5JPAA

Hexameric hiv-1 ca h12y mutant
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
208
Chain Sequence
PIVQNLQGQMVYQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
molecule keywords Capsid Protein P24
total genus 74
structure length 208
sequence length 219
ec nomenclature
pdb deposition date 2016-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5jpaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5jpaA02
1U7KA 2XV6A 4U0AA 4E91A 2X2DD 2Y4ZA 1EIAA 1GWPA 3P05A 3H4EA 2M8NA 4COPA 4U0FA 2WLVB 2JYGA 4DGAC 3DPHA 2ONTA 2PWMA 2X82A 1D1DA 3BP9A 3DS5A 4LQWC 4J93A 4NX4C 3H47A 5JPAA 3DS3A 2JPRA 3DTJA 3G21A 2XGYA 2M8LA 2XT1A 4WYMA 4U0CA 4DGEC 4PH2A 4PH0A 3VRLC 2XGVA 3DS0A 2JO0A 2V4XA 2JYLA 5HGNA 2GONA 1G03A 1EM9A 2WLVA 1AK4C 4M0IA 4XFXA 2XGUA 5HGMA 1M9FC 5HGLA 1A43A 4XROA 2XDEA 2XXMA 5HGOA 4PH3A 3G1GA 3LRYA 4U0DA 3G29A 2M8PA 4INBA 3NTEA 1L6NA 1M9YC 2PXRC 2BUOA 4E92A 4COCA 4U0EA 2L6EA 5DCKA 4XFZA 1M9XC 4PH1A 2X83A 1M9CC 4XFYA 3DS4A 5I4TG 2KODA 1AUMA 1M9DC 2EIAA 3DS1A 3G26A 1P7NA 1QRJA 1AFVA 2LF4A 2GOLB 1A8OA 1BAJA 3DS2A 2PWOA 3MGEA 1M9EC 3G28A 1E6JP 4QNBA 4U0BA 3G0VA 4IPYA 4B4NA 4XRQA 3G1IA 5HGKA 2KGFA 4HTWA 1EOQA
chains in the Genus database with same CATH superfamily
4U0AA 2L4BA 3EJEA 3CCSP 2K93A 1M90Q 2PEIA 1S72P 2WPTA 2JYGA 2ONTA 2JBGA 1VQ9P 3H47A 2LKIA 3DS3A 3G21A 3CCVP 2N5IA 2XT1A 1RNIA 4WYMA 1VQ8P 4PH2A 4PH0A 2XGVA 3RG6C 1E0HA 2FQ0A 1RO0A 2WLVA 1VQMP 1KC8Q 5EW5E 5HV8A 4XFXA 3B4QA 3H0DA 5HGLA 4XROA 4BPFA 2XXMA 3G1GA 4PH3A 3G29A 1DV5A 2XZ0D 1L6NA 1GPJA 3U43A 2BUOA 2MF4A 4H2XC 1DNYA 3GZLA 2X83A 2GDYA 3RG2A 1F80D 4XFYA 3DS4A 2JB0A 5KP7B 2KODA 5EJDA 1JJ2O 1AUMA 1M9DC 3GKLC 2MVVA 2PEMA 2VLQA 1Q86Q 3CC2P 2ERHA 1YJNP 1VQ4P 4GR2A 2LF4A 2GOLB 3CCMP 3HYBA 2KWLA 2EHSA 3DS2A 1YJWP 1IMPA 2PWOA 4IZ6A 4UHPB 2JU2A 2VLOA 1BXIA 1VHNA 4XRQA 3G1IA 2KGFA 1YJ9P 1U7KA 1K30A 1IUQA 4E91A 1EIAA 2K0DX 1K9MQ 1HQBA 4U0FA 2K0XA 2FAEA 3NY7B 4H2YC 4GR6A 3DS5A 4QKOA 2KW2A 3DTJA 4PXHB 1K8AQ 2KGCA 2M8LA 2K92A 2GZEA 3CCLP 1KD1Q 2K2QA 3M1MA 2FVAA 3CCRP 2LL8A 2L9FA 2GONA 1M74A 1VQLP 3CMEP 1VQNP 1Q81Q 1VQ7P 1A43A 2ROQA 3WBHA 2EFJA 3LRYA 4U0DA 1CEIA 2BHVA 4INBA 2FVEA 2PXRC 2N6ZA 2NO8A 1M9CC 2QNWA 2CNRA 3G71P 5I4TG 2AFEA 1K73Q 2EIAA 3Q20A 1L0IA 1QRJA 2KG9A 3G6EP 3I56P 2XZ1C 2KG8A 4CA3A 1UJZA 2GYKA 2OTLP 3HZQA 3G28A 4QNBA 4BPHA 3CC4P 1VQ5P 2FQ2A 4HKGA 2N5HA 3CC7P 2X2DD 2FVFA 2Y4ZA 2JGPA 3P05A 2GZIA 2CGQA 2PENA 2M8NA 4COPA 1IMQA 2CWOA 4DGAC 2PY8A 1NQ4A 3CMAP 4H2WC 2OTJP 2M5RA 2GZFA 2X82A 1D1DA 1AF8A 4LQWC 4PWVB 7CEIA 4J93A 2VLPA 3OW2O 4NX4C 2JPRA 1ZNVA 2XGYA 2PEQA 5F2KA 1X3OA 4DGEC 2FADA 3CD6P 2CQ8A 2KOPA 2VLNA 3VRLC 3DS0A 1NJIQ 2V4XA 1M6EX 5HGNA 1G03A 3EJBA 3CCJP 1AYIA 1YHQP 1MZ8A 1AK4C 2DGYA 3G4SP 4M0IA 1HY8A 2N50A 2JAZA 2EG5A 3GZMA 2K0YA 5HGMA 1M9FC 3LMOA 3B5IA 2DNWA 2KORA 2N98A 2XDEA 5F2OA 2LTEA 1M1KQ 2KGEA 3NTEA 1M9YC 4E92A 2L6EA 4XFZA 1M9XC 2PEKA 3CPWO 4MRTC 2PEOA 3DS1A 1N8RQ 2LOLA 2K94A 1AFVA 1YI2P 2Z45A 2KOSA 2FQ1A 2Z46A 1ZMBA 2PNGA 1ACPA 1VQ6P 2FHSC 1RO2A 2LMLA 3MGEA 2AFDA 1E6JP 4B4NA 1VQPP 2X2BA 2KG6A 2MD9A 4HTWA 1EOQA 3I55P 2XV6A 1GWPA 1VQOP 1FR2A 3H4EA 5KP8B 2L22A 1QVFO 2KGAA 2WLVB 2AVAA 1KQSO 3DPHA 1Z6MA 1VQKP 1UNKA 5HVCA 1Q7YQ 2PWMA 2QEXP 1EMVA 4NEOA 1GXGA 3BP9A 2JU1A 5JPAA 2N6YA 1W2BO 3EJDA 2MVUA 2K5XA 4U0CA 2LIUA 2MR7A 2L0QA 2JO0A 1QVGO 2JYLA 4F37A 1EM9A 1L0HA 2JQ4A 2MY5A 2KR5A 2XGUA 1OR5A 2PEJA 3CCQP 2EHTA 2GDXA 1YITP 2CG5B 2FACA 1M6NA 5HGOA 3CE7A 2GDWA 5BS1A 2M8PA 2KOQA 4COCA 5F2NA 4U0EA 2QA4P 2P9XA 5DCKA 4PH1A 2E1MA 2LIWA 3E2DA 3GJNA 5KP6B 4BPGA 2GZJA 2VSQA 5BS2A 1VKUA 1GXHA 2LPKA 3G26A 2KOOA 1P7NA 4DG9A 2AF8A 1T8KA 4R0MA 5CZDB 1Q82Q 2MR8A 1A8OA 1BAJA 2KGDA 2OARA 3CXCO 2GZGA 1M9EC 2Z44A 4U0BA 3G0VA 4IPYA 3CCEP 1KLPA 5HGKA 3CCUP 1YIJP
chains in the Genus database with same CATH topology
3I55P 1U7KA 2XV6A 1K30A 1IUQA 3CC7P 4U0AA 4E91A 2X2DD 3CCSP 2Y4ZA 1EIAA 1GWPA 1K9MQ 1VQOP 3P05A 1M90Q 2PEIA 3H4EA 2PENA 1S72P 2M8NA 4COPA 1QVFO 4U0FA 2WLVB 2CWOA 2JYGA 1KQSO 4DGAC 2PY8A 3DPHA 1VQKP 3CMAP 2ONTA 1Q7YQ 2OTJP 2PWMA 2QEXP 2X82A 1D1DA 4GR6A 3BP9A 3DS5A 1VQ9P 4LQWC 4J93A 3OW2O 4NX4C 3H47A 5JPAA 3DS3A 2JPRA 3DTJA 3G21A 3CCVP 1K8AQ 2XGYA 2M8LA 2XT1A 1RNIA 2PEQA 1W2BO 5F2KA 4WYMA 4U0CA 4DGEC 1VQ8P 3CD6P 4PH2A 4PH0A 3VRLC 2XGVA 3CCLP 1KD1Q 3DS0A 3RG6C 3M1MA 1NJIQ 2JO0A 2V4XA 2JYLA 1QVGO 3CCRP 1M6EX 5HGNA 2GONA 1M74A 1RO0A 1G03A 1EM9A 3CCJP 1YHQP 2WLVA 1AK4C 2DGYA 3G4SP 1VQMP 1VQLP 4M0IA 1KC8Q 3CMEP 1VQNP 2EG5A 4XFXA 2XGUA 2PEJA 3CCQP 1Q81Q 5HGMA 1VQ7P 3H0DA 1M9FC 5HGLA 3B5IA 1A43A 4XROA 1YITP 2XDEA 5F2OA 2XXMA 3WBHA 1M6NA 5HGOA 4PH3A 2EFJA 3G1GA 5BS1A 3LRYA 4U0DA 3G29A 1M1KQ 2BHVA 2M8PA 4INBA 3NTEA 1L6NA 1M9YC 2PXRC 2BUOA 4E92A 4COCA 5F2NA 4U0EA 2QA4P 2L6EA 2P9XA 5DCKA 4XFZA 1M9XC 4PH1A 1YIJP 2E1MA 2X83A 3E2DA 1M9CC 2PEKA 4XFYA 3DS4A 3G71P 5BS2A 5I4TG 2KODA 3CPWO 1JJ2O 1AUMA 1M9DC 2PEOA 2PEMA 1Q86Q 3CC2P 1K73Q 2EIAA 3DS1A 3Q20A 1N8RQ 3G26A 1YJNP 1VQ4P 1P7NA 1QRJA 1AFVA 4GR2A 1YI2P 2LF4A 2GOLB 3CCMP 2Z45A 3HYBA 2Z46A 3G6EP 1Q82Q 1A8OA 1BAJA 3I56P 1ZMBA 3DS2A 1YJWP 1VQ6P 2OTLP 2OARA 3CXCO 1RO2A 2PWOA 3MGEA 3HZQA 1M9EC 3G28A 1E6JP 4QNBA 2Z44A 3CC4P 4U0BA 3G0VA 4IPYA 4B4NA 1VQPP 1VQ5P 3CCEP 4XRQA 3G1IA 5HGKA 3CCUP 2KGFA 4HTWA 1EOQA 1YJ9P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7K A;  2XV6 A;  4U0A A;  4E91 A;  2X2D D;  2Y4Z A;  1EIA A;  1GWP A;  3P05 A;  3H4E A;  2M8N A;  4COP A;  4U0F A;  2WLV B;  2JYG A;  4DGA C;  3DPH A;  2ONT A;  2PWM A;  2X82 A;  1D1D A;  3BP9 A;  3DS5 A;  4LQW C;  4J93 A;  4NX4 C;  3H47 A;  5JPA A;  3DS3 A;  2JPR A;  3DTJ A;  3G21 A;  2XGY A;  2M8L A;  2XT1 A;  4WYM A;  4U0C A;  4DGE C;  4PH2 A;  4PH0 A;  3VRL C;  2XGV A;  3DS0 A;  2JO0 A;  2V4X A;  2JYL A;  5HGN A;  2GON A;  1G03 A;  1EM9 A;  2WLV A;  1AK4 C;  4M0I A;  4XFX A;  2XGU A;  5HGM A;  1M9F C;  5HGL A;  1A43 A;  4XRO A;  2XDE A;  2XXM A;  5HGO A;  4PH3 A;  3G1G A;  3LRY A;  4U0D A;  3G29 A;  2M8P A;  4INB A;  3NTE A;  1L6N A;  1M9Y C;  2PXR C;  2BUO A;  4E92 A;  4COC A;  4U0E A;  2L6E A;  5DCK A;  4XFZ A;  1M9X C;  4PH1 A;  2X83 A;  1M9C C;  4XFY A;  3DS4 A;  5I4T G;  2KOD A;  1AUM A;  1M9D C;  2EIA A;  3DS1 A;  3G26 A;  1P7N A;  1QRJ A;  1AFV A;  2LF4 A;  2GOL B;  1A8O A;  1BAJ A;  3DS2 A;  2PWO A;  3MGE A;  1M9E C;  3G28 A;  1E6J P;  4QNB A;  4U0B A;  3G0V A;  4IPY A;  4B4N A;  4XRQ A;  3G1I A;  5HGK A;  2KGF A;  4HTW A;  1EOQ A; 
#chains in the Genus database with same CATH topology
 4U0A A;  2L4B A;  3EJE A;  3CCS P;  2K93 A;  1M90 Q;  2PEI A;  1S72 P;  2WPT A;  2JYG A;  2ONT A;  2JBG A;  1VQ9 P;  3H47 A;  2LKI A;  3DS3 A;  3G21 A;  3CCV P;  2N5I A;  2XT1 A;  1RNI A;  4WYM A;  1VQ8 P;  4PH2 A;  4PH0 A;  2XGV A;  3RG6 C;  1E0H A;  2FQ0 A;  1RO0 A;  2WLV A;  1VQM P;  1KC8 Q;  5EW5 E;  5HV8 A;  4XFX A;  3B4Q A;  3H0D A;  5HGL A;  4XRO A;  4BPF A;  2XXM A;  3G1G A;  4PH3 A;  3G29 A;  1DV5 A;  2XZ0 D;  1L6N A;  1GPJ A;  3U43 A;  2BUO A;  2MF4 A;  4H2X C;  1DNY A;  3GZL A;  2X83 A;  2GDY A;  3RG2 A;  1F80 D;  4XFY A;  3DS4 A;  2JB0 A;  5KP7 B;  2KOD A;  5EJD A;  1JJ2 O;  1AUM A;  1M9D C;  3GKL C;  2MVV A;  2PEM A;  2VLQ A;  1Q86 Q;  3CC2 P;  2ERH A;  1YJN P;  1VQ4 P;  4GR2 A;  2LF4 A;  2GOL B;  3CCM P;  3HYB A;  2KWL A;  2EHS A;  3DS2 A;  1YJW P;  1IMP A;  2PWO A;  4IZ6 A;  4UHP B;  2JU2 A;  2VLO A;  1BXI A;  1VHN A;  4XRQ A;  3G1I A;  2KGF A;  1YJ9 P;  1U7K A;  1K30 A;  1IUQ A;  4E91 A;  1EIA A;  2K0D X;  1K9M Q;  1HQB A;  4U0F A;  2K0X A;  2FAE A;  3NY7 B;  4H2Y C;  4GR6 A;  3DS5 A;  4QKO A;  2KW2 A;  3DTJ A;  4PXH B;  1K8A Q;  2KGC A;  2M8L A;  2K92 A;  2GZE A;  3CCL P;  1KD1 Q;  2K2Q A;  3M1M A;  2FVA A;  3CCR P;  2LL8 A;  2L9F A;  2GON A;  1M74 A;  1VQL P;  3CME P;  1VQN P;  1Q81 Q;  1VQ7 P;  1A43 A;  2ROQ A;  3WBH A;  2EFJ A;  3LRY A;  4U0D A;  1CEI A;  2BHV A;  4INB A;  2FVE A;  2PXR C;  2N6Z A;  2NO8 A;  1M9C C;  2QNW A;  2CNR A;  3G71 P;  5I4T G;  2AFE A;  1K73 Q;  2EIA A;  3Q20 A;  1L0I A;  1QRJ A;  2KG9 A;  3G6E P;  3I56 P;  2XZ1 C;  2KG8 A;  4CA3 A;  1UJZ A;  2GYK A;  2OTL P;  3HZQ A;  3G28 A;  4QNB A;  4BPH A;  3CC4 P;  1VQ5 P;  2FQ2 A;  4HKG A;  2N5H A;  3CC7 P;  2X2D D;  2FVF A;  2Y4Z A;  2JGP A;  3P05 A;  2GZI A;  2CGQ A;  2PEN A;  2M8N A;  4COP A;  1IMQ A;  2CWO A;  4DGA C;  2PY8 A;  1NQ4 A;  3CMA P;  4H2W C;  2OTJ P;  2M5R A;  2GZF A;  2X82 A;  1D1D A;  1AF8 A;  4LQW C;  4PWV B;  7CEI A;  4J93 A;  2VLP A;  3OW2 O;  4NX4 C;  2JPR A;  1ZNV A;  2XGY A;  2PEQ A;  5F2K A;  1X3O A;  4DGE C;  2FAD A;  3CD6 P;  2CQ8 A;  2KOP A;  2VLN A;  3VRL C;  3DS0 A;  1NJI Q;  2V4X A;  1M6E X;  5HGN A;  1G03 A;  3EJB A;  3CCJ P;  1AYI A;  1YHQ P;  1MZ8 A;  1AK4 C;  2DGY A;  3G4S P;  4M0I A;  1HY8 A;  2N50 A;  2JAZ A;  2EG5 A;  3GZM A;  2K0Y A;  5HGM A;  1M9F C;  3LMO A;  3B5I A;  2DNW A;  2KOR A;  2N98 A;  2XDE A;  5F2O A;  2LTE A;  1M1K Q;  2KGE A;  3NTE A;  1M9Y C;  4E92 A;  2L6E A;  4XFZ A;  1M9X C;  2PEK A;  3CPW O;  4MRT C;  2PEO A;  3DS1 A;  1N8R Q;  2LOL A;  2K94 A;  1AFV A;  1YI2 P;  2Z45 A;  2KOS A;  2FQ1 A;  2Z46 A;  1ZMB A;  2PNG A;  1ACP A;  1VQ6 P;  2FHS C;  1RO2 A;  2LML A;  3MGE A;  2AFD A;  1E6J P;  4B4N A;  1VQP P;  2X2B A;  2KG6 A;  2MD9 A;  4HTW A;  1EOQ A;  3I55 P;  2XV6 A;  1GWP A;  1VQO P;  1FR2 A;  3H4E A;  5KP8 B;  2L22 A;  1QVF O;  2KGA A;  2WLV B;  2AVA A;  1KQS O;  3DPH A;  1Z6M A;  1VQK P;  1UNK A;  5HVC A;  1Q7Y Q;  2PWM A;  2QEX P;  1EMV A;  4NEO A;  1GXG A;  3BP9 A;  2JU1 A;  5JPA A;  2N6Y A;  1W2B O;  3EJD A;  2MVU A;  2K5X A;  4U0C A;  2LIU A;  2MR7 A;  2L0Q A;  2JO0 A;  1QVG O;  2JYL A;  4F37 A;  1EM9 A;  1L0H A;  2JQ4 A;  2MY5 A;  2KR5 A;  2XGU A;  1OR5 A;  2PEJ A;  3CCQ P;  2EHT A;  2GDX A;  1YIT P;  2CG5 B;  2FAC A;  1M6N A;  5HGO A;  3CE7 A;  2GDW A;  5BS1 A;  2M8P A;  2KOQ A;  4COC A;  5F2N A;  4U0E A;  2QA4 P;  2P9X A;  5DCK A;  4PH1 A;  2E1M A;  2LIW A;  3E2D A;  3GJN A;  5KP6 B;  4BPG A;  2GZJ A;  2VSQ A;  5BS2 A;  1VKU A;  1GXH A;  2LPK A;  3G26 A;  2KOO A;  1P7N A;  4DG9 A;  2AF8 A;  1T8K A;  4R0M A;  5CZD B;  1Q82 Q;  2MR8 A;  1A8O A;  1BAJ A;  2KGD A;  2OAR A;  3CXC O;  2GZG A;  1M9E C;  2Z44 A;  4U0B A;  3G0V A;  4IPY A;  3CCE P;  1KLP A;  5HGK A;  3CCU P;  1YIJ P; 
#chains in the Genus database with same CATH homology
 3I55 P;  1U7K A;  2XV6 A;  1K30 A;  1IUQ A;  3CC7 P;  4U0A A;  4E91 A;  2X2D D;  3CCS P;  2Y4Z A;  1EIA A;  1GWP A;  1K9M Q;  1VQO P;  3P05 A;  1M90 Q;  2PEI A;  3H4E A;  2PEN A;  1S72 P;  2M8N A;  4COP A;  1QVF O;  4U0F A;  2WLV B;  2CWO A;  2JYG A;  1KQS O;  4DGA C;  2PY8 A;  3DPH A;  1VQK P;  3CMA P;  2ONT A;  1Q7Y Q;  2OTJ P;  2PWM A;  2QEX P;  2X82 A;  1D1D A;  4GR6 A;  3BP9 A;  3DS5 A;  1VQ9 P;  4LQW C;  4J93 A;  3OW2 O;  4NX4 C;  3H47 A;  5JPA A;  3DS3 A;  2JPR A;  3DTJ A;  3G21 A;  3CCV P;  1K8A Q;  2XGY A;  2M8L A;  2XT1 A;  1RNI A;  2PEQ A;  1W2B O;  5F2K A;  4WYM A;  4U0C A;  4DGE C;  1VQ8 P;  3CD6 P;  4PH2 A;  4PH0 A;  3VRL C;  2XGV A;  3CCL P;  1KD1 Q;  3DS0 A;  3RG6 C;  3M1M A;  1NJI Q;  2JO0 A;  2V4X A;  2JYL A;  1QVG O;  3CCR P;  1M6E X;  5HGN A;  2GON A;  1M74 A;  1RO0 A;  1G03 A;  1EM9 A;  3CCJ P;  1YHQ P;  2WLV A;  1AK4 C;  2DGY A;  3G4S P;  1VQM P;  1VQL P;  4M0I A;  1KC8 Q;  3CME P;  1VQN P;  2EG5 A;  4XFX A;  2XGU A;  2PEJ A;  3CCQ P;  1Q81 Q;  5HGM A;  1VQ7 P;  3H0D A;  1M9F C;  5HGL A;  3B5I A;  1A43 A;  4XRO A;  1YIT P;  2XDE A;  5F2O A;  2XXM A;  3WBH A;  1M6N A;  5HGO A;  4PH3 A;  2EFJ A;  3G1G A;  5BS1 A;  3LRY A;  4U0D A;  3G29 A;  1M1K Q;  2BHV A;  2M8P A;  4INB A;  3NTE A;  1L6N A;  1M9Y C;  2PXR C;  2BUO A;  4E92 A;  4COC A;  5F2N A;  4U0E A;  2QA4 P;  2L6E A;  2P9X A;  5DCK A;  4XFZ A;  1M9X C;  4PH1 A;  1YIJ P;  2E1M A;  2X83 A;  3E2D A;  1M9C C;  2PEK A;  4XFY A;  3DS4 A;  3G71 P;  5BS2 A;  5I4T G;  2KOD A;  3CPW O;  1JJ2 O;  1AUM A;  1M9D C;  2PEO A;  2PEM A;  1Q86 Q;  3CC2 P;  1K73 Q;  2EIA A;  3DS1 A;  3Q20 A;  1N8R Q;  3G26 A;  1YJN P;  1VQ4 P;  1P7N A;  1QRJ A;  1AFV A;  4GR2 A;  1YI2 P;  2LF4 A;  2GOL B;  3CCM P;  2Z45 A;  3HYB A;  2Z46 A;  3G6E P;  1Q82 Q;  1A8O A;  1BAJ A;  3I56 P;  1ZMB A;  3DS2 A;  1YJW P;  1VQ6 P;  2OTL P;  2OAR A;  3CXC O;  1RO2 A;  2PWO A;  3MGE A;  3HZQ A;  1M9E C;  3G28 A;  1E6J P;  4QNB A;  2Z44 A;  3CC4 P;  4U0B A;  3G0V A;  4IPY A;  4B4N A;  1VQP P;  1VQ5 P;  3CCE P;  4XRQ A;  3G1I A;  5HGK A;  3CCU P;  2KGF A;  4HTW A;  1EOQ A;  1YJ9 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...