2EIAA

X-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
PRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAPPQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKPKAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords EIAV CAPSID PROTEIN P26
publication title Model for lentivirus capsid core assembly based on crystal dimers of EIAV p26.
pubmed doi rcsb
source organism Equine infectious anemia virus
total genus 75
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2eiaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eiaA02
4HTWA 2L6EA 2WLVB 5DCKA 1EM9A 1EOQA 2XGVA 4B4NA 4U0DA 4E92A 1P7NA 2JO0A 2X83A 1GWPA 4E91A 1EIAA 4NX4C 2XXMA 2LF4A 3NTEA 1M9DC 1L6NA 5HGMA 2M8NA 4M0IA 2X82A 4QNBA 4COCA 4XFZA 1QRJA 5HGNA 2GONA 2XDEA 4LQWC 1D1DA 1AUMA 4J93A 2XGYA 4PH1A 4DGEC 2M8LA 1AK4C 1M9EC 4U0AA 3BP9A 3G28A 3MGEA 3G29A 3G1IA 1M9FC 3DS3A 4XRQA 3DS2A 2JYGA 2ONTA 3G26A 5I4TG 5HGOA 3DS5A 1A43A 2GOLB 5JPAA 3LRYA 4XFYA 2M8PA 2WLVA 3DPHA 2JPRA 2PWOA 3DS1A 1M9CC 1A8OA 2JYLA 3P05A 5HGKA 1G03A 2XV6A 3G1GA 2XT1A 3G21A 2KGFA 4U0BA 3H47A 4WYMA 3DTJA 2Y4ZA 3G0VA 2PWMA 4DGAC 4U0CA 4XROA 2BUOA 3VRLC 2V4XA 2X2DD 4U0FA 2PXRC 1M9YC 3H4EA 4U0EA 1M9XC 4COPA 3DS0A 3DS4A 2XGUA 4INBA 4PH3A 1AFVA 2KODA 4PH2A 5HGLA 1U7KA 4XFXA 4PH0A 1BAJA 4IPYA 2EIAA 1E6JP
chains in the Genus database with same CATH superfamily
2VLOA 2L6EA 1M90Q 5DCKA 1EM9A 2XGVA 2GZJA 3B4QA 1GXGA 2K2QA 1GWPA 4E91A 1YHQP 4NX4C 3CC4P 1L6NA 3CCEP 5HGMA 4M0IA 3CMAP 4COCA 2JAZA 1Q7YQ 2GDXA 2WPTA 2K94A 2JQ4A 4XFZA 2XZ0D 5HGNA 5CZDB 1K9MQ 1NQ4A 1KC8Q 2KORA 2GONA 2XDEA 2PEJA 2PY8A 2XGYA 1VQ6P 3RG6C 2XZ1C 2K0XA 3B5IA 2N50A 2FADA 2K0YA 2KGEA 3G28A 3M1MA 3MGEA 1VKUA 3G29A 2OTLP 4F37A 3DS2A 2EHSA 2FQ0A 3G26A 3DS5A 3I56P 2MVUA 2M8PA 2Z46A 2L9FA 4BPGA 1A8OA 1G03A 2XV6A 2PEIA 2N6ZA 2KGFA 2JB0A 3CCLP 2Y4ZA 3G0VA 5HVCA 2PWMA 2PENA 1JJ2O 1E0HA 4NEOA 1RO2A 3VRLC 2ERHA 2V4XA 2PEKA 2X2DD 4U0FA 2KG9A 2PXRC 3H0DA 1T8KA 4GR2A 3DS4A 2LPKA 3CD6P 1VQ9P 1AFVA 5HGLA 1F80D 2P9XA 2MR7A 4IPYA 2N5HA 1YIJP 4IZ6A 5BS2A 1EOQA 1ACPA 2K93A 3CCQP 4U0DA 4E92A 1YI2P 1P7NA 2BHVA 2JU2A 4MRTC 2JO0A 2FQ1A 2KOSA 2XXMA 2FVAA 2LF4A 4GR6A 3NTEA 1QVGO 1KQSO 1M1KQ 3CCRP 3CCJP 2VLPA 2Z45A 3EJDA 3CCSP 3RG2A 2KWLA 2VLNA 2EFJA 3CC7P 4LQWC 1IUQA 2L0QA 1M74A 3G6EP 2GYKA 5F2NA 4H2YC 4DGEC 2JU1A 1ZNVA 5EJDA 1M9EC 4U0AA 2MVVA 2OTJP 1KD1Q 2MY5A 1L0IA 1W2BO 3DS3A 1DNYA 4DG9A 5BS1A 5HGOA 1QVFO 1Q81Q 2X2BA 5JPAA 4XFYA 1YJNP 2LIWA 2VSQA 2CWOA 2JPRA 2VLQA 2MF4A 5HV8A 3CC2P 2M5RA 2LTEA 1FR2A 5HGKA 1Q82Q 1UJZA 3GJNA 2DNWA 3G21A 4HKGA 1EMVA 2GZFA 2GZEA 4WYMA 3DTJA 4R0MA 1MZ8A 2FVFA 1GXHA 1YITP 4COPA 3I55P 2XGUA 4INBA 2FHSC 1M6EX 1L0HA 5KP8B 1GPJA 2KG8A 1BAJA 3WBHA 2N98A 2FQ2A 1ZMBA 1VQPP 1E6JP 1VQ5P 2WLVB 3Q20A 4B4NA 2KGDA 1K8AQ 1VQ4P 1EIAA 2K5XA 2GDYA 2M8NA 5KP7B 2X82A 1YJWP 1UNKA 3CXCO 1M6NA 3GKLC 1D1DA 4J93A 2CQ8A 1X3OA 2AFEA 1NJIQ 1IMQA 3OW2O 1VQKP 2M8LA 1RO0A 2EG5A 2FACA 3BP9A 7CEIA 1N8RQ 3G1IA 2QA4P 1M9FC 2JYGA 2PNGA 2LIUA 2N5IA 1YJ9P 1K30A 2GZGA 3LRYA 3HYBA 2WLVA 2AFDA 1AYIA 1S72P 3DS1A 3HZQA 2JYLA 3P05A 2GDWA 2LOLA 2Z44A 4CA3A 1VQLP 4BPHA 2MR8A 2XT1A 4U0BA 3H47A 2K0DX 3CPWO 2CG5B 4DGAC 4U0CA 2JBGA 2BUOA 2N6YA 1CEIA 1M9YC 3EJBA 2KG6A 1M9XC 3CE7A 3DS0A 2LKIA 3EJEA 4PH3A 1AF8A 2JGPA 4PH2A 1U7KA 2EIAA 1VQNP 4HTWA 4PWVB 4QKOA 3NY7B 2KOQA 2KOOA 2X83A 1DV5A 1RNIA 2CNRA 3E2DA 1M9DC 2OARA 2PEMA 2QEXP 4PXHB 2FAEA 4QNBA 4H2XC 5KP6B 1QRJA 2DGYA 4H2WC 2K92A 2PEQA 2NO8A 1KLPA 5F2OA 2CGQA 2ROQA 1AUMA 2AVAA 2E1MA 1VQOP 2L4BA 4PH1A 1AK4C 1Q86Q 2MD9A 1OR5A 5F2KA 2AF8A 4XRQA 2ONTA 5I4TG 1K73Q 1A43A 2GOLB 1VQMP 4BPFA 2QNWA 3CCVP 2LL8A 3CMEP 2KGCA 3DPHA 2PWOA 1M9CC 1HY8A 1BXIA 1VHNA 3GZMA 2FVEA 1VQ8P 3G1GA 3G71P 1Z6MA 2KGAA 2GZIA 2EHTA 3G4SP 1HQBA 2KW2A 2L22A 4XROA 1IMPA 3GZLA 4UHPB 2PEOA 5EW5E 3H4EA 4U0EA 3LMOA 3U43A 2LMLA 1VQ7P 3CCUP 3CCMP 2KR5A 2KOPA 2KODA 4XFXA 4PH0A
chains in the Genus database with same CATH topology
4HTWA 1VQ5P 2L6EA 2WLVB 1M90Q 5DCKA 1EM9A 3Q20A 5BS2A 1EOQA 2XGVA 3CCQP 4B4NA 4U0DA 4E92A 1YI2P 1P7NA 2BHVA 2JO0A 2X83A 1K8AQ 1GWPA 1RNIA 4E91A 1YHQP 1VQ4P 1EIAA 4NX4C 2XXMA 3CC4P 2LF4A 3E2DA 3NTEA 1M9DC 1L6NA 2OARA 2PEMA 4GR6A 5HGMA 1QVGO 1M1KQ 2QEXP 1KQSO 3CCRP 2M8NA 3CCJP 4M0IA 2X82A 3CMAP 1YJWP 4QNBA 2Z45A 4COCA 3CCSP 1Q7YQ 4XFZA 1M6NA 3CXCO 1QRJA 5HGNA 2DGYA 2EFJA 1K9MQ 1KC8Q 2PEQA 3CC7P 5F2OA 2GONA 2XDEA 4LQWC 1D1DA 2PEJA 1AUMA 2PY8A 1IUQA 4J93A 2XGYA 1VQ6P 1M74A 3RG6C 2E1MA 1VQOP 3G6EP 3CCEP 5F2NA 4PH1A 1NJIQ 3B5IA 4DGEC 3OW2O 1VQKP 2M8LA 1RO0A 1AK4C 1M9EC 2EG5A 4U0AA 1Q86Q 3BP9A 2OTJP 3G28A 3M1MA 3MGEA 1KD1Q 3G29A 2OTLP 1VQNP 1N8RQ 5F2KA 1W2BO 3G1IA 2QA4P 1M9FC 3DS3A 4XRQA 3DS2A 2JYGA 2ONTA 3G26A 5I4TG 5BS1A 5HGOA 1YJ9P 1K73Q 3DS5A 1A43A 3I56P 2GOLB 1QVFO 1K30A 1Q81Q 5JPAA 3LRYA 1VQMP 4XFYA 3CCVP 1YJNP 3CMEP 2M8PA 2WLVA 2Z46A 2CWOA 3HYBA 3DPHA 1S72P 2JPRA 2PWOA 3DS1A 1M9CC 3HZQA 1A8OA 2JYLA 3CC2P 3P05A 5HGKA 2Z44A 1Q82Q 1G03A 1VQLP 1VQ8P 2XV6A 3G1GA 3G71P 2PEIA 2XT1A 3G21A 2KGFA 4U0BA 3G4SP 3H47A 3CPWO 3CCLP 4WYMA 3DTJA 2Y4ZA 3G0VA 2PWMA 2PENA 4DGAC 1JJ2O 4U0CA 1RO2A 4XROA 2BUOA 3VRLC 2V4XA 2PEKA 2X2DD 4U0FA 2PXRC 2PEOA 1M9YC 1YITP 3H4EA 4U0EA 1M9XC 4COPA 3H0DA 4GR2A 3DS0A 3DS4A 3I55P 2XGUA 4INBA 4PH3A 3CCUP 1VQ7P 3CD6P 3CCMP 1VQ9P 1AFVA 2KODA 1M6EX 4PH2A 5HGLA 2P9XA 1U7KA 4XFXA 4PH0A 1BAJA 4IPYA 3WBHA 1YIJP 1VQPP 1ZMBA 2EIAA 1E6JP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTW A;  2L6E A;  2WLV B;  5DCK A;  1EM9 A;  1EOQ A;  2XGV A;  4B4N A;  4U0D A;  4E92 A;  1P7N A;  2JO0 A;  2X83 A;  1GWP A;  4E91 A;  1EIA A;  4NX4 C;  2XXM A;  2LF4 A;  3NTE A;  1M9D C;  1L6N A;  5HGM A;  2M8N A;  4M0I A;  2X82 A;  4QNB A;  4COC A;  4XFZ A;  1QRJ A;  5HGN A;  2GON A;  2XDE A;  4LQW C;  1D1D A;  1AUM A;  4J93 A;  2XGY A;  4PH1 A;  4DGE C;  2M8L A;  1AK4 C;  1M9E C;  4U0A A;  3BP9 A;  3G28 A;  3MGE A;  3G29 A;  3G1I A;  1M9F C;  3DS3 A;  4XRQ A;  3DS2 A;  2JYG A;  2ONT A;  3G26 A;  5I4T G;  5HGO A;  3DS5 A;  1A43 A;  2GOL B;  5JPA A;  3LRY A;  4XFY A;  2M8P A;  2WLV A;  3DPH A;  2JPR A;  2PWO A;  3DS1 A;  1M9C C;  1A8O A;  2JYL A;  3P05 A;  5HGK A;  1G03 A;  2XV6 A;  3G1G A;  2XT1 A;  3G21 A;  2KGF A;  4U0B A;  3H47 A;  4WYM A;  3DTJ A;  2Y4Z A;  3G0V A;  2PWM A;  4DGA C;  4U0C A;  4XRO A;  2BUO A;  3VRL C;  2V4X A;  2X2D D;  4U0F A;  2PXR C;  1M9Y C;  3H4E A;  4U0E A;  1M9X C;  4COP A;  3DS0 A;  3DS4 A;  2XGU A;  4INB A;  4PH3 A;  1AFV A;  2KOD A;  4PH2 A;  5HGL A;  1U7K A;  4XFX A;  4PH0 A;  1BAJ A;  4IPY A;  2EIA A;  1E6J P; 
#chains in the Genus database with same CATH topology
 2VLO A;  2L6E A;  1M90 Q;  5DCK A;  1EM9 A;  2XGV A;  2GZJ A;  3B4Q A;  1GXG A;  2K2Q A;  1GWP A;  4E91 A;  1YHQ P;  4NX4 C;  3CC4 P;  1L6N A;  3CCE P;  5HGM A;  4M0I A;  3CMA P;  4COC A;  2JAZ A;  1Q7Y Q;  2GDX A;  2WPT A;  2K94 A;  2JQ4 A;  4XFZ A;  2XZ0 D;  5HGN A;  5CZD B;  1K9M Q;  1NQ4 A;  1KC8 Q;  2KOR A;  2GON A;  2XDE A;  2PEJ A;  2PY8 A;  2XGY A;  1VQ6 P;  3RG6 C;  2XZ1 C;  2K0X A;  3B5I A;  2N50 A;  2FAD A;  2K0Y A;  2KGE A;  3G28 A;  3M1M A;  3MGE A;  1VKU A;  3G29 A;  2OTL P;  4F37 A;  3DS2 A;  2EHS A;  2FQ0 A;  3G26 A;  3DS5 A;  3I56 P;  2MVU A;  2M8P A;  2Z46 A;  2L9F A;  4BPG A;  1A8O A;  1G03 A;  2XV6 A;  2PEI A;  2N6Z A;  2KGF A;  2JB0 A;  3CCL P;  2Y4Z A;  3G0V A;  5HVC A;  2PWM A;  2PEN A;  1JJ2 O;  1E0H A;  4NEO A;  1RO2 A;  3VRL C;  2ERH A;  2V4X A;  2PEK A;  2X2D D;  4U0F A;  2KG9 A;  2PXR C;  3H0D A;  1T8K A;  4GR2 A;  3DS4 A;  2LPK A;  3CD6 P;  1VQ9 P;  1AFV A;  5HGL A;  1F80 D;  2P9X A;  2MR7 A;  4IPY A;  2N5H A;  1YIJ P;  4IZ6 A;  5BS2 A;  1EOQ A;  1ACP A;  2K93 A;  3CCQ P;  4U0D A;  4E92 A;  1YI2 P;  1P7N A;  2BHV A;  2JU2 A;  4MRT C;  2JO0 A;  2FQ1 A;  2KOS A;  2XXM A;  2FVA A;  2LF4 A;  4GR6 A;  3NTE A;  1QVG O;  1KQS O;  1M1K Q;  3CCR P;  3CCJ P;  2VLP A;  2Z45 A;  3EJD A;  3CCS P;  3RG2 A;  2KWL A;  2VLN A;  2EFJ A;  3CC7 P;  4LQW C;  1IUQ A;  2L0Q A;  1M74 A;  3G6E P;  2GYK A;  5F2N A;  4H2Y C;  4DGE C;  2JU1 A;  1ZNV A;  5EJD A;  1M9E C;  4U0A A;  2MVV A;  2OTJ P;  1KD1 Q;  2MY5 A;  1L0I A;  1W2B O;  3DS3 A;  1DNY A;  4DG9 A;  5BS1 A;  5HGO A;  1QVF O;  1Q81 Q;  2X2B A;  5JPA A;  4XFY A;  1YJN P;  2LIW A;  2VSQ A;  2CWO A;  2JPR A;  2VLQ A;  2MF4 A;  5HV8 A;  3CC2 P;  2M5R A;  2LTE A;  1FR2 A;  5HGK A;  1Q82 Q;  1UJZ A;  3GJN A;  2DNW A;  3G21 A;  4HKG A;  1EMV A;  2GZF A;  2GZE A;  4WYM A;  3DTJ A;  4R0M A;  1MZ8 A;  2FVF A;  1GXH A;  1YIT P;  4COP A;  3I55 P;  2XGU A;  4INB A;  2FHS C;  1M6E X;  1L0H A;  5KP8 B;  1GPJ A;  2KG8 A;  1BAJ A;  3WBH A;  2N98 A;  2FQ2 A;  1ZMB A;  1VQP P;  1E6J P;  1VQ5 P;  2WLV B;  3Q20 A;  4B4N A;  2KGD A;  1K8A Q;  1VQ4 P;  1EIA A;  2K5X A;  2GDY A;  2M8N A;  5KP7 B;  2X82 A;  1YJW P;  1UNK A;  3CXC O;  1M6N A;  3GKL C;  1D1D A;  4J93 A;  2CQ8 A;  1X3O A;  2AFE A;  1NJI Q;  1IMQ A;  3OW2 O;  1VQK P;  2M8L A;  1RO0 A;  2EG5 A;  2FAC A;  3BP9 A;  7CEI A;  1N8R Q;  3G1I A;  2QA4 P;  1M9F C;  2JYG A;  2PNG A;  2LIU A;  2N5I A;  1YJ9 P;  1K30 A;  2GZG A;  3LRY A;  3HYB A;  2WLV A;  2AFD A;  1AYI A;  1S72 P;  3DS1 A;  3HZQ A;  2JYL A;  3P05 A;  2GDW A;  2LOL A;  2Z44 A;  4CA3 A;  1VQL P;  4BPH A;  2MR8 A;  2XT1 A;  4U0B A;  3H47 A;  2K0D X;  3CPW O;  2CG5 B;  4DGA C;  4U0C A;  2JBG A;  2BUO A;  2N6Y A;  1CEI A;  1M9Y C;  3EJB A;  2KG6 A;  1M9X C;  3CE7 A;  3DS0 A;  2LKI A;  3EJE A;  4PH3 A;  1AF8 A;  2JGP A;  4PH2 A;  1U7K A;  2EIA A;  1VQN P;  4HTW A;  4PWV B;  4QKO A;  3NY7 B;  2KOQ A;  2KOO A;  2X83 A;  1DV5 A;  1RNI A;  2CNR A;  3E2D A;  1M9D C;  2OAR A;  2PEM A;  2QEX P;  4PXH B;  2FAE A;  4QNB A;  4H2X C;  5KP6 B;  1QRJ A;  2DGY A;  4H2W C;  2K92 A;  2PEQ A;  2NO8 A;  1KLP A;  5F2O A;  2CGQ A;  2ROQ A;  1AUM A;  2AVA A;  2E1M A;  1VQO P;  2L4B A;  4PH1 A;  1AK4 C;  1Q86 Q;  2MD9 A;  1OR5 A;  5F2K A;  2AF8 A;  4XRQ A;  2ONT A;  5I4T G;  1K73 Q;  1A43 A;  2GOL B;  1VQM P;  4BPF A;  2QNW A;  3CCV P;  2LL8 A;  3CME P;  2KGC A;  3DPH A;  2PWO A;  1M9C C;  1HY8 A;  1BXI A;  1VHN A;  3GZM A;  2FVE A;  1VQ8 P;  3G1G A;  3G71 P;  1Z6M A;  2KGA A;  2GZI A;  2EHT A;  3G4S P;  1HQB A;  2KW2 A;  2L22 A;  4XRO A;  1IMP A;  3GZL A;  4UHP B;  2PEO A;  5EW5 E;  3H4E A;  4U0E A;  3LMO A;  3U43 A;  2LML A;  1VQ7 P;  3CCU P;  3CCM P;  2KR5 A;  2KOP A;  2KOD A;  4XFX A;  4PH0 A; 
#chains in the Genus database with same CATH homology
 4HTW A;  1VQ5 P;  2L6E A;  2WLV B;  1M90 Q;  5DCK A;  1EM9 A;  3Q20 A;  5BS2 A;  1EOQ A;  2XGV A;  3CCQ P;  4B4N A;  4U0D A;  4E92 A;  1YI2 P;  1P7N A;  2BHV A;  2JO0 A;  2X83 A;  1K8A Q;  1GWP A;  1RNI A;  4E91 A;  1YHQ P;  1VQ4 P;  1EIA A;  4NX4 C;  2XXM A;  3CC4 P;  2LF4 A;  3E2D A;  3NTE A;  1M9D C;  1L6N A;  2OAR A;  2PEM A;  4GR6 A;  5HGM A;  1QVG O;  1M1K Q;  2QEX P;  1KQS O;  3CCR P;  2M8N A;  3CCJ P;  4M0I A;  2X82 A;  3CMA P;  1YJW P;  4QNB A;  2Z45 A;  4COC A;  3CCS P;  1Q7Y Q;  4XFZ A;  1M6N A;  3CXC O;  1QRJ A;  5HGN A;  2DGY A;  2EFJ A;  1K9M Q;  1KC8 Q;  2PEQ A;  3CC7 P;  5F2O A;  2GON A;  2XDE A;  4LQW C;  1D1D A;  2PEJ A;  1AUM A;  2PY8 A;  1IUQ A;  4J93 A;  2XGY A;  1VQ6 P;  1M74 A;  3RG6 C;  2E1M A;  1VQO P;  3G6E P;  3CCE P;  5F2N A;  4PH1 A;  1NJI Q;  3B5I A;  4DGE C;  3OW2 O;  1VQK P;  2M8L A;  1RO0 A;  1AK4 C;  1M9E C;  2EG5 A;  4U0A A;  1Q86 Q;  3BP9 A;  2OTJ P;  3G28 A;  3M1M A;  3MGE A;  1KD1 Q;  3G29 A;  2OTL P;  1VQN P;  1N8R Q;  5F2K A;  1W2B O;  3G1I A;  2QA4 P;  1M9F C;  3DS3 A;  4XRQ A;  3DS2 A;  2JYG A;  2ONT A;  3G26 A;  5I4T G;  5BS1 A;  5HGO A;  1YJ9 P;  1K73 Q;  3DS5 A;  1A43 A;  3I56 P;  2GOL B;  1QVF O;  1K30 A;  1Q81 Q;  5JPA A;  3LRY A;  1VQM P;  4XFY A;  3CCV P;  1YJN P;  3CME P;  2M8P A;  2WLV A;  2Z46 A;  2CWO A;  3HYB A;  3DPH A;  1S72 P;  2JPR A;  2PWO A;  3DS1 A;  1M9C C;  3HZQ A;  1A8O A;  2JYL A;  3CC2 P;  3P05 A;  5HGK A;  2Z44 A;  1Q82 Q;  1G03 A;  1VQL P;  1VQ8 P;  2XV6 A;  3G1G A;  3G71 P;  2PEI A;  2XT1 A;  3G21 A;  2KGF A;  4U0B A;  3G4S P;  3H47 A;  3CPW O;  3CCL P;  4WYM A;  3DTJ A;  2Y4Z A;  3G0V A;  2PWM A;  2PEN A;  4DGA C;  1JJ2 O;  4U0C A;  1RO2 A;  4XRO A;  2BUO A;  3VRL C;  2V4X A;  2PEK A;  2X2D D;  4U0F A;  2PXR C;  2PEO A;  1M9Y C;  1YIT P;  3H4E A;  4U0E A;  1M9X C;  4COP A;  3H0D A;  4GR2 A;  3DS0 A;  3DS4 A;  3I55 P;  2XGU A;  4INB A;  4PH3 A;  3CCU P;  1VQ7 P;  3CD6 P;  3CCM P;  1VQ9 P;  1AFV A;  2KOD A;  1M6E X;  4PH2 A;  5HGL A;  2P9X A;  1U7K A;  4XFX A;  4PH0 A;  1BAJ A;  4IPY A;  3WBH A;  1YIJ P;  1VQP P;  1ZMB A;  2EIA A;  1E6J P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...