A;  1MZ8 A;  4U0D A;  3G26 A;  3CCR P;  3CE7 A;  1VQL P;  2FAE A;  1P7N A;  2QEX P;  4HTW A;  2PXR C;  1M9X C;  3DTJ A;  1QVG O;  2Z46 A;  2K0D X;  4M0I A;  3CCL P;  2KOO A;  1K9M Q;  3CME P;  4WYM A;  1W2B O;  2MR8 A;  2PY8 A;  2N6Y A;  1VQ9 P;  5HVC A;  2N50 A;  2LML A;  1OR5 A;  2CG5 B;  4IZ6 A;  1AFV A;  1KC8 Q;  1Q7Y Q;  2CQ8 A;  2GDY A;  4U0A A;  1VQ8 P;  1EOQ A;  1NQ4 A;  2N98 A;  5EJD A;  1A8O A;  2FQ2 A;  2KG9 A;  3VRL C;  3G4S P;  1Q86 Q;  1QVF O;  3G1I A;  5F2O A;  1M6E X;  2LL8 A;  4PH2 A;  2X83 A;  2JU2 A;  1L0I A;  3M1M A;  4PH3 A;  2JBG A;  3RG6 C;  2M8N A;  1M9C C;  4NEO A;  4QKO A;  1YJW P;  2N5H A;  1A43 A;  3B5I A;  2XGU A;  1VQN P;  2VLQ A;  4BPF A;  1M90 Q;  2VSQ A;  2M8L A;  1L0H A;  5KP6 B;  2JU1 A;  1UJZ A;  2GDW A;  2VLN A;  4IPY A;  2QA4 P;  1IMQ A;  2E1M A;  3HZQ A;  1M9D C;  1ZNV A;  3OW2 O;  5I4T G;  2PEN A;  2JQ4 A;  2GOL B;  5KP8 B;  4INB A;  2XGY A;  2WLV B;  1Z6M A;  1IMP A;  1AK4 C;  2FAD A;  2N6Z A;  3CMA P;  2WLV A;  4PWV B;  3G71 P;  2KR5 A;  1JJ2 O;  3CC2 P;  2BHV A;  1VQ6 P;  2L6E A;  2LIW A;  5BS2 A;  1VQ7 P;  2QNW A;  4XFY A;  2LF4 A;  2KOD A;  1KD1 Q;  2KGD A;  5HGO A;  3DS0 A;  2X82 A;  2LPK A;  4H2Y C;  3B4Q A;  1YJ9 P;  2VLP A;  2FVE A;  2EHT A;  3WBH A;  3CXC O;  4DGE C;  1S72 P;  2FQ0 A;  5HV8 A;  1M1K Q;  4HKG A;  2KOP A;  2KOR A;  4E91 A;  2K2Q A;  2GYK A;  2ROQ A;  1U7K A;  4XFZ A;  2KGA A;  4R0M A;  3CPW O;  2FQ1 A;  2KOS A;  2WPT A;  4BPG A;  1VQP P;  2EFJ A;  2LKI A;  2XT1 A;  4XRO A; 
#chains in the Genus database with same CATH homology
 1K30 A;  2CWO A;  4PH1 A;  2JPR A;  2X83 A;  1VQO P;  3CC7 P;  4XFX A;  3M1M A;  4NX4 C;  4U0C A;  2GON A;  5F2N A;  5F2K A;  2BUO A;  4U0F A;  3G0V A;  4PH3 A;  2PEQ A;  3RG6 C;  4B4N A;  4PH0 A;  2M8N A;  2PWM A;  3CCS P;  2XT1 A;  1M9C C;  3NTE A;  3CCU P;  2EG5 A;  3DS2 A;  1YJW P;  2JYL A;  3B5I A;  1A43 A;  2Z44 A;  2XGU A;  1VQN P;  4DGA C;  1RO2 A;  2DGY A;  1M6N A;  4GR2 A;  3MGE A;  3H4E A;  1M90 Q;  4E92 A;  2M8L A;  1GWP A;  4U0B A;  4LQW C;  4U0E A;  2XV6 A;  3BP9 A;  1RO0 A;  4QNB A;  1M74 A;  2PEO A;  1VQM P;  2Z45 A;  1G03 A;  2OTL P;  5HGM A;  3DPH A;  4IPY A;  3H0D A;  1EM9 A;  2QA4 P;  1ZMB A;  5BS1 A;  2E1M A;  1E6J P;  2M8P A;  2OAR A;  1RNI A;  3HZQ A;  3P05 A;  1M9D C;  2EIA A;  3G21 A;  5I4T G;  4XRQ A;  2V4X A;  2PEN A;  1BAJ A;  3DS4 A;  3OW2 O;  2GOL B;  3LRY A;  3DS3 A;  1Q81 Q;  4COC A;  1M9E C;  2XXM A;  3CCQ P;  3H47 A;  2XGY A;  2WLV B;  4INB A;  2P9X A;  3G6E P;  1K73 Q;  4U0D A;  3G26 A;  3DS1 A;  3CCR P;  1AK4 C;  1VQL P;  4J93 A;  3CCM P;  2JYG A;  3I56 P;  2OTJ P;  3CMA P;  1K8A Q;  2WLV A;  1P7N A;  3G71 P;  2QEX P;  5HGK A;  1N8R Q;  4HTW A;  2PXR C;  1M9X C;  1JJ2 O;  3CC2 P;  3DTJ A;  2BHV A;  1AUM A;  1VQ6 P;  2L6E A;  2Y4Z A;  2Z46 A;  1QVG O;  4M0I A;  2PEK A;  3CCE P;  5BS2 A;  1YIT P;  3CCL P;  3HYB A;  3CCJ P;  1VQ7 P;  1K9M Q;  3CME P;  4XFY A;  2LF4 A;  1M9F C;  4WYM A;  3G29 A;  3I55 P;  1M9Y C;  2KOD A;  1W2B O;  3CD6 P;  1KD1 Q;  1KQS O;  2PY8 A;  3Q20 A;  1QRJ A;  3CC4 P;  1IUQ A;  2PEJ A;  1VQ9 P;  5HGO A;  3DS0 A;  2X82 A;  3G1G A;  2ONT A;  1NJI Q;  1YJ9 P;  3DS5 A;  5DCK A;  3WBH A;  3CXC O;  1AFV A;  1KC8 Q;  2X2D D;  4DGE C;  4GR6 A;  1S72 P;  1YJN P;  1M1K Q;  3E2D A;  1Q7Y Q;  1VQ4 P;  2JO0 A;  4E91 A;  1EIA A;  4U0A A;  5HGL A;  1D1D A;  1Q82 Q;  1VQ8 P;  1U7K A;  4XFZ A;  1EOQ A;  1VQ5 P;  4COP A;  3CPW O;  1YIJ P;  5HGN A;  2KGF A;  2PWO A;  1A8O A;  3G28 A;  1YI2 P;  1VQK P;  1VQP P;  1YHQ P;  3VRL C;  3G4S P;  1Q86 Q;  2EFJ A;  2XGV A;  3G1I A;  5F2O A;  1QVF O;  2PEI A;  2XDE A;  1M6E X;  3CCV P;  5JPA A;  2PEM A;  1L6N A;  4PH2 A;  4XRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...