5JPAA

Hexameric hiv-1 ca h12y mutant
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
208
Chain Sequence
PIVQNLQGQMVYQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid Protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
total genus 74
structure length 208
sequence length 219
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5jpaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5jpaA02
1AFVA 4INBA 2JYGA 4PH3A 4XROA 1AUMA 1A43A 1QRJA 5DCKA 1M9YC 4XFXA 1M9XC 1M9CC 2XGYA 4PH0A 1EOQA 5HGNA 1U7KA 4U0AA 1M9EC 2JO0A 1E6JP 1D1DA 3G26A 4B4NA 3VRLC 2GOLB 4U0BA 2WLVB 2KGFA 2X2DD 2PWOA 2XXMA 4COPA 4DGAC 2XGVA 2KODA 3G28A 2XDEA 3DS5A 4U0DA 2LF4A 5HGOA 1A8OA 2JYLA 2XGUA 2M8PA 4U0FA 4NX4C 3DS4A 1M9DC 3P05A 3G0VA 3NTEA 1L6NA 4LQWC 1GWPA 2BUOA 5HGLA 4PH2A 3G21A 4COCA 2JPRA 2M8LA 3DS0A 3MGEA 2GONA 3DS2A 4HTWA 4QNBA 5JPAA 3G29A 3BP9A 1P7NA 3H47A 4U0EA 5I4TG 2XV6A 5HGMA 3DTJA 3DS1A 2V4XA 4WYMA 4XFYA 3G1IA 4XFZA 1EIAA 3DPHA 3G1GA 4M0IA 1BAJA 2X83A 4U0CA 4E92A 2XT1A 4E91A 4PH1A 2EIAA 3DS3A 1AK4C 3H4EA 2X82A 2PXRC 5HGKA 1G03A 1M9FC 2Y4ZA 4IPYA 2M8NA 1EM9A 2WLVA 4DGEC 4XRQA 2PWMA 4J93A 2L6EA 3LRYA 2ONTA
chains in the Genus database with same CATH superfamily
1VQPP 4INBA 3CCLP 2MVUA 4BPHA 1M9YC 4NEOA 2PEIA 4GR2A 1M9XC 2XGYA 4QKOA 5HGNA 1U7KA 2GDXA 1YJWP 1E6JP 4B4NA 2VLQA 3GZMA 2GZFA 1HQBA 2X2DD 2NO8A 5EW5E 4UHPB 5BS1A 1VQ9P 2FACA 4IZ6A 1VQ4P 1VQ7P 2EHSA 4U0FA 3DS4A 5HV8A 3P05A 1EMVA 1RO2A 3NTEA 2KOOA 2GDWA 1YIJP 5HGLA 2FVAA 4PH2A 2PENA 1AYIA 1RO0A 5BS2A 3EJBA 1CEIA 1P7NA 1Q7YQ 4U0EA 1N8RQ 2K2QA 4GR6A 1Q81Q 3GJNA 1GXHA 4M0IA 1BAJA 2WPTA 4U0CA 1IMQA 2FAEA 3EJDA 4E91A 2PEJA 3CCEP 4H2YC 2XZ0D 3H4EA 2ERHA 1ZNVA 3CCQP 5KP7B 1YITP 4DGEC 2LPKA 3CC7P 1AFVA 2KR5A 2JYGA 2MVVA 2N6ZA 3CE7A 1VQ5P 7CEIA 1VQNP 2JU1A 3EJEA 2KGEA 2P9XA 2VLPA 1QVFO 2DNWA 1W2BO 4H2WC 3CCRP 1D1DA 2MD9A 2Z45A 3HYBA 3G26A 2EG5A 3I56P 1NQ4A 3I55P 2WLVB 2OARA 1RNIA 2XXMA 1S72P 4COPA 2AFEA 1IMPA 4CA3A 3G6EP 1K8AQ 3GZLA 2JAZA 3DS5A 1YHQP 4U0DA 1UJZA 5HGOA 3NY7B 1A8OA 1X3OA 2JYLA 2OTLP 2ROQA 1M9DC 1L6NA 1HY8A 1GWPA 3G21A 3RG2A 3G71P 2E1MA 4COCA 2JPRA 3DS0A 3CCVP 2L9FA 2AVAA 2N5HA 2KG6A 5KP8B 2N6YA 1FR2A 3DTJA 1F80D 3DS1A 2V4XA 4WYMA 5F2NA 1VQ6P 4XFYA 3G1IA 2CWOA 1YJ9P 1E0HA 3DPHA 2JB0A 2GDYA 2XT1A 3HZQA 1T8KA 1AK4C 2QEXP 1BXIA 3CMEP 2KGAA 1M6EX 4IPYA 2M8NA 1M1KQ 2CGQA 2JQ4A 2PWMA 1AUMA 1QVGO 2K0DX 2VLOA 1QRJA 5DCKA 2GYKA 1GXGA 2FADA 1VQKP 2GZIA 2PEQA 1EOQA 1MZ8A 2PEOA 3LMOA 5F2KA 4U0AA 2K93A 2MY5A 1AF8A 1NJIQ 3CMAP 3VRLC 2GOLB 2K5XA 1UNKA 4H2XC 2JBGA 4PXHB 2PNGA 2K94A 2PWOA 4DGAC 2KODA 2XDEA 3CPWO 2FQ0A 1M90Q 1L0IA 1ACPA 2LIUA 2XGUA 2M8PA 4NX4C 1KQSO 1JJ2O 2K92A 2OTJP 4F37A 1K30A 4MRTC 1VQMP 1Q86Q 3GKLC 2DGYA 2PEKA 2BUOA 2L22A 1K9MQ 4DG9A 3G4SP 5F2OA 3RG6C 1K73Q 2Z46A 2GONA 4HKGA 5HVCA 3DS2A 4HTWA 2L0QA 4QNBA 1GPJA 3H47A 2MF4A 2PY8A 5I4TG 1VQOP 2XV6A 3WBHA 1KD1Q 2L6EA 1IUQA 2BHVA 1Q82Q 1VQLP 2AF8A 3G1GA 2FVEA 5EJDA 2GZJA 2CG5B 2K0YA 1Z6MA 3CCJP 2KGDA 2X83A 2FQ1A 4PH1A 2EIAA 2FHSC 1ZMBA 1L0HA 2LL8A 5HGKA 1EM9A 2WLVA 4XRQA 2CNRA 4J93A 3CCUP 4PH3A 4XROA 3CXCO 1A43A 3CCSP 3OW2O 2KW2A 1YI2P 4XFXA 1M9CC 4PH0A 3B4QA 2N5IA 2EHTA 1M9EC 2JO0A 2VSQA 1KLPA 2FVFA 2FQ2A 2LTEA 1VKUA 4U0BA 5CZDB 2LIWA 2KWLA 2KGFA 2N50A 2VLNA 2K0XA 2X2BA 5KP6B 2QA4P 3H0DA 2XGVA 3G28A 3E2DA 2MR7A 1DV5A 2LF4A 3M1MA 3G0VA 2MR8A 2GZGA 4LQWC 2XZ1C 2LMLA 1M74A 1VHNA 2M8LA 2GZEA 2LKIA 3MGEA 2CQ8A 2KG9A 1VQ8P 3CCMP 3CD6P 2M5RA 2JGPA 2KORA 5JPAA 3G29A 3BP9A 2QNWA 5HGMA 2PEMA 2AFDA 1M6NA 3CC2P 4XFZA 1EIAA 3Q20A 2EFJA 1YJNP 3B5IA 2KOPA 2L4BA 4E92A 4PWVB 1KC8Q 2KG8A 2LOLA 3DS3A 4R0MA 2KOSA 2X82A 2Z44A 3CC4P 2PXRC 1DNYA 4BPFA 4BPGA 1G03A 1M9FC 2Y4ZA 2KGCA 2KOQA 3U43A 1OR5A 2JU2A 2N98A 3LRYA 2ONTA
chains in the Genus database with same CATH topology
1AFVA 3CCUP 1VQPP 4INBA 2JYGA 4PH3A 4XROA 1AUMA 3CXCO 3CCLP 1A43A 3CCSP 1QVGO 3OW2O 1QRJA 5DCKA 1M9YC 1VQ5P 1VQNP 1VQKP 2PEIA 1YI2P 4XFXA 4GR2A 2PEQA 1M9XC 1M9CC 2XGYA 4PH0A 1EOQA 2P9XA 5HGNA 2PEOA 1U7KA 1QVFO 1YJWP 5F2KA 4U0AA 1W2BO 1M9EC 2JO0A 1E6JP 3CCRP 1D1DA 2Z45A 3HYBA 3G26A 4B4NA 1NJIQ 3CMAP 2EG5A 3I56P 3VRLC 2GOLB 4U0BA 3I55P 2WLVB 2OARA 2KGFA 2X2DD 2PWOA 1RNIA 2XXMA 1S72P 4COPA 5BS1A 4DGAC 3G6EP 2QA4P 1K8AQ 3H0DA 2XGVA 2KODA 3E2DA 3G28A 2XDEA 1VQ9P 3DS5A 3CC7P 3CPWO 1YHQP 1VQ4P 4U0DA 1VQ7P 2LF4A 5HGOA 1M90Q 3M1MA 1A8OA 2JYLA 2XGUA 2OTLP 2M8PA 4U0FA 4NX4C 3DS4A 1M9DC 3P05A 3G0VA 1KQSO 1RO2A 3NTEA 1JJ2O 2OTJP 1L6NA 1K30A 1VQMP 1Q86Q 4LQWC 1GWPA 2DGYA 2PEKA 1YIJP 2BUOA 5HGLA 1K9MQ 4PH2A 1M74A 3G21A 3G71P 2E1MA 4COCA 2JPRA 3G4SP 2M8LA 5F2OA 3RG6C 3DS0A 2Z46A 1K73Q 2PENA 3MGEA 2GONA 1RO0A 5BS2A 1VQ8P 3CCVP 3CC2P 3CCMP 3DS2A 3CD6P 4HTWA 4QNBA 5JPAA 3G29A 3BP9A 1P7NA 3H47A 4U0EA 1Q7YQ 2PY8A 5I4TG 1VQOP 2XV6A 3WBHA 5HGMA 2PEMA 1KD1Q 3DTJA 3DS1A 2V4XA 4WYMA 5F2NA 1VQ6P 4XFYA 1IUQA 2BHVA 4GR6A 3G1IA 1M6NA 2CWOA 1Q82Q 1YJ9P 1N8RQ 1VQLP 4XFZA 1EIAA 1Q81Q 3Q20A 3DPHA 3G1GA 2EFJA 4M0IA 3B5IA 1YJNP 1BAJA 3CCJP 2X83A 4U0CA 4E92A 1KC8Q 2XT1A 4E91A 4PH1A 2PEJA 3HZQA 2EIAA 3DS3A 1AK4C 3CCEP 3H4EA 2QEXP 2X82A 2Z44A 1ZMBA 3CC4P 2PXRC 3CMEP 3CCQP 1M6EX 5HGKA 1G03A 1M9FC 2Y4ZA 4IPYA 2M8NA 1YITP 1M1KQ 1EM9A 2WLVA 4DGEC 4XRQA 2PWMA 4J93A 2L6EA 3LRYA 2ONTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFV A;  4INB A;  2JYG A;  4PH3 A;  4XRO A;  1AUM A;  1A43 A;  1QRJ A;  5DCK A;  1M9Y C;  4XFX A;  1M9X C;  1M9C C;  2XGY A;  4PH0 A;  1EOQ A;  5HGN A;  1U7K A;  4U0A A;  1M9E C;  2JO0 A;  1E6J P;  1D1D A;  3G26 A;  4B4N A;  3VRL C;  2GOL B;  4U0B A;  2WLV B;  2KGF A;  2X2D D;  2PWO A;  2XXM A;  4COP A;  4DGA C;  2XGV A;  2KOD A;  3G28 A;  2XDE A;  3DS5 A;  4U0D A;  2LF4 A;  5HGO A;  1A8O A;  2JYL A;  2XGU A;  2M8P A;  4U0F A;  4NX4 C;  3DS4 A;  1M9D C;  3P05 A;  3G0V A;  3NTE A;  1L6N A;  4LQW C;  1GWP A;  2BUO A;  5HGL A;  4PH2 A;  3G21 A;  4COC A;  2JPR A;  2M8L A;  3DS0 A;  3MGE A;  2GON A;  3DS2 A;  4HTW A;  4QNB A;  5JPA A;  3G29 A;  3BP9 A;  1P7N A;  3H47 A;  4U0E A;  5I4T G;  2XV6 A;  5HGM A;  3DTJ A;  3DS1 A;  2V4X A;  4WYM A;  4XFY A;  3G1I A;  4XFZ A;  1EIA A;  3DPH A;  3G1G A;  4M0I A;  1BAJ A;  2X83 A;  4U0C A;  4E92 A;  2XT1 A;  4E91 A;  4PH1 A;  2EIA A;  3DS3 A;  1AK4 C;  3H4E A;  2X82 A;  2PXR C;  5HGK A;  1G03 A;  1M9F C;  2Y4Z A;  4IPY A;  2M8N A;  1EM9 A;  2WLV A;  4DGE C;  4XRQ A;  2PWM A;  4J93 A;  2L6E A;  3LRY A;  2ONT A; 
#chains in the Genus database with same CATH topology
 1VQP P;  4INB A;  3CCL P;  2MVU A;  4BPH A;  1M9Y C;  4NEO A;  2PEI A;  4GR2 A;  1M9X C;  2XGY A;  4QKO A;  5HGN A;  1U7K A;  2GDX A;  1YJW P;  1E6J P;  4B4N A;  2VLQ A;  3GZM A;  2GZF A;  1HQB A;  2X2D D;  2NO8 A;  5EW5 E;  4UHP B;  5BS1 A;  1VQ9 P;  2FAC A;  4IZ6 A;  1VQ4 P;  1VQ7 P;  2EHS A;  4U0F A;  3DS4 A;  5HV8 A;  3P05 A;  1EMV A;  1RO2 A;  3NTE A;  2KOO A;  2GDW A;  1YIJ P;  5HGL A;  2FVA A;  4PH2 A;  2PEN A;  1AYI A;  1RO0 A;  5BS2 A;  3EJB A;  1CEI A;  1P7N A;  1Q7Y Q;  4U0E A;  1N8R Q;  2K2Q A;  4GR6 A;  1Q81 Q;  3GJN A;  1GXH A;  4M0I A;  1BAJ A;  2WPT A;  4U0C A;  1IMQ A;  2FAE A;  3EJD A;  4E91 A;  2PEJ A;  3CCE P;  4H2Y C;  2XZ0 D;  3H4E A;  2ERH A;  1ZNV A;  3CCQ P;  5KP7 B;  1YIT P;  4DGE C;  2LPK A;  3CC7 P;  1AFV A;  2KR5 A;  2JYG A;  2MVV A;  2N6Z A;  3CE7 A;  1VQ5 P;  7CEI A;  1VQN P;  2JU1 A;  3EJE A;  2KGE A;  2P9X A;  2VLP A;  1QVF O;  2DNW A;  1W2B O;  4H2W C;  3CCR P;  1D1D A;  2MD9 A;  2Z45 A;  3HYB A;  3G26 A;  2EG5 A;  3I56 P;  1NQ4 A;  3I55 P;  2WLV B;  2OAR A;  1RNI A;  2XXM A;  1S72 P;  4COP A;  2AFE A;  1IMP A;  4CA3 A;  3G6E P;  1K8A Q;  3GZL A;  2JAZ A;  3DS5 A;  1YHQ P;  4U0D A;  1UJZ A;  5HGO A;  3NY7 B;  1A8O A;  1X3O A;  2JYL A;  2OTL P;  2ROQ A;  1M9D C;  1L6N A;  1HY8 A;  1GWP A;  3G21 A;  3RG2 A;  3G71 P;  2E1M A;  4COC A;  2JPR A;  3DS0 A;  3CCV P;  2L9F A;  2AVA A;  2N5H A;  2KG6 A;  5KP8 B;  2N6Y A;  1FR2 A;  3DTJ A;  1F80 D;  3DS1 A;  2V4X A;  4WYM A;  5F2N A;  1VQ6 P;  4XFY A;  3G1I A;  2CWO A;  1YJ9 P;  1E0H A;  3DPH A;  2JB0 A;  2GDY A;  2XT1 A;  3HZQ A;  1T8K A;  1AK4 C;  2QEX P;  1BXI A;  3CME P;  2KGA A;  1M6E X;  4IPY A;  2M8N A;  1M1K Q;  2CGQ A;  2JQ4 A;  2PWM A;  1AUM A;  1QVG O;  2K0D X;  2VLO A;  1QRJ A;  5DCK A;  2GYK A;  1GXG A;  2FAD A;  1VQK P;  2GZI A;  2PEQ A;  1EOQ A;  1MZ8 A;  2PEO A;  3LMO A;  5F2K A;  4U0A A;  2K93 A;  2MY5 A;  1AF8 A;  1NJI Q;  3CMA P;  3VRL C;  2GOL B;  2K5X A;  1UNK A;  4H2X C;  2JBG A;  4PXH B;  2PNG A;  2K94 A;  2PWO A;  4DGA C;  2KOD A;  2XDE A;  3CPW O;  2FQ0 A;  1M90 Q;  1L0I A;  1ACP A;  2LIU A;  2XGU A;  2M8P A;  4NX4 C;  1KQS O;  1JJ2 O;  2K92 A;  2OTJ P;  4F37 A;  1K30 A;  4MRT C;  1VQM P;  1Q86 Q;  3GKL C;  2DGY A;  2PEK A;  2BUO A;  2L22 A;  1K9M Q;  4DG9 A;  3G4S P;  5F2O A;  3RG6 C;  1K73 Q;  2Z46 A;  2GON A;  4HKG A;  5HVC A;  3DS2 A;  4HTW A;  2L0Q A;  4QNB A;  1GPJ A;  3H47 A;  2MF4 A;  2PY8 A;  5I4T G;  1VQO P;  2XV6 A;  3WBH A;  1KD1 Q;  2L6E A;  1IUQ A;  2BHV A;  1Q82 Q;  1VQL P;  2AF8 A;  3G1G A;  2FVE A;  5EJD A;  2GZJ A;  2CG5 B;  2K0Y A;  1Z6M A;  3CCJ P;  2KGD A;  2X83 A;  2FQ1 A;  4PH1 A;  2EIA A;  2FHS C;  1ZMB A;  1L0H A;  2LL8 A;  5HGK A;  1EM9 A;  2WLV A;  4XRQ A;  2CNR A;  4J93 A;  3CCU P;  4PH3 A;  4XRO A;  3CXC O;  1A43 A;  3CCS P;  3OW2 O;  2KW2 A;  1YI2 P;  4XFX A;  1M9C C;  4PH0 A;  3B4Q A;  2N5I A;  2EHT A;  1M9E C;  2JO0 A;  2VSQ A;  1KLP A;  2FVF A;  2FQ2 A;  2LTE A;  1VKU A;  4U0B A;  5CZD B;  2LIW A;  2KWL A;  2KGF A;  2N50 A;  2VLN A;  2K0X A;  2X2B A;  5KP6 B;  2QA4 P;  3H0D A;  2XGV A;  3G28 A;  3E2D A;  2MR7 A;  1DV5 A;  2LF4 A;  3M1M A;  3G0V A;  2MR8 A;  2GZG A;  4LQW C;  2XZ1 C;  2LML A;  1M74 A;  1VHN A;  2M8L A;  2GZE A;  2LKI A;  3MGE A;  2CQ8 A;  2KG9 A;  1VQ8 P;  3CCM P;  3CD6 P;  2M5R A;  2JGP A;  2KOR A;  5JPA A;  3G29 A;  3BP9 A;  2QNW A;  5HGM A;  2PEM A;  2AFD A;  1M6N A;  3CC2 P;  4XFZ A;  1EIA A;  3Q20 A;  2EFJ A;  1YJN P;  3B5I A;  2KOP A;  2L4B A;  4E92 A;  4PWV B;  1KC8 Q;  2KG8 A;  2LOL A;  3DS3 A;  4R0M A;  2KOS A;  2X82 A;  2Z44 A;  3CC4 P;  2PXR C;  1DNY A;  4BPF A;  4BPG A;  1G03 A;  1M9F C;  2Y4Z A;  2KGC A;  2KOQ A;  3U43 A;  1OR5 A;  2JU2 A;  2N98 A;  3LRY A;  2ONT A; 
#chains in the Genus database with same CATH homology
 1AFV A;  3CCU P;  1VQP P;  4INB A;  2JYG A;  4PH3 A;  4XRO A;  1AUM A;  3CXC O;  3CCL P;  1A43 A;  3CCS P;  1QVG O;  3OW2 O;  1QRJ A;  5DCK A;  1M9Y C;  1VQ5 P;  1VQN P;  1VQK P;  2PEI A;  1YI2 P;  4XFX A;  4GR2 A;  2PEQ A;  1M9X C;  1M9C C;  2XGY A;  4PH0 A;  1EOQ A;  2P9X A;  5HGN A;  2PEO A;  1U7K A;  1QVF O;  1YJW P;  5F2K A;  4U0A A;  1W2B O;  1M9E C;  2JO0 A;  1E6J P;  3CCR P;  1D1D A;  2Z45 A;  3HYB A;  3G26 A;  4B4N A;  1NJI Q;  3CMA P;  2EG5 A;  3I56 P;  3VRL C;  2GOL B;  4U0B A;  3I55 P;  2WLV B;  2OAR A;  2KGF A;  2X2D D;  2PWO A;  1RNI A;  2XXM A;  1S72 P;  4COP A;  5BS1 A;  4DGA C;  3G6E P;  2QA4 P;  1K8A Q;  3H0D A;  2XGV A;  2KOD A;  3E2D A;  3G28 A;  2XDE A;  1VQ9 P;  3DS5 A;  3CC7 P;  3CPW O;  1YHQ P;  1VQ4 P;  4U0D A;  1VQ7 P;  2LF4 A;  5HGO A;  1M90 Q;  3M1M A;  1A8O A;  2JYL A;  2XGU A;  2OTL P;  2M8P A;  4U0F A;  4NX4 C;  3DS4 A;  1M9D C;  3P05 A;  3G0V A;  1KQS O;  1RO2 A;  3NTE A;  1JJ2 O;  2OTJ P;  1L6N A;  1K30 A;  1VQM P;  1Q86 Q;  4LQW C;  1GWP A;  2DGY A;  2PEK A;  1YIJ P;  2BUO A;  5HGL A;  1K9M Q;  4PH2 A;  1M74 A;  3G21 A;  3G71 P;  2E1M A;  4COC A;  2JPR A;  3G4S P;  2M8L A;  5F2O A;  3RG6 C;  3DS0 A;  2Z46 A;  1K73 Q;  2PEN A;  3MGE A;  2GON A;  1RO0 A;  5BS2 A;  1VQ8 P;  3CCV P;  3CC2 P;  3CCM P;  3DS2 A;  3CD6 P;  4HTW A;  4QNB A;  5JPA A;  3G29 A;  3BP9 A;  1P7N A;  3H47 A;  4U0E A;  1Q7Y Q;  2PY8 A;  5I4T G;  1VQO P;  2XV6 A;  3WBH A;  5HGM A;  2PEM A;  1KD1 Q;  3DTJ A;  3DS1 A;  2V4X A;  4WYM A;  5F2N A;  1VQ6 P;  4XFY A;  1IUQ A;  2BHV A;  4GR6 A;  3G1I A;  1M6N A;  2CWO A;  1Q82 Q;  1YJ9 P;  1N8R Q;  1VQL P;  4XFZ A;  1EIA A;  1Q81 Q;  3Q20 A;  3DPH A;  3G1G A;  2EFJ A;  4M0I A;  3B5I A;  1YJN P;  1BAJ A;  3CCJ P;  2X83 A;  4U0C A;  4E92 A;  1KC8 Q;  2XT1 A;  4E91 A;  4PH1 A;  2PEJ A;  3HZQ A;  2EIA A;  3DS3 A;  1AK4 C;  3CCE P;  3H4E A;  2QEX P;  2X82 A;  2Z44 A;  1ZMB A;  3CC4 P;  2PXR C;  3CME P;  3CCQ P;  1M6E X;  5HGK A;  1G03 A;  1M9F C;  2Y4Z A;  4IPY A;  2M8N A;  1YIT P;  1M1K Q;  1EM9 A;  2WLV A;  4DGE C;  4XRQ A;  2PWM A;  4J93 A;  2L6E A;  3LRY A;  2ONT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...