2EIAA

X-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
PRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAPPQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKPKAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Model for lentivirus capsid core assembly based on crystal dimers of EIAV p26.
pubmed doi rcsb
source organism Equine infectious anemia virus
molecule tags Viral protein
molecule keywords EIAV CAPSID PROTEIN P26
total genus 75
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2eiaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eiaA02
1M9XC 4B4NA 2M8PA 3DS5A 4U0AA 4PH0A 3G26A 2EIAA 1U7KA 1QRJA 2JPRA 5JPAA 1M9DC 5HGLA 5HGOA 1A43A 1M9YC 1AK4C 3G1GA 4PH3A 2M8LA 2XDEA 2KODA 4U0FA 2JO0A 2PWOA 4E91A 2XGVA 2Y4ZA 3DS0A 4COCA 1P7NA 2M8NA 1A8OA 2BUOA 1E6JP 1L6NA 2GOLB 1M9CC 2XV6A 3G29A 4U0BA 1EM9A 2ONTA 1M9EC 3DS3A 3BP9A 4HTWA 4DGAC 3G21A 1BAJA 2PXRC 2X2DD 4LQWC 2L6EA 5DCKA 2WLVA 3G1IA 1EIAA 3H4EA 3G28A 5I4TG 4QNBA 4PH2A 3DS4A 4INBA 3MGEA 1G03A 5HGKA 4J93A 4M0IA 2LF4A 4U0CA 4WYMA 4IPYA 3NTEA 2XXMA 3H47A 3VRLC 1EOQA 1AFVA 2GONA 4U0EA 4DGEC 2X83A 5HGNA 2PWMA 2XGYA 1M9FC 2XGUA 4XFYA 5HGMA 4NX4C 3P05A 4XFZA 4E92A 1AUMA 2X82A 2V4XA 3DS1A 3DPHA 2JYLA 3DS2A 3G0VA 4PH1A 2JYGA 2XT1A 1D1DA 3LRYA 4XRQA 2KGFA 1GWPA 4COPA 4U0DA 4XFXA 2WLVB 4XROA 3DTJA
chains in the Genus database with same CATH superfamily
3DS5A 4B4NA 2GDWA 5BS2A 3G26A 3EJDA 1VHNA 2GDXA 1HY8A 2CNRA 3G1GA 1VQ4P 2XDEA 4DG9A 2LL8A 2KODA 2Z46A 3EJEA 3CC7P 2E1MA 3Q20A 2L4BA 2BUOA 5F2KA 2XV6A 1YIJP 3CCSP 3G71P 3RG6C 2KW2A 1MZ8A 2K0XA 3BP9A 5EW5E 2AVAA 1BXIA 2KWLA 2X2DD 1RO2A 3CCVP 2DGYA 1YJNP 1F80D 2KGDA 3CCEP 2L22A 1KD1Q 2KORA 1KLPA 2KOOA 3GKLC 1K8AQ 4INBA 3MGEA 1G03A 1GXGA 5HGKA 3GZMA 4U0CA 3M1MA 5BS1A 2QA4P 1QVGO 3CMAP 1M6EX 2OARA 1EOQA 1AFVA 2GONA 3CCRP 1VQNP 3GZLA 2X83A 2PEIA 2PWMA 1RNIA 2MVVA 1M9FC 3OW2O 2JGPA 5HGMA 2VLQA 1AUMA 2N6ZA 2X82A 1YJWP 2GDYA 2ERHA 2N5IA 1D1DA 2VLOA 1NJIQ 1M90Q 3EJBA 2FVFA 1FR2A 4COPA 2KGAA 1M9XC 1AYIA 2M8PA 4PH0A 2KOPA 3G4SP 2K93A 1U7KA 3GJNA 2MY5A 5JPAA 1M9DC 2K5XA 2OTJP 2N98A 3CCJP 2KGCA 4U0FA 2JO0A 2PWOA 4E91A 3DS0A 1P7NA 3G6EP 1YI2P 1L0HA 2FQ2A 2GZIA 1VQ5P 2FACA 4U0BA 3LMOA 2FVEA 1EM9A 3DS3A 3B4QA 2PNGA 2KG6A 4LQWC 1KQSO 3CMEP 2EHSA 2L6EA 2WLVA 3CCMP 3G1IA 2VSQA 5EJDA 3H4EA 2JU1A 2Z44A 1M1KQ 1Q7YQ 5I4TG 2N5HA 3DS4A 2PEQA 4J93A 4M0IA 1VQ9P 2ROQA 2LF4A 4WYMA 1DV5A 2LPKA 2EFJA 1DNYA 2XXMA 2QEXP 1OR5A 2FADA 5HGNA 1KC8Q 2XGYA 2JB0A 4XFZA 1IMQA 2JYLA 3DPHA 1Q86Q 2K0YA 2KOQA 1VQOP 3G0VA 2XZ0D 1VQPP 2FHSC 4H2YC 3I56P 4XRQA 2KGFA 2DNWA 2PEMA 2LIWA 4XFXA 1ACPA 4XROA 2FVAA 1CEIA 2XZ1C 1IMPA 1QVFO 2WPTA 1QRJA 3CC2P 2MR8A 4F37A 5HGLA 5HGOA 2FQ0A 1A43A 1M9YC 5F2OA 1AK4C 2GZEA 5KP6B 2Y4ZA 4COCA 2M8NA 2LTEA 1YHQP 1A8OA 2LOLA 1VQMP 2LKIA 1E6JP 3CE7A 1L6NA 2JQ4A 1IUQA 2CQ8A 1E0HA 3G29A 5HVCA 3CXCO 4GR2A 1Q81Q 1M9EC 2P9XA 3G21A 1BAJA 4H2XC 1EIAA 3G28A 2PEKA 4QNBA 4PH2A 3HYBA 1VQLP 2MR7A 1VKUA 2FQ1A 1M6NA 2JBGA 5KP8B 3NTEA 3H47A 1VQ7P 4U0EA 5KP7B 4PXHB 1GXHA 2KG9A 2VLNA 1Z6MA 2AF8A 2CGQA 2V4XA 3DS1A 3U43A 2CWOA 4BPGA 4PH1A 2JYGA 3CCQP 1UNKA 2MVUA 2XT1A 3LRYA 1GWPA 1EMVA 2AFDA 3CD6P 2WLVB 1W2BO 5F2NA 3DTJA 4PWVB 4U0AA 1S72P 2EIAA 2NO8A 2KR5A 2FAEA 2JPRA 2L9FA 4UHPB 1L0IA 2MF4A 2JAZA 4PH3A 2M8LA 2K0DX 2PY8A 2PENA 3CCUP 2XGVA 1ZNVA 1N8RQ 4R0MA 3CPWO 5HV8A 1GPJA 4QKOA 2GOLB 1M9CC 2PEJA 2QNWA 2Z45A 3B5IA 1K73Q 3HZQA 1YITP 2N6YA 3NY7B 2GZFA 7CEIA 2ONTA 3I55P 4HTWA 4DGAC 2X2BA 2GZJA 1VQ8P 2PXRC 1T8KA 4BPFA 5DCKA 1Q82Q 1UJZA 2KOSA 2M5RA 1JJ2O 3E2DA 2BHVA 1M74A 3WBHA 5CZDB 4GR6A 3CC4P 1AF8A 4IPYA 3H0DA 2K94A 4H2WC 3VRLC 2K2QA 4DGEC 1VQKP 2PEOA 1NQ4A 1VQ6P 2LMLA 2XGUA 1RO0A 4XFYA 1K30A 2GYKA 4HKGA 2EG5A 4NX4C 2JU2A 2OTLP 3P05A 2L0QA 4E92A 2GZGA 1YJ9P 2LIUA 2MD9A 2KGEA 2EHTA 2N50A 3DS2A 1HQBA 2CG5B 2K92A 2AFEA 3CCLP 1X3OA 4CA3A 4NEOA 2KG8A 2VLPA 4BPHA 4IZ6A 3RG2A 4MRTC 4U0DA 1K9MQ 1ZMBA
chains in the Genus database with same CATH topology
1M9XC 4B4NA 2M8PA 3DS5A 4U0AA 4PH0A 3G26A 5BS2A 1S72P 2EIAA 3G4SP 1QVFO 1U7KA 1QRJA 2JPRA 3CC2P 5JPAA 1M9DC 5HGLA 5HGOA 1A43A 1M9YC 5F2OA 1AK4C 2OTJP 3G1GA 3CCJP 4PH3A 1VQ4P 2M8LA 2XDEA 2KODA 2Z46A 3CC7P 4U0FA 2E1MA 2JO0A 2PWOA 3Q20A 4E91A 2PY8A 2PENA 3CCUP 2XGVA 2Y4ZA 3DS0A 4COCA 1N8RQ 1P7NA 2M8NA 3G6EP 3CPWO 1YHQP 1A8OA 1VQMP 1YI2P 2BUOA 1E6JP 1L6NA 5F2KA 2GOLB 1M9CC 1IUQA 2PEJA 2Z45A 3B5IA 1VQ5P 1K73Q 3HZQA 1YITP 2XV6A 3G29A 1YIJP 4U0BA 3CCSP 3G71P 3RG6C 3CXCO 1EM9A 4GR2A 2ONTA 1Q81Q 1M9EC 3DS3A 3I55P 2P9XA 3BP9A 4HTWA 4DGAC 3G21A 1VQ8P 1BAJA 2PXRC 1YJNP 2X2DD 1RO2A 3CCVP 2DGYA 4LQWC 1KQSO 3CMEP 2L6EA 5DCKA 3CCEP 1KD1Q 2WLVA 3CCMP 3G1IA 1EIAA 1Q82Q 3H4EA 2Z44A 3G28A 1M1KQ 1Q7YQ 2PEKA 1JJ2O 5I4TG 3E2DA 4QNBA 4PH2A 3HYBA 2BHVA 3DS4A 1K8AQ 2PEQA 4INBA 3MGEA 1G03A 1M74A 1VQLP 5HGKA 3WBHA 4J93A 4M0IA 1VQ9P 4GR6A 3CC4P 2LF4A 4U0CA 4WYMA 1M6NA 3M1MA 5BS1A 4IPYA 3NTEA 2EFJA 3H0DA 2XXMA 2QA4P 2QEXP 1QVGO 3CMAP 3H47A 3VRLC 1M6EX 2OARA 1VQ7P 1EOQA 1AFVA 2GONA 4U0EA 3CCRP 1VQNP 4DGEC 1VQKP 2X83A 2PEIA 2PEOA 5HGNA 2PWMA 2XGYA 1KC8Q 1VQ6P 1RNIA 1M9FC 3OW2O 2XGUA 1RO0A 4XFYA 5HGMA 1K30A 2EG5A 4NX4C 2OTLP 3P05A 4XFZA 4E92A 1AUMA 2X82A 1YJ9P 1YJWP 2V4XA 3DS1A 3DPHA 2JYLA 1Q86Q 2CWOA 1VQOP 3DS2A 3G0VA 4PH1A 2JYGA 3CCQP 2XT1A 1VQPP 1D1DA 1NJIQ 1M90Q 3LRYA 3I56P 4XRQA 2KGFA 3CCLP 1GWPA 2PEMA 4COPA 4U0DA 4XFXA 1K9MQ 3CD6P 2WLVB 4XROA 1W2BO 1ZMBA 5F2NA 3DTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9X C;  4B4N A;  2M8P A;  3DS5 A;  4U0A A;  4PH0 A;  3G26 A;  2EIA A;  1U7K A;  1QRJ A;  2JPR A;  5JPA A;  1M9D C;  5HGL A;  5HGO A;  1A43 A;  1M9Y C;  1AK4 C;  3G1G A;  4PH3 A;  2M8L A;  2XDE A;  2KOD A;  4U0F A;  2JO0 A;  2PWO A;  4E91 A;  2XGV A;  2Y4Z A;  3DS0 A;  4COC A;  1P7N A;  2M8N A;  1A8O A;  2BUO A;  1E6J P;  1L6N A;  2GOL B;  1M9C C;  2XV6 A;  3G29 A;  4U0B A;  1EM9 A;  2ONT A;  1M9E C;  3DS3 A;  3BP9 A;  4HTW A;  4DGA C;  3G21 A;  1BAJ A;  2PXR C;  2X2D D;  4LQW C;  2L6E A;  5DCK A;  2WLV A;  3G1I A;  1EIA A;  3H4E A;  3G28 A;  5I4T G;  4QNB A;  4PH2 A;  3DS4 A;  4INB A;  3MGE A;  1G03 A;  5HGK A;  4J93 A;  4M0I A;  2LF4 A;  4U0C A;  4WYM A;  4IPY A;  3NTE A;  2XXM A;  3H47 A;  3VRL C;  1EOQ A;  1AFV A;  2GON A;  4U0E A;  4DGE C;  2X83 A;  5HGN A;  2PWM A;  2XGY A;  1M9F C;  2XGU A;  4XFY A;  5HGM A;  4NX4 C;  3P05 A;  4XFZ A;  4E92 A;  1AUM A;  2X82 A;  2V4X A;  3DS1 A;  3DPH A;  2JYL A;  3DS2 A;  3G0V A;  4PH1 A;  2JYG A;  2XT1 A;  1D1D A;  3LRY A;  4XRQ A;  2KGF A;  1GWP A;  4COP A;  4U0D A;  4XFX A;  2WLV B;  4XRO A;  3DTJ A; 
#chains in the Genus database with same CATH topology
 3DS5 A;  4B4N A;  2GDW A;  5BS2 A;  3G26 A;  3EJD A;  1VHN A;  2GDX A;  1HY8 A;  2CNR A;  3G1G A;  1VQ4 P;  2XDE A;  4DG9 A;  2LL8 A;  2KOD A;  2Z46 A;  3EJE A;  3CC7 P;  2E1M A;  3Q20 A;  2L4B A;  2BUO A;  5F2K A;  2XV6 A;  1YIJ P;  3CCS P;  3G71 P;  3RG6 C;  2KW2 A;  1MZ8 A;  2K0X A;  3BP9 A;  5EW5 E;  2AVA A;  1BXI A;  2KWL A;  2X2D D;  1RO2 A;  3CCV P;  2DGY A;  1YJN P;  1F80 D;  2KGD A;  3CCE P;  2L22 A;  1KD1 Q;  2KOR A;  1KLP A;  2KOO A;  3GKL C;  1K8A Q;  4INB A;  3MGE A;  1G03 A;  1GXG A;  5HGK A;  3GZM A;  4U0C A;  3M1M A;  5BS1 A;  2QA4 P;  1QVG O;  3CMA P;  1M6E X;  2OAR A;  1EOQ A;  1AFV A;  2GON A;  3CCR P;  1VQN P;  3GZL A;  2X83 A;  2PEI A;  2PWM A;  1RNI A;  2MVV A;  1M9F C;  3OW2 O;  2JGP A;  5HGM A;  2VLQ A;  1AUM A;  2N6Z A;  2X82 A;  1YJW P;  2GDY A;  2ERH A;  2N5I A;  1D1D A;  2VLO A;  1NJI Q;  1M90 Q;  3EJB A;  2FVF A;  1FR2 A;  4COP A;  2KGA A;  1M9X C;  1AYI A;  2M8P A;  4PH0 A;  2KOP A;  3G4S P;  2K93 A;  1U7K A;  3GJN A;  2MY5 A;  5JPA A;  1M9D C;  2K5X A;  2OTJ P;  2N98 A;  3CCJ P;  2KGC A;  4U0F A;  2JO0 A;  2PWO A;  4E91 A;  3DS0 A;  1P7N A;  3G6E P;  1YI2 P;  1L0H A;  2FQ2 A;  2GZI A;  1VQ5 P;  2FAC A;  4U0B A;  3LMO A;  2FVE A;  1EM9 A;  3DS3 A;  3B4Q A;  2PNG A;  2KG6 A;  4LQW C;  1KQS O;  3CME P;  2EHS A;  2L6E A;  2WLV A;  3CCM P;  3G1I A;  2VSQ A;  5EJD A;  3H4E A;  2JU1 A;  2Z44 A;  1M1K Q;  1Q7Y Q;  5I4T G;  2N5H A;  3DS4 A;  2PEQ A;  4J93 A;  4M0I A;  1VQ9 P;  2ROQ A;  2LF4 A;  4WYM A;  1DV5 A;  2LPK A;  2EFJ A;  1DNY A;  2XXM A;  2QEX P;  1OR5 A;  2FAD A;  5HGN A;  1KC8 Q;  2XGY A;  2JB0 A;  4XFZ A;  1IMQ A;  2JYL A;  3DPH A;  1Q86 Q;  2K0Y A;  2KOQ A;  1VQO P;  3G0V A;  2XZ0 D;  1VQP P;  2FHS C;  4H2Y C;  3I56 P;  4XRQ A;  2KGF A;  2DNW A;  2PEM A;  2LIW A;  4XFX A;  1ACP A;  4XRO A;  2FVA A;  1CEI A;  2XZ1 C;  1IMP A;  1QVF O;  2WPT A;  1QRJ A;  3CC2 P;  2MR8 A;  4F37 A;  5HGL A;  5HGO A;  2FQ0 A;  1A43 A;  1M9Y C;  5F2O A;  1AK4 C;  2GZE A;  5KP6 B;  2Y4Z A;  4COC A;  2M8N A;  2LTE A;  1YHQ P;  1A8O A;  2LOL A;  1VQM P;  2LKI A;  1E6J P;  3CE7 A;  1L6N A;  2JQ4 A;  1IUQ A;  2CQ8 A;  1E0H A;  3G29 A;  5HVC A;  3CXC O;  4GR2 A;  1Q81 Q;  1M9E C;  2P9X A;  3G21 A;  1BAJ A;  4H2X C;  1EIA A;  3G28 A;  2PEK A;  4QNB A;  4PH2 A;  3HYB A;  1VQL P;  2MR7 A;  1VKU A;  2FQ1 A;  1M6N A;  2JBG A;  5KP8 B;  3NTE A;  3H47 A;  1VQ7 P;  4U0E A;  5KP7 B;  4PXH B;  1GXH A;  2KG9 A;  2VLN A;  1Z6M A;  2AF8 A;  2CGQ A;  2V4X A;  3DS1 A;  3U43 A;  2CWO A;  4BPG A;  4PH1 A;  2JYG A;  3CCQ P;  1UNK A;  2MVU A;  2XT1 A;  3LRY A;  1GWP A;  1EMV A;  2AFD A;  3CD6 P;  2WLV B;  1W2B O;  5F2N A;  3DTJ A;  4PWV B;  4U0A A;  1S72 P;  2EIA A;  2NO8 A;  2KR5 A;  2FAE A;  2JPR A;  2L9F A;  4UHP B;  1L0I A;  2MF4 A;  2JAZ A;  4PH3 A;  2M8L A;  2K0D X;  2PY8 A;  2PEN A;  3CCU P;  2XGV A;  1ZNV A;  1N8R Q;  4R0M A;  3CPW O;  5HV8 A;  1GPJ A;  4QKO A;  2GOL B;  1M9C C;  2PEJ A;  2QNW A;  2Z45 A;  3B5I A;  1K73 Q;  3HZQ A;  1YIT P;  2N6Y A;  3NY7 B;  2GZF A;  7CEI A;  2ONT A;  3I55 P;  4HTW A;  4DGA C;  2X2B A;  2GZJ A;  1VQ8 P;  2PXR C;  1T8K A;  4BPF A;  5DCK A;  1Q82 Q;  1UJZ A;  2KOS A;  2M5R A;  1JJ2 O;  3E2D A;  2BHV A;  1M74 A;  3WBH A;  5CZD B;  4GR6 A;  3CC4 P;  1AF8 A;  4IPY A;  3H0D A;  2K94 A;  4H2W C;  3VRL C;  2K2Q A;  4DGE C;  1VQK P;  2PEO A;  1NQ4 A;  1VQ6 P;  2LML A;  2XGU A;  1RO0 A;  4XFY A;  1K30 A;  2GYK A;  4HKG A;  2EG5 A;  4NX4 C;  2JU2 A;  2OTL P;  3P05 A;  2L0Q A;  4E92 A;  2GZG A;  1YJ9 P;  2LIU A;  2MD9 A;  2KGE A;  2EHT A;  2N50 A;  3DS2 A;  1HQB A;  2CG5 B;  2K92 A;  2AFE A;  3CCL P;  1X3O A;  4CA3 A;  4NEO A;  2KG8 A;  2VLP A;  4BPH A;  4IZ6 A;  3RG2 A;  4MRT C;  4U0D A;  1K9M Q;  1ZMB A; 
#chains in the Genus database with same CATH homology
 1M9X C;  4B4N A;  2M8P A;  3DS5 A;  4U0A A;  4PH0 A;  3G26 A;  5BS2 A;  1S72 P;  2EIA A;  3G4S P;  1QVF O;  1U7K A;  1QRJ A;  2JPR A;  3CC2 P;  5JPA A;  1M9D C;  5HGL A;  5HGO A;  1A43 A;  1M9Y C;  5F2O A;  1AK4 C;  2OTJ P;  3G1G A;  3CCJ P;  4PH3 A;  1VQ4 P;  2M8L A;  2XDE A;  2KOD A;  2Z46 A;  3CC7 P;  4U0F A;  2E1M A;  2JO0 A;  2PWO A;  3Q20 A;  4E91 A;  2PY8 A;  2PEN A;  3CCU P;  2XGV A;  2Y4Z A;  3DS0 A;  4COC A;  1N8R Q;  1P7N A;  2M8N A;  3G6E P;  3CPW O;  1YHQ P;  1A8O A;  1VQM P;  1YI2 P;  2BUO A;  1E6J P;  1L6N A;  5F2K A;  2GOL B;  1M9C C;  1IUQ A;  2PEJ A;  2Z45 A;  3B5I A;  1VQ5 P;  1K73 Q;  3HZQ A;  1YIT P;  2XV6 A;  3G29 A;  1YIJ P;  4U0B A;  3CCS P;  3G71 P;  3RG6 C;  3CXC O;  1EM9 A;  4GR2 A;  2ONT A;  1Q81 Q;  1M9E C;  3DS3 A;  3I55 P;  2P9X A;  3BP9 A;  4HTW A;  4DGA C;  3G21 A;  1VQ8 P;  1BAJ A;  2PXR C;  1YJN P;  2X2D D;  1RO2 A;  3CCV P;  2DGY A;  4LQW C;  1KQS O;  3CME P;  2L6E A;  5DCK A;  3CCE P;  1KD1 Q;  2WLV A;  3CCM P;  3G1I A;  1EIA A;  1Q82 Q;  3H4E A;  2Z44 A;  3G28 A;  1M1K Q;  1Q7Y Q;  2PEK A;  1JJ2 O;  5I4T G;  3E2D A;  4QNB A;  4PH2 A;  3HYB A;  2BHV A;  3DS4 A;  1K8A Q;  2PEQ A;  4INB A;  3MGE A;  1G03 A;  1M74 A;  1VQL P;  5HGK A;  3WBH A;  4J93 A;  4M0I A;  1VQ9 P;  4GR6 A;  3CC4 P;  2LF4 A;  4U0C A;  4WYM A;  1M6N A;  3M1M A;  5BS1 A;  4IPY A;  3NTE A;  2EFJ A;  3H0D A;  2XXM A;  2QA4 P;  2QEX P;  1QVG O;  3CMA P;  3H47 A;  3VRL C;  1M6E X;  2OAR A;  1VQ7 P;  1EOQ A;  1AFV A;  2GON A;  4U0E A;  3CCR P;  1VQN P;  4DGE C;  1VQK P;  2X83 A;  2PEI A;  2PEO A;  5HGN A;  2PWM A;  2XGY A;  1KC8 Q;  1VQ6 P;  1RNI A;  1M9F C;  3OW2 O;  2XGU A;  1RO0 A;  4XFY A;  5HGM A;  1K30 A;  2EG5 A;  4NX4 C;  2OTL P;  3P05 A;  4XFZ A;  4E92 A;  1AUM A;  2X82 A;  1YJ9 P;  1YJW P;  2V4X A;  3DS1 A;  3DPH A;  2JYL A;  1Q86 Q;  2CWO A;  1VQO P;  3DS2 A;  3G0V A;  4PH1 A;  2JYG A;  3CCQ P;  2XT1 A;  1VQP P;  1D1D A;  1NJI Q;  1M90 Q;  3LRY A;  3I56 P;  4XRQ A;  2KGF A;  3CCL P;  1GWP A;  2PEM A;  4COP A;  4U0D A;  4XFX A;  1K9M Q;  3CD6 P;  2WLV B;  4XRO A;  1W2B O;  1ZMB A;  5F2N A;  3DTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...