5JPAA

Hexameric hiv-1 ca h12y mutant
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
208
Chain Sequence
PIVQNLQGQMVYQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid Protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 74
structure length 208
sequence length 219
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5jpaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5jpaA02
3P05A 4IPYA 4PH2A 2XXMA 1M9FC 5HGOA 2PXRC 2XGVA 1M9DC 4XFXA 4XFYA 1AUMA 2XV6A 1BAJA 2EIAA 1M9YC 5DCKA 2M8NA 2KGFA 1EIAA 1D1DA 4QNBA 3DS5A 4XFZA 1L6NA 3DS2A 1M9XC 2XGUA 5HGKA 5HGNA 4PH1A 3BP9A 3DS3A 3DS0A 2PWMA 2XT1A 3G0VA 2XDEA 4NX4C 2BUOA 3MGEA 4WYMA 4B4NA 4PH0A 2GOLB 3G1IA 2X2DD 3NTEA 4LQWC 3DS4A 4M0IA 3G28A 2LF4A 1GWPA 2WLVB 4COCA 4E92A 3VRLC 2JYGA 1EM9A 5HGMA 2X82A 4J93A 4U0DA 4E91A 1M9CC 4PH3A 3H47A 4U0FA 2WLVA 1P7NA 2V4XA 1U7KA 2L6EA 3DS1A 1G03A 1AFVA 1M9EC 1E6JP 4COPA 1AK4C 4HTWA 3LRYA 3G26A 4U0AA 4XROA 1EOQA 2ONTA 1QRJA 3G29A 5HGLA 2M8LA 4DGAC 3DPHA 4U0EA 2GONA 4U0CA 2X83A 5JPAA 2JPRA 3H4EA 3DTJA 2XGYA 4DGEC 2JYLA 1A43A 2JO0A 5I4TG 3G21A 2PWOA 2M8PA 4XRQA 1A8OA 2KODA 4U0BA 4INBA 2Y4ZA 3G1GA
chains in the Genus database with same CATH superfamily
4H2WC 1HQBA 4HKGA 2N5IA 4BPHA 5KP8B 5F2KA 2K0YA 1BAJA 3CC2P 2M5RA 5DCKA 1EIAA 1N8RQ 2VLPA 1Q81Q 3B4QA 3DS5A 1IMQA 5BS2A 3CXCO 2XGUA 2JU2A 5HGKA 1VQ4P 2JB0A 2VLQA 5KP7B 2QEXP 2PWMA 4DG9A 2MF4A 4NX4C 2Z45A 2BUOA 3MGEA 2MVVA 1Q82Q 1BXIA 2X2DD 4LQWC 3DS4A 3CCSP 4M0IA 3G28A 1VQLP 2FVAA 4BPFA 2K92A 1VQKP 4E92A 1QVFO 3VRLC 2QNWA 2FHSC 3GKLC 4MRTC 3H47A 2K5XA 2N98A 2FQ2A 3CC4P 4F37A 4GR6A 2KOQA 1Z6MA 1M9EC 2LTEA 2VSQA 4COPA 3CPWO 4CA3A 1UJZA 4U0AA 2ONTA 1F80D 1VQ6P 2LOLA 2MY5A 4U0EA 5JPAA 2JPRA 1K9MQ 1K8AQ 1YJ9P 3I55P 1S72P 2FAEA 2M8PA 4XRQA 2GDYA 2KODA 1W2BO 1VHNA 2Z44A 2OTLP 5KP6B 3P05A 3G4SP 4PH2A 2AVAA 2XXMA 1M9FC 5HGOA 1AUMA 2XGVA 1M9DC 4XFXA 4XFYA 1VQOP 3CC7P 2GZGA 1FR2A 1ZNVA 1KQSO 1KD1Q 2KOPA 2M8NA 2KGFA 2KW2A 3B5IA 1YJWP 1X3OA 2LMLA 2ROQA 1M9XC 3E2DA 3CCEP 2N6YA 3DS0A 1KLPA 2L4BA 3EJBA 2EHSA 4PH0A 2GZIA 3G1IA 1IUQA 2KOSA 1K30A 2GDXA 1T8KA 1KC8Q 4COCA 3CCMP 1JJ2O 5HV8A 2JYGA 5EW5E 1RNIA 3LMOA 2PEOA 1M6EX 2JAZA 2VLOA 4U0FA 3M1MA 2LKIA 1RO0A 2V4XA 1CEIA 3DS1A 2MD9A 1G03A 1E6JP 1AK4C 3LRYA 1M6NA 2K94A 1L0HA 1GXGA 4R0MA 3GZMA 1VQPP 2FVFA 4U0CA 5CZDB 3Q20A 1OR5A 3H4EA 3CCRP 2KOOA 2JO0A 4BPGA 3EJDA 2FQ0A 2Y4ZA 2VLNA 1VQ5P 4IPYA 3CCUP 2N50A 2PXRC 2KG9A 2XV6A 5EJDA 2EIAA 1M9YC 3NY7B 2AF8A 2KGAA 2KGDA 2PEJA 1ZMBA 2L0QA 4QNBA 2GZFA 2PEKA 2KG8A 7CEIA 3CE7A 1M90Q 3DS2A 1HY8A 2LPKA 5HVCA 4H2YC 2CNRA 1E0HA 3BP9A 3DS3A 2XT1A 2KGEA 1AYIA 2AFDA 2WPTA 4UHPB 3NTEA 2PEQA 3CMAP 2FADA 2FVEA 1GWPA 2X2BA 2KG6A 2PY8A 2K0DX 2BHVA 3OW2O 5HGMA 2CQ8A 2X82A 4PH3A 2N6ZA 1VKUA 1YJNP 2NO8A 1L0IA 2WLVA 2FACA 1P7NA 1YHQP 2L6EA 1Q86Q 1EMVA 2ERHA 2Z46A 1YITP 3HZQA 2EHTA 2OARA 2CWOA 4QKOA 5F2NA 2EG5A 3CCVP 3G26A 4XROA 1EOQA 2JQ4A 1DV5A 3CCLP 1VQMP 2PEMA 3H0DA 1RO2A 2N5HA 2JBGA 3RG2A 4DGAC 2JU1A 2L9FA 2X83A 2GDWA 2XZ1C 3DTJA 1GXHA 1NQ4A 1M74A 2E1MA 4DGEC 3G21A 3RG6C 2PWOA 3CCJP 1VQNP 2FQ1A 2MVUA 4U0BA 3G1GA 2LIUA 2DGYA 1VQ9P 2L22A 2GZEA 1ACPA 2QA4P 3CCQP 1NJIQ 2DNWA 2LL8A 1MZ8A 4IZ6A 1D1DA 1YI2P 2KORA 4GR2A 2JGPA 1K73Q 2MR7A 4XFZA 1L6NA 3GJNA 3GZLA 4PWVB 2KWLA 5HGNA 2KGCA 4PH1A 2XZ0D 3G0VA 2PENA 2XDEA 3HYBA 4WYMA 4B4NA 2GOLB 1DNYA 5BS1A 3CD6P 2P9XA 2LF4A 2GYKA 2OTJP 4PXHB 2WLVB 3G71P 3EJEA 3WBHA 1EM9A 4J93A 3U43A 4U0DA 4E91A 1M9CC 2PNGA 2EFJA 1M1KQ 2K0XA 4NEOA 1U7KA 4H2XC 1GPJA 3CMEP 2GZJA 2CGQA 1AFVA 1Q7YQ 1VQ7P 3I56P 4HTWA 3G6EP 2KR5A 1QRJA 3G29A 2LIWA 2MR8A 5HGLA 1UNKA 2M8LA 3DPHA 2AFEA 2GONA 5F2OA 2XGYA 1VQ8P 2JYLA 2K2QA 1A43A 5I4TG 2CG5B 1A8OA 1QVGO 2PEIA 4INBA 1AF8A 2K93A 1IMPA 1YIJP
chains in the Genus database with same CATH topology
1VQ9P 1VQ5P 2Z44A 2OTLP 2QA4P 3P05A 3G4SP 3CCQP 4IPYA 3CCUP 4PH2A 5F2KA 1NJIQ 2XXMA 1M9FC 5HGOA 2PXRC 2XGVA 1M9DC 4XFXA 4XFYA 1AUMA 2XV6A 1VQOP 3CC7P 1BAJA 3CC2P 2EIAA 1M9YC 1KQSO 1KD1Q 5DCKA 2M8NA 2KGFA 1EIAA 3B5IA 1D1DA 1N8RQ 1YJWP 1YI2P 2PEJA 1Q81Q 1ZMBA 4QNBA 4GR2A 3DS5A 2PEKA 1K73Q 4XFZA 1L6NA 5BS2A 1M90Q 3DS2A 3CXCO 1M9XC 2XGUA 3E2DA 5HGKA 3CCEP 1VQ4P 5HGNA 4PH1A 3BP9A 3DS3A 2QEXP 3DS0A 2PWMA 2XT1A 3G0VA 2PENA 2XDEA 4NX4C 2Z45A 2BUOA 3HYBA 3MGEA 4WYMA 4B4NA 4PH0A 1Q82Q 2GOLB 3G1IA 2X2DD 3NTEA 4LQWC 1IUQA 2PEQA 3DS4A 5BS1A 3CMAP 3CD6P 3CCSP 4M0IA 3G28A 2P9XA 2LF4A 1VQLP 1K30A 2OTJP 1GWPA 1VQKP 2WLVB 3G71P 2PY8A 1KC8Q 4COCA 3CCMP 4E92A 2BHVA 1JJ2O 3VRLC 3WBHA 1QVFO 3OW2O 2JYGA 1EM9A 5HGMA 1RNIA 2X82A 4J93A 4U0DA 2PEOA 1M6EX 4E91A 1M9CC 4PH3A 3H47A 4U0FA 1YJNP 3M1MA 2WLVA 2EFJA 1P7NA 1M1KQ 3CC4P 1RO0A 2V4XA 1U7KA 1YHQP 4GR6A 2L6EA 1Q86Q 2Z46A 3DS1A 3HZQA 1YITP 3CMEP 1G03A 2OARA 1AFVA 1M9EC 2CWOA 1Q7YQ 1E6JP 5F2NA 1VQ7P 4COPA 1AK4C 3CPWO 3I56P 4HTWA 3LRYA 2EG5A 3CCVP 1M6NA 3G26A 4U0AA 4XROA 1EOQA 2ONTA 3G6EP 1QRJA 3G29A 3CCLP 1VQMP 5HGLA 2PEMA 3H0DA 1VQ6P 1RO2A 2M8LA 4DGAC 3DPHA 1VQPP 4U0EA 2GONA 4U0CA 2X83A 3Q20A 5JPAA 2JPRA 1K9MQ 1K8AQ 3H4EA 1YJ9P 5F2OA 3DTJA 3CCRP 2XGYA 1M74A 2E1MA 3I55P 4DGEC 2JYLA 1VQ8P 1A43A 1S72P 2JO0A 5I4TG 3G21A 3RG6C 2PWOA 2M8PA 3CCJP 1VQNP 4XRQA 1A8OA 1QVGO 2KODA 2PEIA 4U0BA 4INBA 2Y4ZA 3G1GA 1W2BO 2DGYA 1YIJP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P05 A;  4IPY A;  4PH2 A;  2XXM A;  1M9F C;  5HGO A;  2PXR C;  2XGV A;  1M9D C;  4XFX A;  4XFY A;  1AUM A;  2XV6 A;  1BAJ A;  2EIA A;  1M9Y C;  5DCK A;  2M8N A;  2KGF A;  1EIA A;  1D1D A;  4QNB A;  3DS5 A;  4XFZ A;  1L6N A;  3DS2 A;  1M9X C;  2XGU A;  5HGK A;  5HGN A;  4PH1 A;  3BP9 A;  3DS3 A;  3DS0 A;  2PWM A;  2XT1 A;  3G0V A;  2XDE A;  4NX4 C;  2BUO A;  3MGE A;  4WYM A;  4B4N A;  4PH0 A;  2GOL B;  3G1I A;  2X2D D;  3NTE A;  4LQW C;  3DS4 A;  4M0I A;  3G28 A;  2LF4 A;  1GWP A;  2WLV B;  4COC A;  4E92 A;  3VRL C;  2JYG A;  1EM9 A;  5HGM A;  2X82 A;  4J93 A;  4U0D A;  4E91 A;  1M9C C;  4PH3 A;  3H47 A;  4U0F A;  2WLV A;  1P7N A;  2V4X A;  1U7K A;  2L6E A;  3DS1 A;  1G03 A;  1AFV A;  1M9E C;  1E6J P;  4COP A;  1AK4 C;  4HTW A;  3LRY A;  3G26 A;  4U0A A;  4XRO A;  1EOQ A;  2ONT A;  1QRJ A;  3G29 A;  5HGL A;  2M8L A;  4DGA C;  3DPH A;  4U0E A;  2GON A;  4U0C A;  2X83 A;  5JPA A;  2JPR A;  3H4E A;  3DTJ A;  2XGY A;  4DGE C;  2JYL A;  1A43 A;  2JO0 A;  5I4T G;  3G21 A;  2PWO A;  2M8P A;  4XRQ A;  1A8O A;  2KOD A;  4U0B A;  4INB A;  2Y4Z A;  3G1G A; 
#chains in the Genus database with same CATH topology
 4H2W C;  1HQB A;  4HKG A;  2N5I A;  4BPH A;  5KP8 B;  5F2K A;  2K0Y A;  1BAJ A;  3CC2 P;  2M5R A;  5DCK A;  1EIA A;  1N8R Q;  2VLP A;  1Q81 Q;  3B4Q A;  3DS5 A;  1IMQ A;  5BS2 A;  3CXC O;  2XGU A;  2JU2 A;  5HGK A;  1VQ4 P;  2JB0 A;  2VLQ A;  5KP7 B;  2QEX P;  2PWM A;  4DG9 A;  2MF4 A;  4NX4 C;  2Z45 A;  2BUO A;  3MGE A;  2MVV A;  1Q82 Q;  1BXI A;  2X2D D;  4LQW C;  3DS4 A;  3CCS P;  4M0I A;  3G28 A;  1VQL P;  2FVA A;  4BPF A;  2K92 A;  1VQK P;  4E92 A;  1QVF O;  3VRL C;  2QNW A;  2FHS C;  3GKL C;  4MRT C;  3H47 A;  2K5X A;  2N98 A;  2FQ2 A;  3CC4 P;  4F37 A;  4GR6 A;  2KOQ A;  1Z6M A;  1M9E C;  2LTE A;  2VSQ A;  4COP A;  3CPW O;  4CA3 A;  1UJZ A;  4U0A A;  2ONT A;  1F80 D;  1VQ6 P;  2LOL A;  2MY5 A;  4U0E A;  5JPA A;  2JPR A;  1K9M Q;  1K8A Q;  1YJ9 P;  3I55 P;  1S72 P;  2FAE A;  2M8P A;  4XRQ A;  2GDY A;  2KOD A;  1W2B O;  1VHN A;  2Z44 A;  2OTL P;  5KP6 B;  3P05 A;  3G4S P;  4PH2 A;  2AVA A;  2XXM A;  1M9F C;  5HGO A;  1AUM A;  2XGV A;  1M9D C;  4XFX A;  4XFY A;  1VQO P;  3CC7 P;  2GZG A;  1FR2 A;  1ZNV A;  1KQS O;  1KD1 Q;  2KOP A;  2M8N A;  2KGF A;  2KW2 A;  3B5I A;  1YJW P;  1X3O A;  2LML A;  2ROQ A;  1M9X C;  3E2D A;  3CCE P;  2N6Y A;  3DS0 A;  1KLP A;  2L4B A;  3EJB A;  2EHS A;  4PH0 A;  2GZI A;  3G1I A;  1IUQ A;  2KOS A;  1K30 A;  2GDX A;  1T8K A;  1KC8 Q;  4COC A;  3CCM P;  1JJ2 O;  5HV8 A;  2JYG A;  5EW5 E;  1RNI A;  3LMO A;  2PEO A;  1M6E X;  2JAZ A;  2VLO A;  4U0F A;  3M1M A;  2LKI A;  1RO0 A;  2V4X A;  1CEI A;  3DS1 A;  2MD9 A;  1G03 A;  1E6J P;  1AK4 C;  3LRY A;  1M6N A;  2K94 A;  1L0H A;  1GXG A;  4R0M A;  3GZM A;  1VQP P;  2FVF A;  4U0C A;  5CZD B;  3Q20 A;  1OR5 A;  3H4E A;  3CCR P;  2KOO A;  2JO0 A;  4BPG A;  3EJD A;  2FQ0 A;  2Y4Z A;  2VLN A;  1VQ5 P;  4IPY A;  3CCU P;  2N50 A;  2PXR C;  2KG9 A;  2XV6 A;  5EJD A;  2EIA A;  1M9Y C;  3NY7 B;  2AF8 A;  2KGA A;  2KGD A;  2PEJ A;  1ZMB A;  2L0Q A;  4QNB A;  2GZF A;  2PEK A;  2KG8 A;  7CEI A;  3CE7 A;  1M90 Q;  3DS2 A;  1HY8 A;  2LPK A;  5HVC A;  4H2Y C;  2CNR A;  1E0H A;  3BP9 A;  3DS3 A;  2XT1 A;  2KGE A;  1AYI A;  2AFD A;  2WPT A;  4UHP B;  3NTE A;  2PEQ A;  3CMA P;  2FAD A;  2FVE A;  1GWP A;  2X2B A;  2KG6 A;  2PY8 A;  2K0D X;  2BHV A;  3OW2 O;  5HGM A;  2CQ8 A;  2X82 A;  4PH3 A;  2N6Z A;  1VKU A;  1YJN P;  2NO8 A;  1L0I A;  2WLV A;  2FAC A;  1P7N A;  1YHQ P;  2L6E A;  1Q86 Q;  1EMV A;  2ERH A;  2Z46 A;  1YIT P;  3HZQ A;  2EHT A;  2OAR A;  2CWO A;  4QKO A;  5F2N A;  2EG5 A;  3CCV P;  3G26 A;  4XRO A;  1EOQ A;  2JQ4 A;  1DV5 A;  3CCL P;  1VQM P;  2PEM A;  3H0D A;  1RO2 A;  2N5H A;  2JBG A;  3RG2 A;  4DGA C;  2JU1 A;  2L9F A;  2X83 A;  2GDW A;  2XZ1 C;  3DTJ A;  1GXH A;  1NQ4 A;  1M74 A;  2E1M A;  4DGE C;  3G21 A;  3RG6 C;  2PWO A;  3CCJ P;  1VQN P;  2FQ1 A;  2MVU A;  4U0B A;  3G1G A;  2LIU A;  2DGY A;  1VQ9 P;  2L22 A;  2GZE A;  1ACP A;  2QA4 P;  3CCQ P;  1NJI Q;  2DNW A;  2LL8 A;  1MZ8 A;  4IZ6 A;  1D1D A;  1YI2 P;  2KOR A;  4GR2 A;  2JGP A;  1K73 Q;  2MR7 A;  4XFZ A;  1L6N A;  3GJN A;  3GZL A;  4PWV B;  2KWL A;  5HGN A;  2KGC A;  4PH1 A;  2XZ0 D;  3G0V A;  2PEN A;  2XDE A;  3HYB A;  4WYM A;  4B4N A;  2GOL B;  1DNY A;  5BS1 A;  3CD6 P;  2P9X A;  2LF4 A;  2GYK A;  2OTJ P;  4PXH B;  2WLV B;  3G71 P;  3EJE A;  3WBH A;  1EM9 A;  4J93 A;  3U43 A;  4U0D A;  4E91 A;  1M9C C;  2PNG A;  2EFJ A;  1M1K Q;  2K0X A;  4NEO A;  1U7K A;  4H2X C;  1GPJ A;  3CME P;  2GZJ A;  2CGQ A;  1AFV A;  1Q7Y Q;  1VQ7 P;  3I56 P;  4HTW A;  3G6E P;  2KR5 A;  1QRJ A;  3G29 A;  2LIW A;  2MR8 A;  5HGL A;  1UNK A;  2M8L A;  3DPH A;  2AFE A;  2GON A;  5F2O A;  2XGY A;  1VQ8 P;  2JYL A;  2K2Q A;  1A43 A;  5I4T G;  2CG5 B;  1A8O A;  1QVG O;  2PEI A;  4INB A;  1AF8 A;  2K93 A;  1IMP A;  1YIJ P; 
#chains in the Genus database with same CATH homology
 1VQ9 P;  1VQ5 P;  2Z44 A;  2OTL P;  2QA4 P;  3P05 A;  3G4S P;  3CCQ P;  4IPY A;  3CCU P;  4PH2 A;  5F2K A;  1NJI Q;  2XXM A;  1M9F C;  5HGO A;  2PXR C;  2XGV A;  1M9D C;  4XFX A;  4XFY A;  1AUM A;  2XV6 A;  1VQO P;  3CC7 P;  1BAJ A;  3CC2 P;  2EIA A;  1M9Y C;  1KQS O;  1KD1 Q;  5DCK A;  2M8N A;  2KGF A;  1EIA A;  3B5I A;  1D1D A;  1N8R Q;  1YJW P;  1YI2 P;  2PEJ A;  1Q81 Q;  1ZMB A;  4QNB A;  4GR2 A;  3DS5 A;  2PEK A;  1K73 Q;  4XFZ A;  1L6N A;  5BS2 A;  1M90 Q;  3DS2 A;  3CXC O;  1M9X C;  2XGU A;  3E2D A;  5HGK A;  3CCE P;  1VQ4 P;  5HGN A;  4PH1 A;  3BP9 A;  3DS3 A;  2QEX P;  3DS0 A;  2PWM A;  2XT1 A;  3G0V A;  2PEN A;  2XDE A;  4NX4 C;  2Z45 A;  2BUO A;  3HYB A;  3MGE A;  4WYM A;  4B4N A;  4PH0 A;  1Q82 Q;  2GOL B;  3G1I A;  2X2D D;  3NTE A;  4LQW C;  1IUQ A;  2PEQ A;  3DS4 A;  5BS1 A;  3CMA P;  3CD6 P;  3CCS P;  4M0I A;  3G28 A;  2P9X A;  2LF4 A;  1VQL P;  1K30 A;  2OTJ P;  1GWP A;  1VQK P;  2WLV B;  3G71 P;  2PY8 A;  1KC8 Q;  4COC A;  3CCM P;  4E92 A;  2BHV A;  1JJ2 O;  3VRL C;  3WBH A;  1QVF O;  3OW2 O;  2JYG A;  1EM9 A;  5HGM A;  1RNI A;  2X82 A;  4J93 A;  4U0D A;  2PEO A;  1M6E X;  4E91 A;  1M9C C;  4PH3 A;  3H47 A;  4U0F A;  1YJN P;  3M1M A;  2WLV A;  2EFJ A;  1P7N A;  1M1K Q;  3CC4 P;  1RO0 A;  2V4X A;  1U7K A;  1YHQ P;  4GR6 A;  2L6E A;  1Q86 Q;  2Z46 A;  3DS1 A;  3HZQ A;  1YIT P;  3CME P;  1G03 A;  2OAR A;  1AFV A;  1M9E C;  2CWO A;  1Q7Y Q;  1E6J P;  5F2N A;  1VQ7 P;  4COP A;  1AK4 C;  3CPW O;  3I56 P;  4HTW A;  3LRY A;  2EG5 A;  3CCV P;  1M6N A;  3G26 A;  4U0A A;  4XRO A;  1EOQ A;  2ONT A;  3G6E P;  1QRJ A;  3G29 A;  3CCL P;  1VQM P;  5HGL A;  2PEM A;  3H0D A;  1VQ6 P;  1RO2 A;  2M8L A;  4DGA C;  3DPH A;  1VQP P;  4U0E A;  2GON A;  4U0C A;  2X83 A;  3Q20 A;  5JPA A;  2JPR A;  1K9M Q;  1K8A Q;  3H4E A;  1YJ9 P;  5F2O A;  3DTJ A;  3CCR P;  2XGY A;  1M74 A;  2E1M A;  3I55 P;  4DGE C;  2JYL A;  1VQ8 P;  1A43 A;  1S72 P;  2JO0 A;  5I4T G;  3G21 A;  3RG6 C;  2PWO A;  2M8P A;  3CCJ P;  1VQN P;  4XRQ A;  1A8O A;  1QVG O;  2KOD A;  2PEI A;  4U0B A;  4INB A;  2Y4Z A;  3G1G A;  1W2B O;  2DGY A;  1YIJ P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...