5JPAA

Hexameric hiv-1 ca h12y mutant
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
208
Chain Sequence
PIVQNLQGQMVYQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid Protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 74
structure length 208
sequence length 219
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5jpaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5jpaA02
2XGVA 5HGOA 3DS4A 1M9FC 2XDEA 4E92A 2KODA 1E6JP 4XFXA 2PWMA 1M9CC 2WLVA 4XRQA 2V4XA 3BP9A 2JO0A 4DGAC 2L6EA 4PH0A 2M8PA 5HGNA 3DS1A 4XFZA 1M9XC 5HGMA 3DS3A 4U0FA 1QRJA 2Y4ZA 4DGEC 3DS5A 4PH1A 1AFVA 2WLVB 4XROA 1G03A 4LQWC 4U0DA 4U0CA 2JYGA 2X83A 4IPYA 4NX4C 3G28A 4PH2A 1A43A 4E91A 4U0AA 3VRLC 3H47A 3G21A 3G1IA 2JPRA 3NTEA 5I4TG 1EOQA 4COCA 3G26A 1M9DC 3MGEA 3DPHA 1D1DA 2XGUA 2M8LA 2XT1A 1BAJA 2XGYA 4INBA 1AUMA 1GWPA 1L6NA 4HTWA 4PH3A 4U0EA 3LRYA 2XV6A 3G1GA 4COPA 4QNBA 1AK4C 2X2DD 1P7NA 2GOLB 3G0VA 4XFYA 2PXRC 5DCKA 4WYMA 4B4NA 2JYLA 2X82A 5JPAA 1M9EC 2KGFA 2LF4A 4J93A 2ONTA 4M0IA 1U7KA 1EIAA 4U0BA 2XXMA 3P05A 2BUOA 5HGKA 3DTJA 3G29A 5HGLA 1M9YC 2EIAA 2PWOA 3DS0A 1A8OA 2M8NA 2GONA 1EM9A 3DS2A 3H4EA
chains in the Genus database with same CATH superfamily
3GZMA 3DS4A 3NY7B 2XDEA 2KODA 2FADA 3U43A 2KR5A 1RO2A 1M74A 2KGCA 2L4BA 2KGDA 3CPWO 3GKLC 2V4XA 3BP9A 2JO0A 2K0YA 2NO8A 2M8PA 1OR5A 2KG9A 3DS1A 3Q20A 2KOSA 2FVEA 1QRJA 2GZFA 3GJNA 2OARA 1DNYA 3B4QA 5HVCA 2CQ8A 2PEKA 3CCUP 1MZ8A 4LQWC 4U0DA 2X83A 1VQ4P 4PH2A 2JPRA 3NTEA 1EOQA 5BS2A 1IMQA 3CXCO 4H2YC 2K92A 4COCA 4QKOA 1Z6MA 1M9DC 3CCQP 4GR6A 4IZ6A 1D1DA 2XGUA 4BPHA 4PXHB 1BAJA 2GZGA 2FVAA 2KG6A 4GR2A 3CCSP 2KOPA 2EG5A 1L6NA 2FACA 1VQPP 2XV6A 1NQ4A 1Q7YQ 4COPA 2JBGA 1P7NA 2LMLA 2K0DX 2MR7A 3LMOA 2KG8A 1NJIQ 5BS1A 2BHVA 1EIAA 3HZQA 2XXMA 4PWVB 2QNWA 1K30A 2XZ1C 2KOQA 1L0IA 1HY8A 3HYBA 3G29A 1IUQA 2EIAA 2PEOA 2K2QA 2OTJP 3CMAP 2M8NA 1YI2P 3CC7P 3CE7A 1EM9A 2CG5B 5KP6B 5HGOA 2MD9A 3WBHA 5HV8A 1E6JP 4XFXA 1M9CC 2WLVA 2MVUA 2XZ0D 1VQ7P 4DGAC 1M9XC 2DGYA 5HGMA 1M6EX 1DV5A 5EJDA 3G71P 3CCLP 2KWLA 4PH1A 2OTLP 2WLVB 4XROA 1G03A 2KGEA 2VLPA 4IPYA 5F2OA 4NX4C 3G28A 3CD6P 4E91A 4U0AA 3VRLC 3H47A 3I56P 2M8LA 4H2XC 4H2WC 2PEQA 3CC2P 3G6EP 1AUMA 2L22A 4NEOA 2EHTA 4QNBA 3CCJP 1AK4C 2M5RA 2K5XA 3G0VA 1K8AQ 5F2KA 4CA3A 1Q86Q 1JJ2O 1M9EC 2PENA 2Z45A 2MY5A 1GXGA 2N6YA 3GZLA 1U7KA 2JQ4A 2BUOA 2AFEA 2EFJA 5HGLA 2K93A 3E2DA 3EJBA 2DNWA 2MR8A 3DS0A 1VQ9P 2GONA 2LL8A 3OW2O 1ZMBA 2XGVA 2VSQA 1M9FC 2WPTA 2ROQA 3H0DA 1VQ6P 2FQ2A 4MRTC 1QVFO 1N8RQ 3RG6C 4BPFA 2LIWA 2KORA 1RO0A 2LIUA 4PH0A 1K9MQ 3EJEA 2PNGA 3DS3A 4U0FA 1RNIA 1KQSO 4DGEC 1VQNP 1T8KA 1AFVA 1IMPA 3CCVP 2JYGA 4U0CA 2FHSC 1UNKA 2GZEA 2GDYA 3CCMP 3G21A 2GZJA 1W2BO 3EJDA 5I4TG 1VHNA 5KP7B 2QA4P 1VQLP 3MGEA 3DPHA 5CZDB 2XT1A 2JU2A 2XGYA 4INBA 1GWPA 2N5IA 4HTWA 2GYKA 2JAZA 4PH3A 3LRYA 2JGPA 1Q82Q 2X2DD 3B5IA 2GOLB 1AYIA 1YIJP 2PXRC 1M1KQ 5KP8B 2JYLA 5JPAA 2JU1A 2LF4A 2KGFA 2GDXA 1F80D 2FQ1A 5F2NA 4J93A 1VQMP 1BXIA 4U0BA 2AF8A 1KLPA 2L0QA 5HGKA 2LOLA 1S72P 1EMVA 1VQ8P 1M9YC 3CMEP 2KW2A 1QVGO 2N6ZA 2PWOA 1A8OA 2EHSA 4F37A 2FQ0A 2KGAA 2AVAA 3G4SP 1M6NA 2PEIA 2CGQA 5EW5E 2GZIA 4E92A 2AFDA 2PWMA 1YHQP 2CWOA 4XRQA 1KD1Q 1UJZA 2K0XA 2L6EA 1HQBA 2N5HA 2E1MA 5HGNA 4XFZA 1YITP 1AF8A 4R0MA 1GPJA 2Z44A 1VQKP 2Y4ZA 2PEMA 2KOOA 3DS5A 3CCRP 3M1MA 2LTEA 1CEIA 1FR2A 1A43A 2N50A 3G1IA 4DG9A 2PEJA 4BPGA 2FAEA 1K73Q 3G26A 1GXHA 2ERHA 1E0HA 2PY8A 1YJNP 2FVFA 1VKUA 1X3OA 1VQ5P 3RG2A 1Q81Q 3CCEP 7CEIA 4U0EA 1KC8Q 3G1GA 2LPKA 4UHPB 4XFYA 2VLQA 1L0HA 2MF4A 5DCKA 4WYMA 2CNRA 4B4NA 2X82A 2MVVA 2GDWA 2QEXP 3CC4P 2JB0A 2K94A 2ONTA 4M0IA 2N98A 2LKIA 3P05A 2VLOA 1YJWP 3I55P 2Z46A 2X2BA 3DTJA 1ACPA 1ZNVA 1VQOP 2VLNA 3DS2A 4HKGA 2P9XA 1YJ9P 1M90Q 3H4EA 2L9FA
chains in the Genus database with same CATH topology
1M6NA 2XGVA 5HGOA 3DS4A 2PEIA 1M9FC 3H0DA 3WBHA 2XDEA 4E92A 2KODA 1VQ6P 1E6JP 4XFXA 2PWMA 1YHQP 1M9CC 1RO2A 2WLVA 1M74A 2CWOA 4XRQA 3CPWO 1QVFO 1N8RQ 2V4XA 3RG6C 3BP9A 2JO0A 1KD1Q 1VQ7P 1RO0A 4DGAC 2L6EA 4PH0A 2M8PA 2E1MA 1K9MQ 5HGNA 3DS1A 4XFZA 3Q20A 1M9XC 1YITP 2DGYA 5HGMA 3DS3A 4U0FA 1QRJA 1M6EX 1RNIA 2Z44A 1KQSO 1VQKP 2OARA 2Y4ZA 2PEMA 3G71P 4DGEC 1VQNP 3CCLP 3DS5A 2PEKA 4PH1A 3CCUP 1AFVA 2OTLP 2WLVB 4XROA 1G03A 3CCVP 4LQWC 3CCRP 4U0DA 4U0CA 2JYGA 3M1MA 2X83A 4IPYA 5F2OA 4NX4C 3G28A 1VQ4P 3CD6P 4PH2A 1A43A 4E91A 4U0AA 3VRLC 3H47A 3CCMP 3G21A 3I56P 3G1IA 1W2BO 2JPRA 3NTEA 5I4TG 1EOQA 5BS2A 2PEJA 3CXCO 2QA4P 1K73Q 4COCA 1VQLP 3G26A 1M9DC 3CCQP 3MGEA 4GR6A 3DPHA 1D1DA 2XGUA 2M8LA 2XT1A 2PEQA 1BAJA 2PY8A 1YJNP 3CC2P 3G6EP 2XGYA 4INBA 1AUMA 4GR2A 1GWPA 3CCSP 1VQ5P 2EG5A 1L6NA 1VQPP 1Q81Q 3CCEP 4HTWA 4PH3A 4U0EA 3LRYA 1KC8Q 2XV6A 3G1GA 1Q7YQ 4COPA 4QNBA 3CCJP 1AK4C 1Q82Q 2X2DD 3B5IA 1P7NA 2GOLB 3G0VA 1K8AQ 4XFYA 1YIJP 2PXRC 1M1KQ 5DCKA 4WYMA 5F2KA 1Q86Q 4B4NA 2JYLA 2X82A 5JPAA 1JJ2O 1M9EC 2KGFA 2LF4A 2PENA 2Z45A 2QEXP 1NJIQ 5BS1A 5F2NA 4J93A 3CC4P 1VQMP 2ONTA 4M0IA 2BHVA 1U7KA 1EIAA 3HZQA 4U0BA 2XXMA 3P05A 1YJWP 2BUOA 3I55P 1K30A 5HGKA 2Z46A 1S72P 3HYBA 3DTJA 3G29A 2EFJA 1VQOP 5HGLA 1IUQA 1M9YC 1VQ8P 2EIAA 3CMEP 3E2DA 2PEOA 1QVGO 2PWOA 3DS0A 2OTJP 1A8OA 3CMAP 2M8NA 1YI2P 1VQ9P 3CC7P 2GONA 1EM9A 3DS2A 3OW2O 2P9XA 1YJ9P 1M90Q 1ZMBA 3H4EA 3G4SP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGV A;  5HGO A;  3DS4 A;  1M9F C;  2XDE A;  4E92 A;  2KOD A;  1E6J P;  4XFX A;  2PWM A;  1M9C C;  2WLV A;  4XRQ A;  2V4X A;  3BP9 A;  2JO0 A;  4DGA C;  2L6E A;  4PH0 A;  2M8P A;  5HGN A;  3DS1 A;  4XFZ A;  1M9X C;  5HGM A;  3DS3 A;  4U0F A;  1QRJ A;  2Y4Z A;  4DGE C;  3DS5 A;  4PH1 A;  1AFV A;  2WLV B;  4XRO A;  1G03 A;  4LQW C;  4U0D A;  4U0C A;  2JYG A;  2X83 A;  4IPY A;  4NX4 C;  3G28 A;  4PH2 A;  1A43 A;  4E91 A;  4U0A A;  3VRL C;  3H47 A;  3G21 A;  3G1I A;  2JPR A;  3NTE A;  5I4T G;  1EOQ A;  4COC A;  3G26 A;  1M9D C;  3MGE A;  3DPH A;  1D1D A;  2XGU A;  2M8L A;  2XT1 A;  1BAJ A;  2XGY A;  4INB A;  1AUM A;  1GWP A;  1L6N A;  4HTW A;  4PH3 A;  4U0E A;  3LRY A;  2XV6 A;  3G1G A;  4COP A;  4QNB A;  1AK4 C;  2X2D D;  1P7N A;  2GOL B;  3G0V A;  4XFY A;  2PXR C;  5DCK A;  4WYM A;  4B4N A;  2JYL A;  2X82 A;  5JPA A;  1M9E C;  2KGF A;  2LF4 A;  4J93 A;  2ONT A;  4M0I A;  1U7K A;  1EIA A;  4U0B A;  2XXM A;  3P05 A;  2BUO A;  5HGK A;  3DTJ A;  3G29 A;  5HGL A;  1M9Y C;  2EIA A;  2PWO A;  3DS0 A;  1A8O A;  2M8N A;  2GON A;  1EM9 A;  3DS2 A;  3H4E A; 
#chains in the Genus database with same CATH topology
 3GZM A;  3DS4 A;  3NY7 B;  2XDE A;  2KOD A;  2FAD A;  3U43 A;  2KR5 A;  1RO2 A;  1M74 A;  2KGC A;  2L4B A;  2KGD A;  3CPW O;  3GKL C;  2V4X A;  3BP9 A;  2JO0 A;  2K0Y A;  2NO8 A;  2M8P A;  1OR5 A;  2KG9 A;  3DS1 A;  3Q20 A;  2KOS A;  2FVE A;  1QRJ A;  2GZF A;  3GJN A;  2OAR A;  1DNY A;  3B4Q A;  5HVC A;  2CQ8 A;  2PEK A;  3CCU P;  1MZ8 A;  4LQW C;  4U0D A;  2X83 A;  1VQ4 P;  4PH2 A;  2JPR A;  3NTE A;  1EOQ A;  5BS2 A;  1IMQ A;  3CXC O;  4H2Y C;  2K92 A;  4COC A;  4QKO A;  1Z6M A;  1M9D C;  3CCQ P;  4GR6 A;  4IZ6 A;  1D1D A;  2XGU A;  4BPH A;  4PXH B;  1BAJ A;  2GZG A;  2FVA A;  2KG6 A;  4GR2 A;  3CCS P;  2KOP A;  2EG5 A;  1L6N A;  2FAC A;  1VQP P;  2XV6 A;  1NQ4 A;  1Q7Y Q;  4COP A;  2JBG A;  1P7N A;  2LML A;  2K0D X;  2MR7 A;  3LMO A;  2KG8 A;  1NJI Q;  5BS1 A;  2BHV A;  1EIA A;  3HZQ A;  2XXM A;  4PWV B;  2QNW A;  1K30 A;  2XZ1 C;  2KOQ A;  1L0I A;  1HY8 A;  3HYB A;  3G29 A;  1IUQ A;  2EIA A;  2PEO A;  2K2Q A;  2OTJ P;  3CMA P;  2M8N A;  1YI2 P;  3CC7 P;  3CE7 A;  1EM9 A;  2CG5 B;  5KP6 B;  5HGO A;  2MD9 A;  3WBH A;  5HV8 A;  1E6J P;  4XFX A;  1M9C C;  2WLV A;  2MVU A;  2XZ0 D;  1VQ7 P;  4DGA C;  1M9X C;  2DGY A;  5HGM A;  1M6E X;  1DV5 A;  5EJD A;  3G71 P;  3CCL P;  2KWL A;  4PH1 A;  2OTL P;  2WLV B;  4XRO A;  1G03 A;  2KGE A;  2VLP A;  4IPY A;  5F2O A;  4NX4 C;  3G28 A;  3CD6 P;  4E91 A;  4U0A A;  3VRL C;  3H47 A;  3I56 P;  2M8L A;  4H2X C;  4H2W C;  2PEQ A;  3CC2 P;  3G6E P;  1AUM A;  2L22 A;  4NEO A;  2EHT A;  4QNB A;  3CCJ P;  1AK4 C;  2M5R A;  2K5X A;  3G0V A;  1K8A Q;  5F2K A;  4CA3 A;  1Q86 Q;  1JJ2 O;  1M9E C;  2PEN A;  2Z45 A;  2MY5 A;  1GXG A;  2N6Y A;  3GZL A;  1U7K A;  2JQ4 A;  2BUO A;  2AFE A;  2EFJ A;  5HGL A;  2K93 A;  3E2D A;  3EJB A;  2DNW A;  2MR8 A;  3DS0 A;  1VQ9 P;  2GON A;  2LL8 A;  3OW2 O;  1ZMB A;  2XGV A;  2VSQ A;  1M9F C;  2WPT A;  2ROQ A;  3H0D A;  1VQ6 P;  2FQ2 A;  4MRT C;  1QVF O;  1N8R Q;  3RG6 C;  4BPF A;  2LIW A;  2KOR A;  1RO0 A;  2LIU A;  4PH0 A;  1K9M Q;  3EJE A;  2PNG A;  3DS3 A;  4U0F A;  1RNI A;  1KQS O;  4DGE C;  1VQN P;  1T8K A;  1AFV A;  1IMP A;  3CCV P;  2JYG A;  4U0C A;  2FHS C;  1UNK A;  2GZE A;  2GDY A;  3CCM P;  3G21 A;  2GZJ A;  1W2B O;  3EJD A;  5I4T G;  1VHN A;  5KP7 B;  2QA4 P;  1VQL P;  3MGE A;  3DPH A;  5CZD B;  2XT1 A;  2JU2 A;  2XGY A;  4INB A;  1GWP A;  2N5I A;  4HTW A;  2GYK A;  2JAZ A;  4PH3 A;  3LRY A;  2JGP A;  1Q82 Q;  2X2D D;  3B5I A;  2GOL B;  1AYI A;  1YIJ P;  2PXR C;  1M1K Q;  5KP8 B;  2JYL A;  5JPA A;  2JU1 A;  2LF4 A;  2KGF A;  2GDX A;  1F80 D;  2FQ1 A;  5F2N A;  4J93 A;  1VQM P;  1BXI A;  4U0B A;  2AF8 A;  1KLP A;  2L0Q A;  5HGK A;  2LOL A;  1S72 P;  1EMV A;  1VQ8 P;  1M9Y C;  3CME P;  2KW2 A;  1QVG O;  2N6Z A;  2PWO A;  1A8O A;  2EHS A;  4F37 A;  2FQ0 A;  2KGA A;  2AVA A;  3G4S P;  1M6N A;  2PEI A;  2CGQ A;  5EW5 E;  2GZI A;  4E92 A;  2AFD A;  2PWM A;  1YHQ P;  2CWO A;  4XRQ A;  1KD1 Q;  1UJZ A;  2K0X A;  2L6E A;  1HQB A;  2N5H A;  2E1M A;  5HGN A;  4XFZ A;  1YIT P;  1AF8 A;  4R0M A;  1GPJ A;  2Z44 A;  1VQK P;  2Y4Z A;  2PEM A;  2KOO A;  3DS5 A;  3CCR P;  3M1M A;  2LTE A;  1CEI A;  1FR2 A;  1A43 A;  2N50 A;  3G1I A;  4DG9 A;  2PEJ A;  4BPG A;  2FAE A;  1K73 Q;  3G26 A;  1GXH A;  2ERH A;  1E0H A;  2PY8 A;  1YJN P;  2FVF A;  1VKU A;  1X3O A;  1VQ5 P;  3RG2 A;  1Q81 Q;  3CCE P;  7CEI A;  4U0E A;  1KC8 Q;  3G1G A;  2LPK A;  4UHP B;  4XFY A;  2VLQ A;  1L0H A;  2MF4 A;  5DCK A;  4WYM A;  2CNR A;  4B4N A;  2X82 A;  2MVV A;  2GDW A;  2QEX P;  3CC4 P;  2JB0 A;  2K94 A;  2ONT A;  4M0I A;  2N98 A;  2LKI A;  3P05 A;  2VLO A;  1YJW P;  3I55 P;  2Z46 A;  2X2B A;  3DTJ A;  1ACP A;  1ZNV A;  1VQO P;  2VLN A;  3DS2 A;  4HKG A;  2P9X A;  1YJ9 P;  1M90 Q;  3H4E A;  2L9F A; 
#chains in the Genus database with same CATH homology
 1M6N A;  2XGV A;  5HGO A;  3DS4 A;  2PEI A;  1M9F C;  3H0D A;  3WBH A;  2XDE A;  4E92 A;  2KOD A;  1VQ6 P;  1E6J P;  4XFX A;  2PWM A;  1YHQ P;  1M9C C;  1RO2 A;  2WLV A;  1M74 A;  2CWO A;  4XRQ A;  3CPW O;  1QVF O;  1N8R Q;  2V4X A;  3RG6 C;  3BP9 A;  2JO0 A;  1KD1 Q;  1VQ7 P;  1RO0 A;  4DGA C;  2L6E A;  4PH0 A;  2M8P A;  2E1M A;  1K9M Q;  5HGN A;  3DS1 A;  4XFZ A;  3Q20 A;  1M9X C;  1YIT P;  2DGY A;  5HGM A;  3DS3 A;  4U0F A;  1QRJ A;  1M6E X;  1RNI A;  2Z44 A;  1KQS O;  1VQK P;  2OAR A;  2Y4Z A;  2PEM A;  3G71 P;  4DGE C;  1VQN P;  3CCL P;  3DS5 A;  2PEK A;  4PH1 A;  3CCU P;  1AFV A;  2OTL P;  2WLV B;  4XRO A;  1G03 A;  3CCV P;  4LQW C;  3CCR P;  4U0D A;  4U0C A;  2JYG A;  3M1M A;  2X83 A;  4IPY A;  5F2O A;  4NX4 C;  3G28 A;  1VQ4 P;  3CD6 P;  4PH2 A;  1A43 A;  4E91 A;  4U0A A;  3VRL C;  3H47 A;  3CCM P;  3G21 A;  3I56 P;  3G1I A;  1W2B O;  2JPR A;  3NTE A;  5I4T G;  1EOQ A;  5BS2 A;  2PEJ A;  3CXC O;  2QA4 P;  1K73 Q;  4COC A;  1VQL P;  3G26 A;  1M9D C;  3CCQ P;  3MGE A;  4GR6 A;  3DPH A;  1D1D A;  2XGU A;  2M8L A;  2XT1 A;  2PEQ A;  1BAJ A;  2PY8 A;  1YJN P;  3CC2 P;  3G6E P;  2XGY A;  4INB A;  1AUM A;  4GR2 A;  1GWP A;  3CCS P;  1VQ5 P;  2EG5 A;  1L6N A;  1VQP P;  1Q81 Q;  3CCE P;  4HTW A;  4PH3 A;  4U0E A;  3LRY A;  1KC8 Q;  2XV6 A;  3G1G A;  1Q7Y Q;  4COP A;  4QNB A;  3CCJ P;  1AK4 C;  1Q82 Q;  2X2D D;  3B5I A;  1P7N A;  2GOL B;  3G0V A;  1K8A Q;  4XFY A;  1YIJ P;  2PXR C;  1M1K Q;  5DCK A;  4WYM A;  5F2K A;  1Q86 Q;  4B4N A;  2JYL A;  2X82 A;  5JPA A;  1JJ2 O;  1M9E C;  2KGF A;  2LF4 A;  2PEN A;  2Z45 A;  2QEX P;  1NJI Q;  5BS1 A;  5F2N A;  4J93 A;  3CC4 P;  1VQM P;  2ONT A;  4M0I A;  2BHV A;  1U7K A;  1EIA A;  3HZQ A;  4U0B A;  2XXM A;  3P05 A;  1YJW P;  2BUO A;  3I55 P;  1K30 A;  5HGK A;  2Z46 A;  1S72 P;  3HYB A;  3DTJ A;  3G29 A;  2EFJ A;  1VQO P;  5HGL A;  1IUQ A;  1M9Y C;  1VQ8 P;  2EIA A;  3CME P;  3E2D A;  2PEO A;  1QVG O;  2PWO A;  3DS0 A;  2OTJ P;  1A8O A;  3CMA P;  2M8N A;  1YI2 P;  1VQ9 P;  3CC7 P;  2GON A;  1EM9 A;  3DS2 A;  3OW2 O;  2P9X A;  1YJ9 P;  1M90 Q;  1ZMB A;  3H4E A;  3G4S P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...