2EIAA

X-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
206
structure length
206
Chain Sequence
PRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAPPQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKPKAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Model for lentivirus capsid core assembly based on crystal dimers of EIAV p26.
pubmed doi rcsb
source organism Equine infectious anemia virus
molecule tags Viral protein
molecule keywords EIAV CAPSID PROTEIN P26
total genus 75
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2eiaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2eiaA02
2LF4A 2V4XA 1EIAA 1M9CC 2JPRA 1AUMA 3G1IA 2WLVB 3NTEA 4U0DA 4M0IA 3P05A 2XDEA 3BP9A 4PH2A 5HGNA 1AFVA 4WYMA 5I4TG 4XRQA 3G26A 2KODA 4E92A 4IPYA 4INBA 5HGMA 2M8LA 2X83A 1M9DC 4E91A 1M9EC 3G21A 3G0VA 4COCA 1U7KA 4LQWC 3DPHA 2XGVA 2X2DD 3VRLC 1EM9A 2ONTA 2GONA 2JYLA 5JPAA 3LRYA 2GOLB 2X82A 2L6EA 2XT1A 3DS4A 3MGEA 2KGFA 4B4NA 3DS1A 4J93A 2PXRC 4NX4C 4QNBA 5HGOA 4DGAC 3DS3A 3G29A 1M9YC 4XROA 1D1DA 3DTJA 2XGUA 4U0FA 1G03A 2M8NA 1A8OA 4COPA 1P7NA 1M9XC 4PH1A 2JYGA 2PWMA 1AK4C 2M8PA 2Y4ZA 5HGKA 3G28A 2PWOA 1L6NA 3G1GA 4U0AA 3H4EA 4DGEC 2JO0A 3DS5A 1EOQA 4U0CA 1A43A 3H47A 2XV6A 4U0EA 4XFZA 4U0BA 1BAJA 2WLVA 2XXMA 1GWPA 4PH0A 3DS0A 1M9FC 1QRJA 1E6JP 4XFXA 2EIAA 2BUOA 4XFYA 3DS2A 4HTWA 4PH3A 2XGYA 5HGLA 5DCKA
chains in the Genus database with same CATH superfamily
2LF4A 2WPTA 3CCRP 3G1IA 2WLVB 3NTEA 3CCUP 4M0IA 2KORA 4GR6A 1VQNP 2EG5A 2VLPA 2PNGA 1VQ6P 5KP8B 4INBA 1AYIA 5HGMA 2M8LA 3HZQA 1UNKA 2EFJA 1VKUA 1BXIA 1M9EC 3G21A 2N50A 1YJWP 2QNWA 2K5XA 3DPHA 4R0MA 1K8AQ 2GZGA 1EM9A 1RO0A 5JPAA 3LRYA 2OTLP 1GPJA 3M1MA 2FQ2A 2XT1A 3DS4A 3MGEA 3EJBA 2KGFA 4CA3A 4J93A 2L4BA 5CZDB 3CMEP 2PEIA 3DS3A 2LKIA 2CG5B 2JAZA 3CMAP 1M9YC 1X3OA 4XROA 2DNWA 2Z45A 2VLOA 2L0QA 5KP7B 1GXHA 2PEJA 4NEOA 1YI2P 3G6EP 2M8NA 2X2BA 1M9XC 2JYGA 3G28A 3EJDA 1AF8A 1N8RQ 4HKGA 3DS5A 2NO8A 3CC2P 5F2NA 3I56P 1QVFO 2K92A 2XV6A 2K0DX 4XFZA 1EMVA 2JQ4A 2XXMA 3E2DA 1K9MQ 1QRJA 1FR2A 1CEIA 1IMPA 4PH3A 1Q7YQ 5HGLA 2L22A 2CWOA 2VLQA 2MR7A 3Q20A 1YHQP 1Q86Q 1M9CC 1W2BO 1M74A 1VHNA 2CGQA 2JPRA 2K2QA 4U0DA 3P05A 2XDEA 3BP9A 2N6ZA 2M5RA 2KGAA 1F80D 2JBGA 5BS1A 1QVGO 2X83A 2N6YA 3OW2O 1M9DC 3NY7B 1YJNP 3CCLP 2KOSA 1L0IA 4GR2A 4DG9A 1U7KA 2LOLA 1VQ7P 2FADA 2VLNA 2PEQA 3VRLC 2N5HA 2JB0A 4QKOA 2GOLB 2X82A 4B4NA 3DS1A 4PWVB 2LIWA 1Q81Q 3GJNA 1ZNVA 2KOPA 4PXHB 1D1DA 4U0FA 1NQ4A 2GDYA 1P7NA 1MZ8A 5F2OA 5HGKA 2K0XA 2GZEA 2PWOA 1M6NA 2KGCA 4DGEC 2FVEA 2PY8A 1A43A 4U0BA 2JU2A 1Z6MA 2KW2A 1VQOP 3DS0A 1M9FC 1M1KQ 2E1MA 2EIAA 1K30A 2KG9A 1DNYA 4XFYA 3DS2A 2QA4P 2ROQA 2LTEA 3CCVP 2PEKA 1M90Q 5DCKA 1K73Q 4BPFA 3CC7P 3CCJP 2LIUA 1EIAA 3CPWO 5EW5E 2AFEA 1AUMA 2MVUA 1UJZA 5I4TG 1AFVA 4WYMA 4XRQA 7CEIA 2PENA 3G26A 1GXGA 1HQBA 2KODA 4IPYA 3WBHA 2AFDA 5EJDA 2GZJA 2OARA 2QEXP 1VQ4P 3CCMP 2GZFA 2FAEA 3G0VA 1YJ9P 2FACA 1S72P 4COCA 2N5IA 2PEMA 2CQ8A 1IMQA 2X2DD 1ZMBA 1DV5A 2JYLA 2VSQA 4F37A 1VQ8P 5BS2A 2FQ0A 1OR5A 1VQPP 1YIJP 1RNIA 2OTJP 3RG6C 2JGPA 2MY5A 4MRTC 4H2YC 2CNRA 3DTJA 4BPGA 2XZ1C 1G03A 4COPA 2Z46A 4PH1A 1KD1Q 1AK4C 2M8PA 5KP6B 3CCQP 2KR5A 2ERHA 2FHSC 2L9FA 1L6NA 3H4EA 4UHPB 2FQ1A 1EOQA 4U0CA 3H47A 4U0EA 3CCSP 1ACPA 2WLVA 1GWPA 2GDWA 4PH0A 3GZMA 2P9XA 4XFXA 2MR8A 1RO2A 3CE7A 2N98A 2XGYA 3B5IA 2MF4A 2V4XA 1JJ2O 3B4QA 1VQ5P 2KG6A 1L0HA 1Q82Q 1KLPA 1IUQA 4PH2A 5HGNA 1M6EX 3H0DA 4E92A 2BHVA 2XZ0D 2GYKA 4E91A 1KQSO 2KOQA 4IZ6A 1T8KA 3HYBA 3U43A 4LQWC 2EHSA 2XGVA 2FVAA 2JU1A 2LL8A 2ONTA 2GONA 2PEOA 3GKLC 5HVCA 2L6EA 3CD6P 2KGEA 5HV8A 1VQLP 5F2KA 1VQKP 2AF8A 2LPKA 2PXRC 4NX4C 4QNBA 5HGOA 1E0HA 4DGAC 2DGYA 4H2XC 3I55P 2KWLA 3CCEP 3G29A 2MVVA 2Z44A 2FVFA 2XGUA 2K93A 4BPHA 1A8OA 2PWMA 2Y4ZA 3GZLA 2KG8A 1NJIQ 1VQ9P 2KGDA 2K0YA 4H2WC 1KC8Q 2EHTA 3G1GA 4U0AA 2JO0A 3RG2A 2K94A 2GZIA 3CC4P 1BAJA 3G71P 1HY8A 2AVAA 2MD9A 2GDXA 2LMLA 1E6JP 1YITP 2BUOA 1VQMP 2KOOA 3G4SP 4HTWA 3EJEA 3LMOA 3CXCO
chains in the Genus database with same CATH topology
3Q20A 2LF4A 1K73Q 1YHQP 2V4XA 3CC7P 3CCJP 5I4TG 1JJ2O 1EIAA 1VQ5P 1Q86Q 3CPWO 1M9CC 1W2BO 1M74A 2JPRA 3CCRP 1AUMA 1Q82Q 1IUQA 3G1IA 2WLVB 3NTEA 4U0DA 4M0IA 3P05A 2XDEA 3BP9A 4PH2A 5HGNA 1AFVA 4WYMA 1M6EX 2EG5A 4GR6A 4XRQA 2PENA 3G26A 2KODA 3H0DA 4E92A 2BHVA 1VQ6P 4IPYA 4INBA 3WBHA 5BS1A 2OARA 1QVGO 2QEXP 5HGMA 2M8LA 2X83A 3HZQA 3OW2O 1M9DC 4E91A 1KQSO 2EFJA 1VQ4P 3CCMP 1M9EC 3G21A 3G0VA 1YJ9P 1YJNP 3CCLP 3HYBA 4GR2A 4COCA 1YJWP 1U7KA 1S72P 2PEMA 4LQWC 3DPHA 1VQ7P 2XGVA 1VQNP 3CCUP 2PEQA 1K8AQ 2X2DD 1ZMBA 3VRLC 1EM9A 2ONTA 2GONA 1RO0A 5JPAA 2JYLA 3LRYA 2PEOA 2OTLP 2GOLB 2X82A 1VQ8P 2L6EA 5BS2A 3CD6P 3M1MA 1VQLP 2XT1A 3DS4A 3MGEA 5F2KA 2KGFA 1VQKP 1VQPP 4B4NA 3DS1A 4J93A 2PXRC 4NX4C 4QNBA 5HGOA 1YIJP 3CMEP 1RNIA 2OTJP 4DGAC 2DGYA 2PEIA 3I55P 1Q81Q 3DS3A 3RG6C 3CCEP 3G29A 3CMAP 1M9YC 2Z45A 4XROA 1D1DA 2Z44A 3DTJA 2XGUA 4U0FA 2PEJA 1YI2P 1G03A 3G6EP 2M8NA 1A8OA 4COPA 1P7NA 2Z46A 1M9XC 4PH1A 2JYGA 1KD1Q 5F2OA 2PWMA 1AK4C 2M8PA 2Y4ZA 5HGKA 3G28A 1NJIQ 1VQ9P 3CCQP 1KC8Q 2PWOA 1M6NA 1N8RQ 1L6NA 3G1GA 4U0AA 3H4EA 4DGEC 2JO0A 3DS5A 3CC2P 5F2NA 3I56P 1QVFO 1EOQA 4U0CA 1A43A 2PY8A 3H47A 2XV6A 4U0EA 4XFZA 4U0BA 3CCSP 3CC4P 1BAJA 2WLVA 3G71P 2XXMA 1VQOP 1GWPA 3E2DA 1K9MQ 4PH0A 3DS0A 1M9FC 1QRJA 2P9XA 1E6JP 1YITP 1M1KQ 2E1MA 4XFXA 2EIAA 1K30A 2BUOA 1VQMP 4XFYA 3DS2A 2QA4P 3G4SP 4HTWA 1RO2A 4PH3A 2XGYA 1Q7YQ 5HGLA 2PEKA 2CWOA 3B5IA 3CCVP 1M90Q 3CXCO 5DCKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF4 A;  2V4X A;  1EIA A;  1M9C C;  2JPR A;  1AUM A;  3G1I A;  2WLV B;  3NTE A;  4U0D A;  4M0I A;  3P05 A;  2XDE A;  3BP9 A;  4PH2 A;  5HGN A;  1AFV A;  4WYM A;  5I4T G;  4XRQ A;  3G26 A;  2KOD A;  4E92 A;  4IPY A;  4INB A;  5HGM A;  2M8L A;  2X83 A;  1M9D C;  4E91 A;  1M9E C;  3G21 A;  3G0V A;  4COC A;  1U7K A;  4LQW C;  3DPH A;  2XGV A;  2X2D D;  3VRL C;  1EM9 A;  2ONT A;  2GON A;  2JYL A;  5JPA A;  3LRY A;  2GOL B;  2X82 A;  2L6E A;  2XT1 A;  3DS4 A;  3MGE A;  2KGF A;  4B4N A;  3DS1 A;  4J93 A;  2PXR C;  4NX4 C;  4QNB A;  5HGO A;  4DGA C;  3DS3 A;  3G29 A;  1M9Y C;  4XRO A;  1D1D A;  3DTJ A;  2XGU A;  4U0F A;  1G03 A;  2M8N A;  1A8O A;  4COP A;  1P7N A;  1M9X C;  4PH1 A;  2JYG A;  2PWM A;  1AK4 C;  2M8P A;  2Y4Z A;  5HGK A;  3G28 A;  2PWO A;  1L6N A;  3G1G A;  4U0A A;  3H4E A;  4DGE C;  2JO0 A;  3DS5 A;  1EOQ A;  4U0C A;  1A43 A;  3H47 A;  2XV6 A;  4U0E A;  4XFZ A;  4U0B A;  1BAJ A;  2WLV A;  2XXM A;  1GWP A;  4PH0 A;  3DS0 A;  1M9F C;  1QRJ A;  1E6J P;  4XFX A;  2EIA A;  2BUO A;  4XFY A;  3DS2 A;  4HTW A;  4PH3 A;  2XGY A;  5HGL A;  5DCK A; 
#chains in the Genus database with same CATH topology
 2LF4 A;  2WPT A;  3CCR P;  3G1I A;  2WLV B;  3NTE A;  3CCU P;  4M0I A;  2KOR A;  4GR6 A;  1VQN P;  2EG5 A;  2VLP A;  2PNG A;  1VQ6 P;  5KP8 B;  4INB A;  1AYI A;  5HGM A;  2M8L A;  3HZQ A;  1UNK A;  2EFJ A;  1VKU A;  1BXI A;  1M9E C;  3G21 A;  2N50 A;  1YJW P;  2QNW A;  2K5X A;  3DPH A;  4R0M A;  1K8A Q;  2GZG A;  1EM9 A;  1RO0 A;  5JPA A;  3LRY A;  2OTL P;  1GPJ A;  3M1M A;  2FQ2 A;  2XT1 A;  3DS4 A;  3MGE A;  3EJB A;  2KGF A;  4CA3 A;  4J93 A;  2L4B A;  5CZD B;  3CME P;  2PEI A;  3DS3 A;  2LKI A;  2CG5 B;  2JAZ A;  3CMA P;  1M9Y C;  1X3O A;  4XRO A;  2DNW A;  2Z45 A;  2VLO A;  2L0Q A;  5KP7 B;  1GXH A;  2PEJ A;  4NEO A;  1YI2 P;  3G6E P;  2M8N A;  2X2B A;  1M9X C;  2JYG A;  3G28 A;  3EJD A;  1AF8 A;  1N8R Q;  4HKG A;  3DS5 A;  2NO8 A;  3CC2 P;  5F2N A;  3I56 P;  1QVF O;  2K92 A;  2XV6 A;  2K0D X;  4XFZ A;  1EMV A;  2JQ4 A;  2XXM A;  3E2D A;  1K9M Q;  1QRJ A;  1FR2 A;  1CEI A;  1IMP A;  4PH3 A;  1Q7Y Q;  5HGL A;  2L22 A;  2CWO A;  2VLQ A;  2MR7 A;  3Q20 A;  1YHQ P;  1Q86 Q;  1M9C C;  1W2B O;  1M74 A;  1VHN A;  2CGQ A;  2JPR A;  2K2Q A;  4U0D A;  3P05 A;  2XDE A;  3BP9 A;  2N6Z A;  2M5R A;  2KGA A;  1F80 D;  2JBG A;  5BS1 A;  1QVG O;  2X83 A;  2N6Y A;  3OW2 O;  1M9D C;  3NY7 B;  1YJN P;  3CCL P;  2KOS A;  1L0I A;  4GR2 A;  4DG9 A;  1U7K A;  2LOL A;  1VQ7 P;  2FAD A;  2VLN A;  2PEQ A;  3VRL C;  2N5H A;  2JB0 A;  4QKO A;  2GOL B;  2X82 A;  4B4N A;  3DS1 A;  4PWV B;  2LIW A;  1Q81 Q;  3GJN A;  1ZNV A;  2KOP A;  4PXH B;  1D1D A;  4U0F A;  1NQ4 A;  2GDY A;  1P7N A;  1MZ8 A;  5F2O A;  5HGK A;  2K0X A;  2GZE A;  2PWO A;  1M6N A;  2KGC A;  4DGE C;  2FVE A;  2PY8 A;  1A43 A;  4U0B A;  2JU2 A;  1Z6M A;  2KW2 A;  1VQO P;  3DS0 A;  1M9F C;  1M1K Q;  2E1M A;  2EIA A;  1K30 A;  2KG9 A;  1DNY A;  4XFY A;  3DS2 A;  2QA4 P;  2ROQ A;  2LTE A;  3CCV P;  2PEK A;  1M90 Q;  5DCK A;  1K73 Q;  4BPF A;  3CC7 P;  3CCJ P;  2LIU A;  1EIA A;  3CPW O;  5EW5 E;  2AFE A;  1AUM A;  2MVU A;  1UJZ A;  5I4T G;  1AFV A;  4WYM A;  4XRQ A;  7CEI A;  2PEN A;  3G26 A;  1GXG A;  1HQB A;  2KOD A;  4IPY A;  3WBH A;  2AFD A;  5EJD A;  2GZJ A;  2OAR A;  2QEX P;  1VQ4 P;  3CCM P;  2GZF A;  2FAE A;  3G0V A;  1YJ9 P;  2FAC A;  1S72 P;  4COC A;  2N5I A;  2PEM A;  2CQ8 A;  1IMQ A;  2X2D D;  1ZMB A;  1DV5 A;  2JYL A;  2VSQ A;  4F37 A;  1VQ8 P;  5BS2 A;  2FQ0 A;  1OR5 A;  1VQP P;  1YIJ P;  1RNI A;  2OTJ P;  3RG6 C;  2JGP A;  2MY5 A;  4MRT C;  4H2Y C;  2CNR A;  3DTJ A;  4BPG A;  2XZ1 C;  1G03 A;  4COP A;  2Z46 A;  4PH1 A;  1KD1 Q;  1AK4 C;  2M8P A;  5KP6 B;  3CCQ P;  2KR5 A;  2ERH A;  2FHS C;  2L9F A;  1L6N A;  3H4E A;  4UHP B;  2FQ1 A;  1EOQ A;  4U0C A;  3H47 A;  4U0E A;  3CCS P;  1ACP A;  2WLV A;  1GWP A;  2GDW A;  4PH0 A;  3GZM A;  2P9X A;  4XFX A;  2MR8 A;  1RO2 A;  3CE7 A;  2N98 A;  2XGY A;  3B5I A;  2MF4 A;  2V4X A;  1JJ2 O;  3B4Q A;  1VQ5 P;  2KG6 A;  1L0H A;  1Q82 Q;  1KLP A;  1IUQ A;  4PH2 A;  5HGN A;  1M6E X;  3H0D A;  4E92 A;  2BHV A;  2XZ0 D;  2GYK A;  4E91 A;  1KQS O;  2KOQ A;  4IZ6 A;  1T8K A;  3HYB A;  3U43 A;  4LQW C;  2EHS A;  2XGV A;  2FVA A;  2JU1 A;  2LL8 A;  2ONT A;  2GON A;  2PEO A;  3GKL C;  5HVC A;  2L6E A;  3CD6 P;  2KGE A;  5HV8 A;  1VQL P;  5F2K A;  1VQK P;  2AF8 A;  2LPK A;  2PXR C;  4NX4 C;  4QNB A;  5HGO A;  1E0H A;  4DGA C;  2DGY A;  4H2X C;  3I55 P;  2KWL A;  3CCE P;  3G29 A;  2MVV A;  2Z44 A;  2FVF A;  2XGU A;  2K93 A;  4BPH A;  1A8O A;  2PWM A;  2Y4Z A;  3GZL A;  2KG8 A;  1NJI Q;  1VQ9 P;  2KGD A;  2K0Y A;  4H2W C;  1KC8 Q;  2EHT A;  3G1G A;  4U0A A;  2JO0 A;  3RG2 A;  2K94 A;  2GZI A;  3CC4 P;  1BAJ A;  3G71 P;  1HY8 A;  2AVA A;  2MD9 A;  2GDX A;  2LML A;  1E6J P;  1YIT P;  2BUO A;  1VQM P;  2KOO A;  3G4S P;  4HTW A;  3EJE A;  3LMO A;  3CXC O; 
#chains in the Genus database with same CATH homology
 3Q20 A;  2LF4 A;  1K73 Q;  1YHQ P;  2V4X A;  3CC7 P;  3CCJ P;  5I4T G;  1JJ2 O;  1EIA A;  1VQ5 P;  1Q86 Q;  3CPW O;  1M9C C;  1W2B O;  1M74 A;  2JPR A;  3CCR P;  1AUM A;  1Q82 Q;  1IUQ A;  3G1I A;  2WLV B;  3NTE A;  4U0D A;  4M0I A;  3P05 A;  2XDE A;  3BP9 A;  4PH2 A;  5HGN A;  1AFV A;  4WYM A;  1M6E X;  2EG5 A;  4GR6 A;  4XRQ A;  2PEN A;  3G26 A;  2KOD A;  3H0D A;  4E92 A;  2BHV A;  1VQ6 P;  4IPY A;  4INB A;  3WBH A;  5BS1 A;  2OAR A;  1QVG O;  2QEX P;  5HGM A;  2M8L A;  2X83 A;  3HZQ A;  3OW2 O;  1M9D C;  4E91 A;  1KQS O;  2EFJ A;  1VQ4 P;  3CCM P;  1M9E C;  3G21 A;  3G0V A;  1YJ9 P;  1YJN P;  3CCL P;  3HYB A;  4GR2 A;  4COC A;  1YJW P;  1U7K A;  1S72 P;  2PEM A;  4LQW C;  3DPH A;  1VQ7 P;  2XGV A;  1VQN P;  3CCU P;  2PEQ A;  1K8A Q;  2X2D D;  1ZMB A;  3VRL C;  1EM9 A;  2ONT A;  2GON A;  1RO0 A;  5JPA A;  2JYL A;  3LRY A;  2PEO A;  2OTL P;  2GOL B;  2X82 A;  1VQ8 P;  2L6E A;  5BS2 A;  3CD6 P;  3M1M A;  1VQL P;  2XT1 A;  3DS4 A;  3MGE A;  5F2K A;  2KGF A;  1VQK P;  1VQP P;  4B4N A;  3DS1 A;  4J93 A;  2PXR C;  4NX4 C;  4QNB A;  5HGO A;  1YIJ P;  3CME P;  1RNI A;  2OTJ P;  4DGA C;  2DGY A;  2PEI A;  3I55 P;  1Q81 Q;  3DS3 A;  3RG6 C;  3CCE P;  3G29 A;  3CMA P;  1M9Y C;  2Z45 A;  4XRO A;  1D1D A;  2Z44 A;  3DTJ A;  2XGU A;  4U0F A;  2PEJ A;  1YI2 P;  1G03 A;  3G6E P;  2M8N A;  1A8O A;  4COP A;  1P7N A;  2Z46 A;  1M9X C;  4PH1 A;  2JYG A;  1KD1 Q;  5F2O A;  2PWM A;  1AK4 C;  2M8P A;  2Y4Z A;  5HGK A;  3G28 A;  1NJI Q;  1VQ9 P;  3CCQ P;  1KC8 Q;  2PWO A;  1M6N A;  1N8R Q;  1L6N A;  3G1G A;  4U0A A;  3H4E A;  4DGE C;  2JO0 A;  3DS5 A;  3CC2 P;  5F2N A;  3I56 P;  1QVF O;  1EOQ A;  4U0C A;  1A43 A;  2PY8 A;  3H47 A;  2XV6 A;  4U0E A;  4XFZ A;  4U0B A;  3CCS P;  3CC4 P;  1BAJ A;  2WLV A;  3G71 P;  2XXM A;  1VQO P;  1GWP A;  3E2D A;  1K9M Q;  4PH0 A;  3DS0 A;  1M9F C;  1QRJ A;  2P9X A;  1E6J P;  1YIT P;  1M1K Q;  2E1M A;  4XFX A;  2EIA A;  1K30 A;  2BUO A;  1VQM P;  4XFY A;  3DS2 A;  2QA4 P;  3G4S P;  4HTW A;  1RO2 A;  4PH3 A;  2XGY A;  1Q7Y Q;  5HGL A;  2PEK A;  2CWO A;  3B5I A;  3CCV P;  1M90 Q;  3CXC O;  5DCK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...