2EIAA

X-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
PRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAPPQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKPKAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EIAV CAPSID PROTEIN P26
publication title Model for lentivirus capsid core assembly based on crystal dimers of EIAV p26.
pubmed doi rcsb
source organism Equine infectious anemia virus
molecule tags Viral protein
total genus 75
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2eiaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eiaA02
4U0FA 1A43A 2KODA 4HTWA 5HGLA 1E6JP 2KGFA 1P7NA 3LRYA 3DS2A 2V4XA 4COCA 2WLVB 4XROA 4PH1A 3DS5A 2XGVA 1M9YC 4DGEC 4PH0A 2M8LA 2GOLB 3G26A 2BUOA 4DGAC 4M0IA 2L6EA 2JYGA 1AFVA 4B4NA 2WLVA 1L6NA 3DTJA 3G28A 4U0DA 1EOQA 1EIAA 4XFXA 2ONTA 1M9DC 2XXMA 2X2DD 4E92A 4U0EA 1BAJA 3G1GA 4U0BA 1AK4C 2XGUA 3VRLC 1M9FC 2Y4ZA 5HGNA 1M9EC 2PWOA 3DS4A 2XDEA 1AUMA 2XV6A 4LQWC 5DCKA 3G0VA 5JPAA 2PXRC 3H47A 4PH3A 3DS3A 2JYLA 2PWMA 3DS0A 4U0AA 1U7KA 2GONA 4U0CA 4INBA 3H4EA 1D1DA 3P05A 2JPRA 5HGMA 4XRQA 1QRJA 2EIAA 1GWPA 2XT1A 3DS1A 4IPYA 1M9XC 2M8NA 2LF4A 4COPA 3G21A 3G29A 3DPHA 3G1IA 1M9CC 1EM9A 4XFZA 5HGOA 1A8OA 4NX4C 2XGYA 3BP9A 4WYMA 4QNBA 3NTEA 2X83A 2X82A 3MGEA 4PH2A 4XFYA 5HGKA 4E91A 2M8PA 4J93A 2JO0A 5I4TG 1G03A
chains in the Genus database with same CATH superfamily
1Q7YQ 3CC7P 1CEIA 1M6EX 2FQ1A 5KP7B 5HGLA 5F2OA 2KGFA 2PY8A 4COCA 3EJDA 4DG9A 3DS5A 1GXGA 2EG5A 1M9YC 3CCSP 2M8LA 2GOLB 3G26A 2VLOA 2BUOA 1FR2A 2MR8A 4DGAC 1L0HA 1L0IA 2PEJA 1VQKP 4M0IA 4UHPB 4B4NA 2PEMA 1EOQA 2LPKA 1KC8Q 2GDXA 2X2DD 4E92A 2E1MA 2K2QA 2L22A 1QVGO 4U0EA 1RO0A 2KOQA 2CWOA 2N6ZA 2MVUA 2K0DX 3GJNA 5HGNA 2K93A 2XV6A 1GXHA 5DCKA 1AF8A 1KLPA 3H47A 4PH3A 3DS0A 2JYLA 3CCLP 3CCUP 3EJEA 2KG6A 2JU2A 2KGDA 5KP6B 1YHQP 2N98A 2VLQA 2K92A 2FVEA 2KOOA 5HGMA 2EIAA 1M1KQ 2GZGA 4IPYA 3G21A 2L4BA 4H2WC 2FQ0A 3G1IA 2PEKA 1M9CC 1EM9A 2MD9A 4H2XC 2ERHA 2LTEA 4HKGA 3NTEA 2X83A 3MGEA 2M8PA 2Z46A 3CCJP 1Q81Q 3G1GA 1A43A 2PENA 1EMVA 1UJZA 2N50A 2VLPA 5EW5E 2OTJP 2LIWA 4XROA 2XGVA 1YI2P 4DGEC 2FQ2A 2QA4P 1YJ9P 2NO8A 1M90Q 2JB0A 3EJBA 2L6EA 1AFVA 2WLVA 2VLNA 2OTLP 4XFXA 2KGAA 2ONTA 2L0QA 2KG9A 1M9DC 2LOLA 2KGCA 2EHSA 3E2DA 1BAJA 1M74A 1Z6MA 4U0BA 5F2NA 1DNYA 1IMQA 2LMLA 3Q20A 2CQ8A 4IZ6A 1YITP 2PWOA 2VSQA 3G4SP 2PNGA 2KOSA 2PXRC 2KGEA 4U0AA 1VQ7P 3RG2A 1VQPP 2GONA 1BXIA 1VHNA 1VQ4P 1DV5A 1RO2A 3P05A 3G6EP 3CCRP 3CC2P 1GWPA 1YJWP 3NY7B 1M9XC 2M8NA 4MRTC 3B4QA 1ZNVA 2DGYA 2JU1A 2EFJA 5CZDB 2FAEA 2AVAA 2KORA 1HY8A 2PEQA 1VQ9P 3HYBA 3BP9A 4WYMA 2KR5A 2JO0A 5I4TG 1HQBA 4U0FA 3RG6C 1P7NA 2FADA 3DS2A 2V4XA 1OR5A 4H2YC 2WLVB 1F80D 4F37A 2KOPA 4BPFA 2K0YA 1YJNP 2MVVA 4R0MA 2AF8A 2GZJA 1K9MQ 1K8AQ 2WPTA 3GZLA 2Z44A 1K73Q 3DTJA 1MZ8A 1YIJP 2JAZA 2N5IA 2JGPA 2XXMA 3HZQA 2KW2A 1Q86Q 1ACPA 5KP8B 1VQ8P 3CE7A 3LMOA 2FHSC 1N8RQ 1AK4C 2XGUA 2JQ4A 1ZMBA 1QVFO 3VRLC 1M9FC 1M6NA 4PWVB 2Y4ZA 1VQOP 2MF4A 1M9EC 1VQNP 3CXCO 3U43A 2QEXP 2PWMA 4GR6A 2GDWA 3M1MA 3GZMA 1UNKA 2ROQA 2EHTA 1VQLP 1VQMP 1D1DA 2K94A 1AYIA 2PEOA 4XRQA 1QRJA 2XT1A 3DS1A 4BPGA 2MR7A 4BPHA 5F2KA 4COPA 4QKOA 4NEOA 2FVAA 1VKUA 2FACA 4XFZA 1GPJA 4NX4C 2KG8A 4QNBA 4PH2A 4E91A 1VQ6P 4XFYA 1KQSO 4J93A 1G03A 2CNRA 1W2BO 5HV8A 2KODA 4HTWA 2AFDA 3CCQP 1E6JP 3LRYA 1T8KA 2N6YA 2LKIA 2BHVA 4PH1A 1JJ2O 3B5IA 2MY5A 1E0HA 3CMEP 3G71P 4PH0A 2Z45A 2QNWA 1K30A 2CG5B 1RNIA 1KD1Q 3CCEP 1IMPA 2JYGA 1IUQA 1L6NA 2OARA 3CMAP 3G28A 4U0DA 1EIAA 5BS2A 3CCVP 3OW2O 2DNWA 2M5RA 1NJIQ 2N5HA 2L9FA 2GZIA 3I55P 5BS1A 2P9XA 4PXHB 2PEIA 2K5XA 2KWLA 1NQ4A 1Q82Q 5EJDA 3GKLC 2CGQA 2GDYA 3CD6P 3DS4A 2XDEA 1AUMA 7CEIA 4LQWC 3G0VA 5JPAA 2GZFA 2FVFA 3DS3A 4GR2A 2GYKA 2AFEA 1S72P 1U7KA 2LL8A 4U0CA 2XZ1C 3CCMP 1VQ5P 4INBA 2LIUA 4CA3A 3CPWO 3H4EA 2JPRA 2GZEA 2XZ0D 2LF4A 3H0DA 3G29A 1X3OA 2JBGA 3DPHA 3WBHA 5HGOA 1A8OA 5HVCA 2XGYA 2K0XA 2X82A 5HGKA 3CC4P 2X2BA 3I56P
chains in the Genus database with same CATH topology
4U0FA 1A43A 1Q7YQ 3CC7P 1W2BO 2PENA 1M6EX 2KODA 4HTWA 5HGLA 5F2OA 3CCQP 3RG6C 1E6JP 2KGFA 2PY8A 1P7NA 3LRYA 2OTJP 3DS2A 2BHVA 2V4XA 4COCA 2WLVB 4XROA 4PH1A 1JJ2O 3B5IA 3CMEP 3DS5A 2XGVA 2EG5A 1M9YC 4DGEC 3G71P 3CCSP 1YI2P 4PH0A 2Z45A 2M8LA 2QA4P 2GOLB 1YJ9P 1K30A 3G26A 2BUOA 1M90Q 1RNIA 1YJNP 4DGAC 2PEJA 1KD1Q 1VQKP 3CCEP 4M0IA 1K9MQ 1K8AQ 2L6EA 2JYGA 1AFVA 2Z44A 4B4NA 1K73Q 2WLVA 1IUQA 2PEMA 1L6NA 2OARA 2OTLP 3DTJA 3G28A 3CMAP 4U0DA 1EOQA 1EIAA 5BS2A 1YIJP 3CCVP 4XFXA 1KC8Q 3OW2O 2ONTA 1M9DC 2XXMA 2X2DD 3HZQA 4E92A 2E1MA 1Q86Q 1VQ8P 1QVGO 3CCJP 3E2DA 4U0EA 1BAJA 1RO0A 1M74A 3G1GA 1NJIQ 4U0BA 2CWOA 5F2NA 1AK4C 1N8RQ 3I55P 5BS1A 2XGUA 2P9XA 1QVFO 1ZMBA 3VRLC 2PEIA 1M9FC 1M6NA 3Q20A 2Y4ZA 1VQOP 1Q82Q 5HGNA 1YITP 1M9EC 2PWOA 1VQNP 3CD6P 3DS4A 2XDEA 1AUMA 3G4SP 2XV6A 4LQWC 5DCKA 3G0VA 3CXCO 5JPAA 2PXRC 3H47A 4PH3A 3DS3A 2JYLA 2PWMA 3DS0A 4GR2A 2QEXP 4U0AA 4GR6A 3M1MA 1S72P 3CCLP 1U7KA 3CCUP 1Q81Q 1VQ7P 1VQPP 2GONA 4U0CA 1VQ4P 3CCMP 1YHQP 1VQ5P 4INBA 3CPWO 1VQLP 1VQMP 1RO2A 3H4EA 1D1DA 3P05A 2JPRA 3G6EP 2PEOA 3CCRP 5HGMA 4XRQA 1QRJA 2EIAA 1GWPA 2XT1A 3DS1A 4IPYA 1YJWP 1M1KQ 3CC2P 1M9XC 2M8NA 5F2KA 2LF4A 3H0DA 2DGYA 4COPA 3G21A 3G29A 2EFJA 3DPHA 3G1IA 2PEKA 3WBHA 1M9CC 2PEQA 1EM9A 1VQ9P 4XFZA 5HGOA 1A8OA 4NX4C 3HYBA 2XGYA 3BP9A 4WYMA 4QNBA 3NTEA 2X83A 2X82A 3MGEA 4PH2A 4XFYA 5HGKA 4E91A 3CC4P 2M8PA 1VQ6P 2Z46A 3I56P 4J93A 1KQSO 2JO0A 5I4TG 1G03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0F A;  1A43 A;  2KOD A;  4HTW A;  5HGL A;  1E6J P;  2KGF A;  1P7N A;  3LRY A;  3DS2 A;  2V4X A;  4COC A;  2WLV B;  4XRO A;  4PH1 A;  3DS5 A;  2XGV A;  1M9Y C;  4DGE C;  4PH0 A;  2M8L A;  2GOL B;  3G26 A;  2BUO A;  4DGA C;  4M0I A;  2L6E A;  2JYG A;  1AFV A;  4B4N A;  2WLV A;  1L6N A;  3DTJ A;  3G28 A;  4U0D A;  1EOQ A;  1EIA A;  4XFX A;  2ONT A;  1M9D C;  2XXM A;  2X2D D;  4E92 A;  4U0E A;  1BAJ A;  3G1G A;  4U0B A;  1AK4 C;  2XGU A;  3VRL C;  1M9F C;  2Y4Z A;  5HGN A;  1M9E C;  2PWO A;  3DS4 A;  2XDE A;  1AUM A;  2XV6 A;  4LQW C;  5DCK A;  3G0V A;  5JPA A;  2PXR C;  3H47 A;  4PH3 A;  3DS3 A;  2JYL A;  2PWM A;  3DS0 A;  4U0A A;  1U7K A;  2GON A;  4U0C A;  4INB A;  3H4E A;  1D1D A;  3P05 A;  2JPR A;  5HGM A;  4XRQ A;  1QRJ A;  2EIA A;  1GWP A;  2XT1 A;  3DS1 A;  4IPY A;  1M9X C;  2M8N A;  2LF4 A;  4COP A;  3G21 A;  3G29 A;  3DPH A;  3G1I A;  1M9C C;  1EM9 A;  4XFZ A;  5HGO A;  1A8O A;  4NX4 C;  2XGY A;  3BP9 A;  4WYM A;  4QNB A;  3NTE A;  2X83 A;  2X82 A;  3MGE A;  4PH2 A;  4XFY A;  5HGK A;  4E91 A;  2M8P A;  4J93 A;  2JO0 A;  5I4T G;  1G03 A; 
#chains in the Genus database with same CATH topology
 1Q7Y Q;  3CC7 P;  1CEI A;  1M6E X;  2FQ1 A;  5KP7 B;  5HGL A;  5F2O A;  2KGF A;  2PY8 A;  4COC A;  3EJD A;  4DG9 A;  3DS5 A;  1GXG A;  2EG5 A;  1M9Y C;  3CCS P;  2M8L A;  2GOL B;  3G26 A;  2VLO A;  2BUO A;  1FR2 A;  2MR8 A;  4DGA C;  1L0H A;  1L0I A;  2PEJ A;  1VQK P;  4M0I A;  4UHP B;  4B4N A;  2PEM A;  1EOQ A;  2LPK A;  1KC8 Q;  2GDX A;  2X2D D;  4E92 A;  2E1M A;  2K2Q A;  2L22 A;  1QVG O;  4U0E A;  1RO0 A;  2KOQ A;  2CWO A;  2N6Z A;  2MVU A;  2K0D X;  3GJN A;  5HGN A;  2K93 A;  2XV6 A;  1GXH A;  5DCK A;  1AF8 A;  1KLP A;  3H47 A;  4PH3 A;  3DS0 A;  2JYL A;  3CCL P;  3CCU P;  3EJE A;  2KG6 A;  2JU2 A;  2KGD A;  5KP6 B;  1YHQ P;  2N98 A;  2VLQ A;  2K92 A;  2FVE A;  2KOO A;  5HGM A;  2EIA A;  1M1K Q;  2GZG A;  4IPY A;  3G21 A;  2L4B A;  4H2W C;  2FQ0 A;  3G1I A;  2PEK A;  1M9C C;  1EM9 A;  2MD9 A;  4H2X C;  2ERH A;  2LTE A;  4HKG A;  3NTE A;  2X83 A;  3MGE A;  2M8P A;  2Z46 A;  3CCJ P;  1Q81 Q;  3G1G A;  1A43 A;  2PEN A;  1EMV A;  1UJZ A;  2N50 A;  2VLP A;  5EW5 E;  2OTJ P;  2LIW A;  4XRO A;  2XGV A;  1YI2 P;  4DGE C;  2FQ2 A;  2QA4 P;  1YJ9 P;  2NO8 A;  1M90 Q;  2JB0 A;  3EJB A;  2L6E A;  1AFV A;  2WLV A;  2VLN A;  2OTL P;  4XFX A;  2KGA A;  2ONT A;  2L0Q A;  2KG9 A;  1M9D C;  2LOL A;  2KGC A;  2EHS A;  3E2D A;  1BAJ A;  1M74 A;  1Z6M A;  4U0B A;  5F2N A;  1DNY A;  1IMQ A;  2LML A;  3Q20 A;  2CQ8 A;  4IZ6 A;  1YIT P;  2PWO A;  2VSQ A;  3G4S P;  2PNG A;  2KOS A;  2PXR C;  2KGE A;  4U0A A;  1VQ7 P;  3RG2 A;  1VQP P;  2GON A;  1BXI A;  1VHN A;  1VQ4 P;  1DV5 A;  1RO2 A;  3P05 A;  3G6E P;  3CCR P;  3CC2 P;  1GWP A;  1YJW P;  3NY7 B;  1M9X C;  2M8N A;  4MRT C;  3B4Q A;  1ZNV A;  2DGY A;  2JU1 A;  2EFJ A;  5CZD B;  2FAE A;  2AVA A;  2KOR A;  1HY8 A;  2PEQ A;  1VQ9 P;  3HYB A;  3BP9 A;  4WYM A;  2KR5 A;  2JO0 A;  5I4T G;  1HQB A;  4U0F A;  3RG6 C;  1P7N A;  2FAD A;  3DS2 A;  2V4X A;  1OR5 A;  4H2Y C;  2WLV B;  1F80 D;  4F37 A;  2KOP A;  4BPF A;  2K0Y A;  1YJN P;  2MVV A;  4R0M A;  2AF8 A;  2GZJ A;  1K9M Q;  1K8A Q;  2WPT A;  3GZL A;  2Z44 A;  1K73 Q;  3DTJ A;  1MZ8 A;  1YIJ P;  2JAZ A;  2N5I A;  2JGP A;  2XXM A;  3HZQ A;  2KW2 A;  1Q86 Q;  1ACP A;  5KP8 B;  1VQ8 P;  3CE7 A;  3LMO A;  2FHS C;  1N8R Q;  1AK4 C;  2XGU A;  2JQ4 A;  1ZMB A;  1QVF O;  3VRL C;  1M9F C;  1M6N A;  4PWV B;  2Y4Z A;  1VQO P;  2MF4 A;  1M9E C;  1VQN P;  3CXC O;  3U43 A;  2QEX P;  2PWM A;  4GR6 A;  2GDW A;  3M1M A;  3GZM A;  1UNK A;  2ROQ A;  2EHT A;  1VQL P;  1VQM P;  1D1D A;  2K94 A;  1AYI A;  2PEO A;  4XRQ A;  1QRJ A;  2XT1 A;  3DS1 A;  4BPG A;  2MR7 A;  4BPH A;  5F2K A;  4COP A;  4QKO A;  4NEO A;  2FVA A;  1VKU A;  2FAC A;  4XFZ A;  1GPJ A;  4NX4 C;  2KG8 A;  4QNB A;  4PH2 A;  4E91 A;  1VQ6 P;  4XFY A;  1KQS O;  4J93 A;  1G03 A;  2CNR A;  1W2B O;  5HV8 A;  2KOD A;  4HTW A;  2AFD A;  3CCQ P;  1E6J P;  3LRY A;  1T8K A;  2N6Y A;  2LKI A;  2BHV A;  4PH1 A;  1JJ2 O;  3B5I A;  2MY5 A;  1E0H A;  3CME P;  3G71 P;  4PH0 A;  2Z45 A;  2QNW A;  1K30 A;  2CG5 B;  1RNI A;  1KD1 Q;  3CCE P;  1IMP A;  2JYG A;  1IUQ A;  1L6N A;  2OAR A;  3CMA P;  3G28 A;  4U0D A;  1EIA A;  5BS2 A;  3CCV P;  3OW2 O;  2DNW A;  2M5R A;  1NJI Q;  2N5H A;  2L9F A;  2GZI A;  3I55 P;  5BS1 A;  2P9X A;  4PXH B;  2PEI A;  2K5X A;  2KWL A;  1NQ4 A;  1Q82 Q;  5EJD A;  3GKL C;  2CGQ A;  2GDY A;  3CD6 P;  3DS4 A;  2XDE A;  1AUM A;  7CEI A;  4LQW C;  3G0V A;  5JPA A;  2GZF A;  2FVF A;  3DS3 A;  4GR2 A;  2GYK A;  2AFE A;  1S72 P;  1U7K A;  2LL8 A;  4U0C A;  2XZ1 C;  3CCM P;  1VQ5 P;  4INB A;  2LIU A;  4CA3 A;  3CPW O;  3H4E A;  2JPR A;  2GZE A;  2XZ0 D;  2LF4 A;  3H0D A;  3G29 A;  1X3O A;  2JBG A;  3DPH A;  3WBH A;  5HGO A;  1A8O A;  5HVC A;  2XGY A;  2K0X A;  2X82 A;  5HGK A;  3CC4 P;  2X2B A;  3I56 P; 
#chains in the Genus database with same CATH homology
 4U0F A;  1A43 A;  1Q7Y Q;  3CC7 P;  1W2B O;  2PEN A;  1M6E X;  2KOD A;  4HTW A;  5HGL A;  5F2O A;  3CCQ P;  3RG6 C;  1E6J P;  2KGF A;  2PY8 A;  1P7N A;  3LRY A;  2OTJ P;  3DS2 A;  2BHV A;  2V4X A;  4COC A;  2WLV B;  4XRO A;  4PH1 A;  1JJ2 O;  3B5I A;  3CME P;  3DS5 A;  2XGV A;  2EG5 A;  1M9Y C;  4DGE C;  3G71 P;  3CCS P;  1YI2 P;  4PH0 A;  2Z45 A;  2M8L A;  2QA4 P;  2GOL B;  1YJ9 P;  1K30 A;  3G26 A;  2BUO A;  1M90 Q;  1RNI A;  1YJN P;  4DGA C;  2PEJ A;  1KD1 Q;  1VQK P;  3CCE P;  4M0I A;  1K9M Q;  1K8A Q;  2L6E A;  2JYG A;  1AFV A;  2Z44 A;  4B4N A;  1K73 Q;  2WLV A;  1IUQ A;  2PEM A;  1L6N A;  2OAR A;  2OTL P;  3DTJ A;  3G28 A;  3CMA P;  4U0D A;  1EOQ A;  1EIA A;  5BS2 A;  1YIJ P;  3CCV P;  4XFX A;  1KC8 Q;  3OW2 O;  2ONT A;  1M9D C;  2XXM A;  2X2D D;  3HZQ A;  4E92 A;  2E1M A;  1Q86 Q;  1VQ8 P;  1QVG O;  3CCJ P;  3E2D A;  4U0E A;  1BAJ A;  1RO0 A;  1M74 A;  3G1G A;  1NJI Q;  4U0B A;  2CWO A;  5F2N A;  1AK4 C;  1N8R Q;  3I55 P;  5BS1 A;  2XGU A;  2P9X A;  1QVF O;  1ZMB A;  3VRL C;  2PEI A;  1M9F C;  1M6N A;  3Q20 A;  2Y4Z A;  1VQO P;  1Q82 Q;  5HGN A;  1YIT P;  1M9E C;  2PWO A;  1VQN P;  3CD6 P;  3DS4 A;  2XDE A;  1AUM A;  3G4S P;  2XV6 A;  4LQW C;  5DCK A;  3G0V A;  3CXC O;  5JPA A;  2PXR C;  3H47 A;  4PH3 A;  3DS3 A;  2JYL A;  2PWM A;  3DS0 A;  4GR2 A;  2QEX P;  4U0A A;  4GR6 A;  3M1M A;  1S72 P;  3CCL P;  1U7K A;  3CCU P;  1Q81 Q;  1VQ7 P;  1VQP P;  2GON A;  4U0C A;  1VQ4 P;  3CCM P;  1YHQ P;  1VQ5 P;  4INB A;  3CPW O;  1VQL P;  1VQM P;  1RO2 A;  3H4E A;  1D1D A;  3P05 A;  2JPR A;  3G6E P;  2PEO A;  3CCR P;  5HGM A;  4XRQ A;  1QRJ A;  2EIA A;  1GWP A;  2XT1 A;  3DS1 A;  4IPY A;  1YJW P;  1M1K Q;  3CC2 P;  1M9X C;  2M8N A;  5F2K A;  2LF4 A;  3H0D A;  2DGY A;  4COP A;  3G21 A;  3G29 A;  2EFJ A;  3DPH A;  3G1I A;  2PEK A;  3WBH A;  1M9C C;  2PEQ A;  1EM9 A;  1VQ9 P;  4XFZ A;  5HGO A;  1A8O A;  4NX4 C;  3HYB A;  2XGY A;  3BP9 A;  4WYM A;  4QNB A;  3NTE A;  2X83 A;  2X82 A;  3MGE A;  4PH2 A;  4XFY A;  5HGK A;  4E91 A;  3CC4 P;  2M8P A;  1VQ6 P;  2Z46 A;  3I56 P;  4J93 A;  1KQS O;  2JO0 A;  5I4T G;  1G03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...