5JPAA

Hexameric hiv-1 ca h12y mutant
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
208
Chain Sequence
b'PIVQNLQGQMVYQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASTETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid Protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 74
structure length 208
sequence length 219
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5jpaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5jpaA02
5HGLA 2M8NA 2L6EA 3G21A 4DGEC 2X82A 1U7KA 2GONA 1GWPA 4M0IA 4PH1A 4XROA 1M9YC 2XV6A 4XFXA 1D1DA 1M9EC 3DS2A 3P05A 3G28A 3VRLC 4COPA 4E92A 2XXMA 5HGNA 5HGMA 2XGVA 2XGYA 3DTJA 4PH0A 1EM9A 2PXRC 2KODA 3DS0A 4U0DA 4IPYA 3G1IA 2WLVA 1EIAA 4PH3A 4U0FA 2XT1A 3H47A 4U0CA 4HTWA 2LF4A 3MGEA 4U0BA 1QRJA 4COCA 1AUMA 2JYGA 3DS5A 2JPRA 3G29A 2M8PA 5HGKA 4J93A 4INBA 4PH2A 2PWOA 3BP9A 3DS4A 1AK4C 4QNBA 4E91A 1AFVA 4XRQA 2XGUA 5HGOA 4WYMA 3G26A 2XDEA 2X83A 2X2DD 1BAJA 2JO0A 3DS3A 4U0EA 3G1GA 3NTEA 2KGFA 1M9DC 2JYLA 4XFZA 1EOQA 4XFYA 4DGAC 4NX4C 4B4NA 5DCKA 1A8OA 1M9CC 3LRYA 1M9XC 2V4XA 2GOLB 3DS1A 1E6JP 1M9FC 1L6NA 2ONTA 3H4EA 4LQWC 2WLVB 5JPAA 3DPHA 2M8LA 3G0VA 1P7NA 2BUOA 4U0AA 5I4TG 1G03A 2Y4ZA 1A43A 2EIAA 2PWMA
chains in the Genus database with same CATH superfamily
2CQ8A 1QVFO 2VSQA 3G21A 2JBGA 2X82A 3I55P 2GONA 1GWPA 2JQ4A 1X3OA 4XROA 1M9YC 2DGYA 2P9XA 3P05A 2EHTA 4COPA 1JJ2O 1Q81Q 2LKIA 4F37A 1N8RQ 2PXRC 2CWOA 3DS0A 5F2OA 1VQPP 4IPYA 2L4BA 1W2BO 2K5XA 1EIAA 4HTWA 1KLPA 4COCA 1YJWP 4UHPB 1UJZA 7CEIA 2JYGA 1M6EX 2K92A 1Q7YQ 2L0QA 1HY8A 4H2XC 1M90Q 1YJ9P 2KGEA 1AK4C 1VQ6P 3G71P 2N6ZA 2N50A 3CD6P 2AVAA 3G1GA 1VQLP 4CA3A 1YI2P 2KGCA 3G6EP 2PEIA 5F2KA 2MY5A 2X2BA 5DCKA 1VQ8P 5KP7B 2GOLB 2FQ1A 2L9FA 3DS1A 3B4QA 1VKUA 2EHSA 1GXHA 3DPHA 2MVUA 2MD9A 4U0AA 2JAZA 2NO8A 3RG2A 2EIAA 1QVGO 2QA4P 4DG9A 2L6EA 4MRTC 3WBHA 2LTEA 1U7KA 2JB0A 2KORA 5CZDB 2JU1A 2GZEA 2XV6A 3DS2A 2BHVA 3CE7A 4GR6A 2LPKA 3NY7B 3CPWO 2XGYA 3DTJA 4PWVB 4PH0A 1VQKP 3GZMA 2KODA 1HQBA 1FR2A 2LIWA 1VQMP 3CCQP 4U0FA 2DNWA 3HZQA 2GYKA 2M5RA 4U0CA 2VLOA 2GZFA 3CCVP 3MGEA 1YHQP 3I56P 5HV8A 1VQ7P 3Q20A 1QRJA 4QKOA 3U43A 3DS5A 4H2WC 2KOPA 1VQNP 2FAEA 5EW5E 4NEOA 2FHSC 3OW2O 1VQ9P 1F80D 2K0YA 3BP9A 2L22A 3G4SP 3DS4A 4QNBA 5F2NA 4GR2A 2XGUA 5HGOA 2KGDA 1NQ4A 2CGQA 2KW2A 3EJBA 1BAJA 3NTEA 2KGFA 2N5IA 2OTLP 2JYLA 2KOQA 2WPTA 5KP6B 3CC2P 2PENA 3B5IA 3CCJP 3EJEA 2XZ1C 2FADA 1K73Q 2V4XA 2KG6A 1EMVA 3CC4P 1BXIA 1IMQA 1M9FC 3CCSP 2WLVB 5JPAA 2M8LA 2LMLA 1P7NA 1VQ5P 2KOSA 2EFJA 5KP8B 3E2DA 3CMEP 2MR7A 2EG5A 2N98A 2KR5A 2PEOA 1VQOP 4DGEC 1L0HA 2Z44A 4BPHA 3CCMP 4XFXA 1M9EC 3G28A 3VRLC 2N5HA 2XXMA 5HGNA 3EJDA 1VQ4P 2MR8A 2XGVA 2OARA 5BS2A 1AF8A 1M6NA 2K0XA 2PEKA 4PXHB 1RO0A 4U0DA 2KOOA 1RO2A 3G1IA 3H0DA 2VLPA 2VLQA 4PH3A 3CMAP 2FACA 4U0BA 1YIJP 2KGAA 2K94A 1DV5A 1RNIA 5HGKA 4J93A 2JU2A 2PWOA 2PEMA 1M74A 3GJNA 1UNKA 2MVVA 1KQSO 4E91A 1AFVA 4XRQA 1IMPA 2Z46A 3G26A 1VHNA 1M1KQ 1Q86Q 2AFDA 2JO0A 1ZNVA 3DS3A 3RG6C 2K0DX 4XFZA 4DGAC 4NX4C 4B4NA 2Z45A 1A8OA 1AYIA 1M9CC 2FQ0A 2LIUA 3LRYA 1M9XC 1E0HA 1KC8Q 2ONTA 3H4EA 1GPJA 3CCEP 1DNYA 2GDXA 1G03A 2Y4ZA 1KD1Q 1A43A 2K2QA 2PWMA 4HKGA 5HGLA 2GZIA 2KG9A 2M8NA 5EJDA 2K93A 3GKLC 4M0IA 1K8AQ 4PH1A 2AF8A 2XZ0D 1K9MQ 1D1DA 3LMOA 4E92A 5HGMA 2QEXP 2PNGA 1L0IA 2CNRA 1YJNP 1EM9A 2PEJA 2QNWA 1Z6MA 2GZGA 2LL8A 1GXGA 2WLVA 4BPGA 2OTJP 1S72P 2N6YA 3H47A 2XT1A 2LF4A 2ROQA 2MF4A 3M1MA 1AUMA 3CCRP 2JPRA 4IZ6A 3G29A 1ZMBA 2M8PA 4INBA 2CG5B 1OR5A 3CCLP 4PH2A 2FVFA 2GDYA 3CC7P 1IUQA 4R0MA 3HYBA 4WYMA 2ERHA 2KG8A 2XDEA 2X83A 2X2DD 1NJIQ 2KWLA 4U0EA 2FQ2A 3CXCO 2FVEA 1M9DC 2PY8A 1EOQA 5HVCA 3GZLA 1YITP 1MZ8A 4XFYA 1ACPA 2PEQA 2FVAA 2GDWA 1Q82Q 2GZJA 2JGPA 4H2YC 4BPFA 1T8KA 2E1MA 1E6JP 1L6NA 2AFEA 4LQWC 3G0VA 5BS1A 1CEIA 2BUOA 2LOLA 3CCUP 1K30A 5I4TG 2VLNA
chains in the Genus database with same CATH topology
1QVFO 5HGLA 2EG5A 2PEOA 2M8NA 2L6EA 3G21A 1VQOP 3WBHA 4DGEC 2X82A 1U7KA 2Z44A 3I55P 2GONA 1GWPA 4M0IA 1K8AQ 3CCMP 4PH1A 4XROA 1M9YC 2XV6A 1K9MQ 4XFXA 1D1DA 2DGYA 1M9EC 2P9XA 3P05A 3DS2A 3G28A 3VRLC 4COPA 2BHVA 4E92A 2XXMA 4GR6A 5HGNA 1JJ2O 1Q81Q 1VQ4P 5HGMA 2QEXP 2XGVA 2OARA 3CPWO 2XGYA 5BS2A 1YJNP 3DTJA 1N8RQ 4PH0A 1EM9A 1VQKP 2PXRC 1M6NA 2KODA 2CWOA 3DS0A 5F2OA 1VQPP 2PEKA 1RO0A 2PEJA 4U0DA 4IPYA 1RO2A 1VQMP 3G1IA 1W2BO 3H0DA 2WLVA 1EIAA 4PH3A 2OTJP 4U0FA 3HZQA 1S72P 3CMAP 2XT1A 3H47A 4U0CA 4HTWA 2LF4A 3CCVP 3MGEA 4U0BA 1YHQP 1YIJP 3CMEP 3I56P 1VQ7P 3M1MA 3Q20A 1QRJA 4COCA 1YJWP 1AUMA 3CCRP 2JYGA 3DS5A 2JPRA 1VQNP 3G29A 1ZMBA 1RNIA 2M8PA 1M6EX 3OW2O 5HGKA 4J93A 4INBA 1VQ9P 3CCLP 4PH2A 1Q7YQ 2PWOA 3BP9A 1YJ9P 1M90Q 3CC7P 2PEMA 3G4SP 1M74A 3DS4A 1IUQA 1AK4C 4QNBA 1KQSO 4E91A 1AFVA 1VQ6P 5F2NA 4GR2A 4XRQA 2XGUA 3G71P 2Z46A 5HGOA 3HYBA 4WYMA 3G26A 1M1KQ 3CD6P 1Q86Q 2XDEA 2X83A 2X2DD 1BAJA 2JO0A 1NJIQ 3DS3A 4U0EA 3RG6C 3G1GA 3CXCO 1VQLP 3NTEA 2KGFA 1YI2P 1M9DC 2PY8A 2OTLP 2JYLA 4XFZA 1EOQA 3G6EP 1YITP 2PEIA 3CC2P 4XFYA 4DGAC 5F2KA 2PENA 3B5IA 2PEQA 3CCJP 4NX4C 4B4NA 2Z45A 5DCKA 1A8OA 1Q82Q 1VQ8P 1M9CC 3LRYA 1M9XC 1K73Q 2QA4P 2V4XA 2GOLB 1KC8Q 2E1MA 3DS1A 1E6JP 3CC4P 1M9FC 1L6NA 2ONTA 3CCSP 3H4EA 4LQWC 2WLVB 5JPAA 3DPHA 2M8LA 3G0VA 5BS1A 1P7NA 1VQ5P 2BUOA 3CCEP 4U0AA 3CCUP 1K30A 1G03A 5I4TG 2Y4ZA 1KD1Q 1A43A 2EIAA 1QVGO 2EFJA 2PWMA 3E2DA 3CCQP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGL A;  2M8N A;  2L6E A;  3G21 A;  4DGE C;  2X82 A;  1U7K A;  2GON A;  1GWP A;  4M0I A;  4PH1 A;  4XRO A;  1M9Y C;  2XV6 A;  4XFX A;  1D1D A;  1M9E C;  3DS2 A;  3P05 A;  3G28 A;  3VRL C;  4COP A;  4E92 A;  2XXM A;  5HGN A;  5HGM A;  2XGV A;  2XGY A;  3DTJ A;  4PH0 A;  1EM9 A;  2PXR C;  2KOD A;  3DS0 A;  4U0D A;  4IPY A;  3G1I A;  2WLV A;  1EIA A;  4PH3 A;  4U0F A;  2XT1 A;  3H47 A;  4U0C A;  4HTW A;  2LF4 A;  3MGE A;  4U0B A;  1QRJ A;  4COC A;  1AUM A;  2JYG A;  3DS5 A;  2JPR A;  3G29 A;  2M8P A;  5HGK A;  4J93 A;  4INB A;  4PH2 A;  2PWO A;  3BP9 A;  3DS4 A;  1AK4 C;  4QNB A;  4E91 A;  1AFV A;  4XRQ A;  2XGU A;  5HGO A;  4WYM A;  3G26 A;  2XDE A;  2X83 A;  2X2D D;  1BAJ A;  2JO0 A;  3DS3 A;  4U0E A;  3G1G A;  3NTE A;  2KGF A;  1M9D C;  2JYL A;  4XFZ A;  1EOQ A;  4XFY A;  4DGA C;  4NX4 C;  4B4N A;  5DCK A;  1A8O A;  1M9C C;  3LRY A;  1M9X C;  2V4X A;  2GOL B;  3DS1 A;  1E6J P;  1M9F C;  1L6N A;  2ONT A;  3H4E A;  4LQW C;  2WLV B;  5JPA A;  3DPH A;  2M8L A;  3G0V A;  1P7N A;  2BUO A;  4U0A A;  5I4T G;  1G03 A;  2Y4Z A;  1A43 A;  2EIA A;  2PWM A; 
#chains in the Genus database with same CATH topology
 2CQ8 A;  1QVF O;  2VSQ A;  3G21 A;  2JBG A;  2X82 A;  3I55 P;  2GON A;  1GWP A;  2JQ4 A;  1X3O A;  4XRO A;  1M9Y C;  2DGY A;  2P9X A;  3P05 A;  2EHT A;  4COP A;  1JJ2 O;  1Q81 Q;  2LKI A;  4F37 A;  1N8R Q;  2PXR C;  2CWO A;  3DS0 A;  5F2O A;  1VQP P;  4IPY A;  2L4B A;  1W2B O;  2K5X A;  1EIA A;  4HTW A;  1KLP A;  4COC A;  1YJW P;  4UHP B;  1UJZ A;  7CEI A;  2JYG A;  1M6E X;  2K92 A;  1Q7Y Q;  2L0Q A;  1HY8 A;  4H2X C;  1M90 Q;  1YJ9 P;  2KGE A;  1AK4 C;  1VQ6 P;  3G71 P;  2N6Z A;  2N50 A;  3CD6 P;  2AVA A;  3G1G A;  1VQL P;  4CA3 A;  1YI2 P;  2KGC A;  3G6E P;  2PEI A;  5F2K A;  2MY5 A;  2X2B A;  5DCK A;  1VQ8 P;  5KP7 B;  2GOL B;  2FQ1 A;  2L9F A;  3DS1 A;  3B4Q A;  1VKU A;  2EHS A;  1GXH A;  3DPH A;  2MVU A;  2MD9 A;  4U0A A;  2JAZ A;  2NO8 A;  3RG2 A;  2EIA A;  1QVG O;  2QA4 P;  4DG9 A;  2L6E A;  4MRT C;  3WBH A;  2LTE A;  1U7K A;  2JB0 A;  2KOR A;  5CZD B;  2JU1 A;  2GZE A;  2XV6 A;  3DS2 A;  2BHV A;  3CE7 A;  4GR6 A;  2LPK A;  3NY7 B;  3CPW O;  2XGY A;  3DTJ A;  4PWV B;  4PH0 A;  1VQK P;  3GZM A;  2KOD A;  1HQB A;  1FR2 A;  2LIW A;  1VQM P;  3CCQ P;  4U0F A;  2DNW A;  3HZQ A;  2GYK A;  2M5R A;  4U0C A;  2VLO A;  2GZF A;  3CCV P;  3MGE A;  1YHQ P;  3I56 P;  5HV8 A;  1VQ7 P;  3Q20 A;  1QRJ A;  4QKO A;  3U43 A;  3DS5 A;  4H2W C;  2KOP A;  1VQN P;  2FAE A;  5EW5 E;  4NEO A;  2FHS C;  3OW2 O;  1VQ9 P;  1F80 D;  2K0Y A;  3BP9 A;  2L22 A;  3G4S P;  3DS4 A;  4QNB A;  5F2N A;  4GR2 A;  2XGU A;  5HGO A;  2KGD A;  1NQ4 A;  2CGQ A;  2KW2 A;  3EJB A;  1BAJ A;  3NTE A;  2KGF A;  2N5I A;  2OTL P;  2JYL A;  2KOQ A;  2WPT A;  5KP6 B;  3CC2 P;  2PEN A;  3B5I A;  3CCJ P;  3EJE A;  2XZ1 C;  2FAD A;  1K73 Q;  2V4X A;  2KG6 A;  1EMV A;  3CC4 P;  1BXI A;  1IMQ A;  1M9F C;  3CCS P;  2WLV B;  5JPA A;  2M8L A;  2LML A;  1P7N A;  1VQ5 P;  2KOS A;  2EFJ A;  5KP8 B;  3E2D A;  3CME P;  2MR7 A;  2EG5 A;  2N98 A;  2KR5 A;  2PEO A;  1VQO P;  4DGE C;  1L0H A;  2Z44 A;  4BPH A;  3CCM P;  4XFX A;  1M9E C;  3G28 A;  3VRL C;  2N5H A;  2XXM A;  5HGN A;  3EJD A;  1VQ4 P;  2MR8 A;  2XGV A;  2OAR A;  5BS2 A;  1AF8 A;  1M6N A;  2K0X A;  2PEK A;  4PXH B;  1RO0 A;  4U0D A;  2KOO A;  1RO2 A;  3G1I A;  3H0D A;  2VLP A;  2VLQ A;  4PH3 A;  3CMA P;  2FAC A;  4U0B A;  1YIJ P;  2KGA A;  2K94 A;  1DV5 A;  1RNI A;  5HGK A;  4J93 A;  2JU2 A;  2PWO A;  2PEM A;  1M74 A;  3GJN A;  1UNK A;  2MVV A;  1KQS O;  4E91 A;  1AFV A;  4XRQ A;  1IMP A;  2Z46 A;  3G26 A;  1VHN A;  1M1K Q;  1Q86 Q;  2AFD A;  2JO0 A;  1ZNV A;  3DS3 A;  3RG6 C;  2K0D X;  4XFZ A;  4DGA C;  4NX4 C;  4B4N A;  2Z45 A;  1A8O A;  1AYI A;  1M9C C;  2FQ0 A;  2LIU A;  3LRY A;  1M9X C;  1E0H A;  1KC8 Q;  2ONT A;  3H4E A;  1GPJ A;  3CCE P;  1DNY A;  2GDX A;  1G03 A;  2Y4Z A;  1KD1 Q;  1A43 A;  2K2Q A;  2PWM A;  4HKG A;  5HGL A;  2GZI A;  2KG9 A;  2M8N A;  5EJD A;  2K93 A;  3GKL C;  4M0I A;  1K8A Q;  4PH1 A;  2AF8 A;  2XZ0 D;  1K9M Q;  1D1D A;  3LMO A;  4E92 A;  5HGM A;  2QEX P;  2PNG A;  1L0I A;  2CNR A;  1YJN P;  1EM9 A;  2PEJ A;  2QNW A;  1Z6M A;  2GZG A;  2LL8 A;  1GXG A;  2WLV A;  4BPG A;  2OTJ P;  1S72 P;  2N6Y A;  3H47 A;  2XT1 A;  2LF4 A;  2ROQ A;  2MF4 A;  3M1M A;  1AUM A;  3CCR P;  2JPR A;  4IZ6 A;  3G29 A;  1ZMB A;  2M8P A;  4INB A;  2CG5 B;  1OR5 A;  3CCL P;  4PH2 A;  2FVF A;  2GDY A;  3CC7 P;  1IUQ A;  4R0M A;  3HYB A;  4WYM A;  2ERH A;  2KG8 A;  2XDE A;  2X83 A;  2X2D D;  1NJI Q;  2KWL A;  4U0E A;  2FQ2 A;  3CXC O;  2FVE A;  1M9D C;  2PY8 A;  1EOQ A;  5HVC A;  3GZL A;  1YIT P;  1MZ8 A;  4XFY A;  1ACP A;  2PEQ A;  2FVA A;  2GDW A;  1Q82 Q;  2GZJ A;  2JGP A;  4H2Y C;  4BPF A;  1T8K A;  2E1M A;  1E6J P;  1L6N A;  2AFE A;  4LQW C;  3G0V A;  5BS1 A;  1CEI A;  2BUO A;  2LOL A;  3CCU P;  1K30 A;  5I4T G;  2VLN A; 
#chains in the Genus database with same CATH homology
 1QVF O;  5HGL A;  2EG5 A;  2PEO A;  2M8N A;  2L6E A;  3G21 A;  1VQO P;  3WBH A;  4DGE C;  2X82 A;  1U7K A;  2Z44 A;  3I55 P;  2GON A;  1GWP A;  4M0I A;  1K8A Q;  3CCM P;  4PH1 A;  4XRO A;  1M9Y C;  2XV6 A;  1K9M Q;  4XFX A;  1D1D A;  2DGY A;  1M9E C;  2P9X A;  3P05 A;  3DS2 A;  3G28 A;  3VRL C;  4COP A;  2BHV A;  4E92 A;  2XXM A;  4GR6 A;  5HGN A;  1JJ2 O;  1Q81 Q;  1VQ4 P;  5HGM A;  2QEX P;  2XGV A;  2OAR A;  3CPW O;  2XGY A;  5BS2 A;  1YJN P;  3DTJ A;  1N8R Q;  4PH0 A;  1EM9 A;  1VQK P;  2PXR C;  1M6N A;  2KOD A;  2CWO A;  3DS0 A;  5F2O A;  1VQP P;  2PEK A;  1RO0 A;  2PEJ A;  4U0D A;  4IPY A;  1RO2 A;  1VQM P;  3G1I A;  1W2B O;  3H0D A;  2WLV A;  1EIA A;  4PH3 A;  2OTJ P;  4U0F A;  3HZQ A;  1S72 P;  3CMA P;  2XT1 A;  3H47 A;  4U0C A;  4HTW A;  2LF4 A;  3CCV P;  3MGE A;  4U0B A;  1YHQ P;  1YIJ P;  3CME P;  3I56 P;  1VQ7 P;  3M1M A;  3Q20 A;  1QRJ A;  4COC A;  1YJW P;  1AUM A;  3CCR P;  2JYG A;  3DS5 A;  2JPR A;  1VQN P;  3G29 A;  1ZMB A;  1RNI A;  2M8P A;  1M6E X;  3OW2 O;  5HGK A;  4J93 A;  4INB A;  1VQ9 P;  3CCL P;  4PH2 A;  1Q7Y Q;  2PWO A;  3BP9 A;  1YJ9 P;  1M90 Q;  3CC7 P;  2PEM A;  3G4S P;  1M74 A;  3DS4 A;  1IUQ A;  1AK4 C;  4QNB A;  1KQS O;  4E91 A;  1AFV A;  1VQ6 P;  5F2N A;  4GR2 A;  4XRQ A;  2XGU A;  3G71 P;  2Z46 A;  5HGO A;  3HYB A;  4WYM A;  3G26 A;  1M1K Q;  3CD6 P;  1Q86 Q;  2XDE A;  2X83 A;  2X2D D;  1BAJ A;  2JO0 A;  1NJI Q;  3DS3 A;  4U0E A;  3RG6 C;  3G1G A;  3CXC O;  1VQL P;  3NTE A;  2KGF A;  1YI2 P;  1M9D C;  2PY8 A;  2OTL P;  2JYL A;  4XFZ A;  1EOQ A;  3G6E P;  1YIT P;  2PEI A;  3CC2 P;  4XFY A;  4DGA C;  5F2K A;  2PEN A;  3B5I A;  2PEQ A;  3CCJ P;  4NX4 C;  4B4N A;  2Z45 A;  5DCK A;  1A8O A;  1Q82 Q;  1VQ8 P;  1M9C C;  3LRY A;  1M9X C;  1K73 Q;  2QA4 P;  2V4X A;  2GOL B;  1KC8 Q;  2E1M A;  3DS1 A;  1E6J P;  3CC4 P;  1M9F C;  1L6N A;  2ONT A;  3CCS P;  3H4E A;  4LQW C;  2WLV B;  5JPA A;  3DPH A;  2M8L A;  3G0V A;  5BS1 A;  1P7N A;  1VQ5 P;  2BUO A;  3CCE P;  4U0A A;  3CCU P;  1K30 A;  1G03 A;  5I4T G;  2Y4Z A;  1KD1 Q;  1A43 A;  2EIA A;  1QVG O;  2EFJ A;  2PWM A;  3E2D A;  3CCQ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...