3MGEA

X-ray structure of hexameric hiv-1 ca
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
204
Chain Sequence
PIVMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSCLSEGATPQDLNCMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein p24
publication title Disulfide Bond Stabilization of the Hexameric Capsomer of Human Immunodeficiency Virus.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
total genus 71
structure length 204
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3mgeA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3mgeA02
1BAJA 4U0AA 2WLVA 2JPRA 1M9DC 4IPYA 1EIAA 5DCKA 3P05A 4PH3A 4XRQA 1EM9A 4COPA 3DS3A 4WYMA 3G0VA 3H4EA 2XGUA 1E6JP 4E91A 1P7NA 4INBA 5I4TG 2M8PA 1D1DA 2PXRC 3DS0A 2GONA 4XROA 2Y4ZA 1AFVA 4XFYA 2JYGA 2BUOA 1AK4C 3G29A 5HGLA 2XT1A 4J93A 4U0DA 1M9YC 4XFXA 2JYLA 1GWPA 2EIAA 2JO0A 2KGFA 2XGVA 1QRJA 4E92A 5HGMA 2LF4A 2V4XA 2M8LA 3BP9A 1M9EC 4QNBA 4PH0A 3G21A 2KODA 3G28A 2X2DD 4U0BA 4B4NA 2GOLB 2PWMA 4DGEC 3DS5A 2XXMA 2XDEA 1M9XC 1A8OA 2M8NA 5JPAA 3DS4A 4PH1A 5HGNA 5HGOA 4NX4C 4U0FA 4COCA 4PH2A 4DGAC 2L6EA 4LQWC 1U7KA 3H47A 2XV6A 2ONTA 3NTEA 2PWOA 1A43A 1M9CC 3MGEA 4XFZA 3VRLC 3G1IA 2X83A 4U0CA 1EOQA 4M0IA 3G26A 1M9FC 4HTWA 3DS1A 2X82A 1AUMA 2XGYA 3DS2A 3G1GA 4U0EA 1L6NA 3DTJA 2WLVB 5HGKA 3LRYA 3DPHA 1G03A
chains in the Genus database with same CATH superfamily
4NEOA 1BAJA 1M9DC 3G71P 2GZIA 5DCKA 1UJZA 4COPA 2LTEA 2QNWA 1UNKA 1NQ4A 1VQNP 2LIWA 2XGUA 1Q82Q 1E0HA 2FQ0A 2KG8A 1K9MQ 2CNRA 1NJIQ 2M8PA 1X3OA 1D1DA 2LOLA 4XROA 2PNGA 2PEOA 2JYGA 4CA3A 2QA4P 2KG9A 1DV5A 2KWLA 5HGLA 2MD9A 2XT1A 1GWPA 2L0QA 1AYIA 2JO0A 3RG2A 2P9XA 3NY7B 2FQ2A 3CMAP 2MR8A 4H2XC 3BP9A 2N5IA 2FACA 4DGEC 4H2WC 2K0YA 5EJDA 1KLPA 1M9XC 1EMVA 1KQSO 5JPAA 2LKIA 3DS4A 2K94A 2Z46A 2BHVA 2KGCA 5HGOA 3U43A 4HKGA 2AF8A 2KW2A 4NX4C 7CEIA 1KC8Q 2JBGA 2K0XA 2FVFA 2K5XA 2VLOA 4DGAC 1Q81Q 1A43A 1VHNA 2KGDA 2VSQA 1YJNP 2FVAA 2L22A 1DNYA 4U0CA 1EOQA 3GZMA 3G26A 2K0DX 1K8AQ 1AUMA 1ZNVA 2JQ4A 2EG5A 4BPHA 1L6NA 3DTJA 3E2DA 2WLVB 2PEMA 2GZJA 2JPRA 2LL8A 3EJDA 4IPYA 2VLNA 4PH3A 3CC7P 2PEKA 1VQPP 2GZGA 2FVEA 1VQLP 3Q20A 1P7NA 4F37A 1VKUA 5I4TG 1RNIA 2MR7A 2PXRC 2LMLA 1F80D 3DS0A 2GONA 3EJBA 1AFVA 2L9FA 2EHTA 1QVGO 3EJEA 4XFXA 3CMEP 3CCQP 2KGFA 1BXIA 5HGMA 1M74A 2MY5A 2KOOA 1YJWP 1YJ9P 3G21A 2X2DD 4U0BA 1HQBA 1W2BO 3DS5A 2XDEA 2KGEA 2L4BA 2AFEA 2N6ZA 2CG5B 4PH1A 5HGNA 1VQ8P 1JJ2O 2FQ1A 1VQ9P 2JB0A 2CQ8A 1IMQA 3GJNA 4COCA 1Q7YQ 3CC4P 2L6EA 3H47A 2XV6A 1ZMBA 2KORA 3NTEA 3MGEA 4XFZA 3RG6C 1KD1Q 1VQ4P 3M1MA 2K2QA 2CGQA 1YITP 2JGPA 5HV8A 5BS1A 4HTWA 3CCJP 3DS1A 2X82A 1GXHA 1M90Q 3DS2A 2KOQA 5F2OA 2K93A 1Z6MA 3G1GA 2DNWA 2LIUA 1YI2P 3H0DA 3DPHA 1G03A 2DGYA 2WLVA 5BS2A 2GDXA 1L0IA 1YIJP 2AVAA 3WBHA 3CCSP 4XRQA 1EM9A 4BPGA 3DS3A 1CEIA 3B5IA 1E6JP 4DG9A 4E91A 5HVCA 1M6NA 3G6EP 2PEJA 2EHSA 4GR6A 3CCRP 3I55P 3GZLA 2BUOA 3G29A 2JU2A 2ROQA 5F2KA 5KP7B 1VQ7P 4U0DA 1M9YC 2WPTA 1AF8A 2GYKA 4UHPB 4E92A 2LF4A 3OW2O 2EFJA 1Q86Q 2KG6A 1M9EC 4QNBA 4PH0A 2OTJP 3G28A 4PXHB 2PWMA 2N5HA 4H2YC 2XXMA 5KP6B 1N8RQ 2KGAA 1VQ5P 2JAZA 1T8KA 3HZQA 1HY8A 1OR5A 4PH2A 3CE7A 2NO8A 1U7KA 2Z45A 2PY8A 2CWOA 2PWOA 1GPJA 3CXCO 3VRLC 2E1MA 4M0IA 2M5RA 3CPWO 2N50A 3HYBA 2N6YA 4QKOA 2XZ1C 3B4QA 2XZ0D 3CCVP 2KR5A 3CCMP 2LPKA 3LMOA 4IZ6A 2GDYA 1RO2A 1MZ8A 4U0AA 1RO0A 2QEXP 1EIAA 2PEQA 3P05A 1IUQA 3CCUP 4WYMA 3G0VA 3H4EA 2MF4A 1K73Q 2OARA 4INBA 5EW5E 2PEIA 4GR2A 2GDWA 1VQ6P 2N98A 5CZDB 1VQOP 2Y4ZA 4XFYA 1AK4C 2MVUA 1K30A 4J93A 2JYLA 2EIAA 3I56P 3CCLP 2KOSA 2X2BA 3CD6P 2GZEA 2XGVA 1QRJA 1S72P 2V4XA 2M8LA 1M1KQ 2ERHA 2JU1A 2VLQA 2Z44A 4BPFA 5KP8B 2FAEA 2KODA 2KOPA 4B4NA 2GOLB 2K92A 5F2NA 2PENA 1A8OA 2M8NA 3GKLC 1IMPA 2VLPA 2OTLP 2FHSC 1GXGA 2GZFA 2MVVA 2FADA 3CCEP 4U0FA 4R0MA 3CC2P 2AFDA 4LQWC 4PWVB 2ONTA 1M9CC 1ACPA 1M6EX 3G1IA 2X83A 4MRTC 1FR2A 1M9FC 3G4SP 2XGYA 1VQKP 1VQMP 4U0EA 1YHQP 1QVFO 1L0HA 5HGKA 3LRYA
chains in the Genus database with same CATH topology
2DGYA 1BAJA 4U0AA 2WLVA 1RO0A 5BS2A 2QEXP 2JPRA 1M9DC 4IPYA 1EIAA 2PEQA 5DCKA 3G71P 1YIJP 3P05A 1IUQA 3CCUP 3WBHA 3CCSP 4PH3A 4XRQA 3CC7P 1EM9A 4COPA 3DS3A 4WYMA 2PEKA 1VQPP 3G0VA 1VQNP 3H4EA 3B5IA 2XGUA 1E6JP 1K73Q 4E91A 1Q82Q 1VQLP 2OARA 3Q20A 1P7NA 4INBA 1M6NA 3G6EP 1K9MQ 5I4TG 2PEIA 1RNIA 4GR2A 1NJIQ 2M8PA 2PEJA 1D1DA 2PXRC 1VQ6P 3DS0A 4GR6A 2GONA 3I55P 3CCRP 4XROA 2PEOA 1VQOP 2Y4ZA 1AFVA 4XFYA 2JYGA 2QA4P 2BUOA 1AK4C 3G29A 1QVGO 5F2KA 1K30A 5HGLA 2XT1A 1VQ7P 4J93A 4U0DA 1M9YC 4XFXA 2JYLA 3CMEP 1GWPA 2EIAA 2JO0A 3I56P 3CCQP 3CCLP 3CD6P 2P9XA 2KGFA 2XGVA 1QRJA 4E92A 1S72P 5HGMA 2LF4A 2V4XA 2M8LA 1M74A 3CMAP 2EFJA 3OW2O 1Q86Q 1M1KQ 1YJWP 1YJ9P 2Z44A 3BP9A 1M9EC 4QNBA 4PH0A 3G21A 2OTJP 2KODA 3G28A 2X2DD 4U0BA 4B4NA 2GOLB 2PWMA 4DGEC 1W2BO 3DS5A 2XXMA 5F2NA 2XDEA 1N8RQ 1M9XC 1KQSO 2PENA 1A8OA 2M8NA 3LRYA 2OTLP 1VQ5P 5JPAA 3DS4A 2Z46A 2BHVA 4PH1A 5HGNA 5HGOA 1VQ8P 1JJ2O 3CCEP 4NX4C 4U0FA 1VQ9P 3HZQA 1KC8Q 4COCA 1Q7YQ 3CC4P 4PH2A 4DGAC 2L6EA 3CC2P 4LQWC 1U7KA 2Z45A 3H47A 2XV6A 2PY8A 1ZMBA 2ONTA 1Q81Q 2CWOA 3NTEA 2PWOA 1A43A 3CXCO 1M9CC 1M6EX 3MGEA 4XFZA 3RG6C 3VRLC 2E1MA 1KD1Q 3G1IA 1YJNP 3M1MA 1VQ4P 2X83A 4U0CA 1EOQA 1YITP 4M0IA 3CPWO 5BS1A 3G26A 1M9FC 4HTWA 3CCJP 3HYBA 3G4SP 1K8AQ 3DS1A 2X82A 1AUMA 2XGYA 1M90Q 3DS2A 1VQKP 5F2OA 3CCVP 3G1GA 2EG5A 3CCMP 1VQMP 4U0EA 1YHQP 1L6NA 3DTJA 3E2DA 1YI2P 1QVFO 2WLVB 3H0DA 5HGKA 2PEMA 1RO2A 3DPHA 1G03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAJ A;  4U0A A;  2WLV A;  2JPR A;  1M9D C;  4IPY A;  1EIA A;  5DCK A;  3P05 A;  4PH3 A;  4XRQ A;  1EM9 A;  4COP A;  3DS3 A;  4WYM A;  3G0V A;  3H4E A;  2XGU A;  1E6J P;  4E91 A;  1P7N A;  4INB A;  5I4T G;  2M8P A;  1D1D A;  2PXR C;  3DS0 A;  2GON A;  4XRO A;  2Y4Z A;  1AFV A;  4XFY A;  2JYG A;  2BUO A;  1AK4 C;  3G29 A;  5HGL A;  2XT1 A;  4J93 A;  4U0D A;  1M9Y C;  4XFX A;  2JYL A;  1GWP A;  2EIA A;  2JO0 A;  2KGF A;  2XGV A;  1QRJ A;  4E92 A;  5HGM A;  2LF4 A;  2V4X A;  2M8L A;  3BP9 A;  1M9E C;  4QNB A;  4PH0 A;  3G21 A;  2KOD A;  3G28 A;  2X2D D;  4U0B A;  4B4N A;  2GOL B;  2PWM A;  4DGE C;  3DS5 A;  2XXM A;  2XDE A;  1M9X C;  1A8O A;  2M8N A;  5JPA A;  3DS4 A;  4PH1 A;  5HGN A;  5HGO A;  4NX4 C;  4U0F A;  4COC A;  4PH2 A;  4DGA C;  2L6E A;  4LQW C;  1U7K A;  3H47 A;  2XV6 A;  2ONT A;  3NTE A;  2PWO A;  1A43 A;  1M9C C;  3MGE A;  4XFZ A;  3VRL C;  3G1I A;  2X83 A;  4U0C A;  1EOQ A;  4M0I A;  3G26 A;  1M9F C;  4HTW A;  3DS1 A;  2X82 A;  1AUM A;  2XGY A;  3DS2 A;  3G1G A;  4U0E A;  1L6N A;  3DTJ A;  2WLV B;  5HGK A;  3LRY A;  3DPH A;  1G03 A; 
#chains in the Genus database with same CATH topology
 4NEO A;  1BAJ A;  1M9D C;  3G71 P;  2GZI A;  5DCK A;  1UJZ A;  4COP A;  2LTE A;  2QNW A;  1UNK A;  1NQ4 A;  1VQN P;  2LIW A;  2XGU A;  1Q82 Q;  1E0H A;  2FQ0 A;  2KG8 A;  1K9M Q;  2CNR A;  1NJI Q;  2M8P A;  1X3O A;  1D1D A;  2LOL A;  4XRO A;  2PNG A;  2PEO A;  2JYG A;  4CA3 A;  2QA4 P;  2KG9 A;  1DV5 A;  2KWL A;  5HGL A;  2MD9 A;  2XT1 A;  1GWP A;  2L0Q A;  1AYI A;  2JO0 A;  3RG2 A;  2P9X A;  3NY7 B;  2FQ2 A;  3CMA P;  2MR8 A;  4H2X C;  3BP9 A;  2N5I A;  2FAC A;  4DGE C;  4H2W C;  2K0Y A;  5EJD A;  1KLP A;  1M9X C;  1EMV A;  1KQS O;  5JPA A;  2LKI A;  3DS4 A;  2K94 A;  2Z46 A;  2BHV A;  2KGC A;  5HGO A;  3U43 A;  4HKG A;  2AF8 A;  2KW2 A;  4NX4 C;  7CEI A;  1KC8 Q;  2JBG A;  2K0X A;  2FVF A;  2K5X A;  2VLO A;  4DGA C;  1Q81 Q;  1A43 A;  1VHN A;  2KGD A;  2VSQ A;  1YJN P;  2FVA A;  2L22 A;  1DNY A;  4U0C A;  1EOQ A;  3GZM A;  3G26 A;  2K0D X;  1K8A Q;  1AUM A;  1ZNV A;  2JQ4 A;  2EG5 A;  4BPH A;  1L6N A;  3DTJ A;  3E2D A;  2WLV B;  2PEM A;  2GZJ A;  2JPR A;  2LL8 A;  3EJD A;  4IPY A;  2VLN A;  4PH3 A;  3CC7 P;  2PEK A;  1VQP P;  2GZG A;  2FVE A;  1VQL P;  3Q20 A;  1P7N A;  4F37 A;  1VKU A;  5I4T G;  1RNI A;  2MR7 A;  2PXR C;  2LML A;  1F80 D;  3DS0 A;  2GON A;  3EJB A;  1AFV A;  2L9F A;  2EHT A;  1QVG O;  3EJE A;  4XFX A;  3CME P;  3CCQ P;  2KGF A;  1BXI A;  5HGM A;  1M74 A;  2MY5 A;  2KOO A;  1YJW P;  1YJ9 P;  3G21 A;  2X2D D;  4U0B A;  1HQB A;  1W2B O;  3DS5 A;  2XDE A;  2KGE A;  2L4B A;  2AFE A;  2N6Z A;  2CG5 B;  4PH1 A;  5HGN A;  1VQ8 P;  1JJ2 O;  2FQ1 A;  1VQ9 P;  2JB0 A;  2CQ8 A;  1IMQ A;  3GJN A;  4COC A;  1Q7Y Q;  3CC4 P;  2L6E A;  3H47 A;  2XV6 A;  1ZMB A;  2KOR A;  3NTE A;  3MGE A;  4XFZ A;  3RG6 C;  1KD1 Q;  1VQ4 P;  3M1M A;  2K2Q A;  2CGQ A;  1YIT P;  2JGP A;  5HV8 A;  5BS1 A;  4HTW A;  3CCJ P;  3DS1 A;  2X82 A;  1GXH A;  1M90 Q;  3DS2 A;  2KOQ A;  5F2O A;  2K93 A;  1Z6M A;  3G1G A;  2DNW A;  2LIU A;  1YI2 P;  3H0D A;  3DPH A;  1G03 A;  2DGY A;  2WLV A;  5BS2 A;  2GDX A;  1L0I A;  1YIJ P;  2AVA A;  3WBH A;  3CCS P;  4XRQ A;  1EM9 A;  4BPG A;  3DS3 A;  1CEI A;  3B5I A;  1E6J P;  4DG9 A;  4E91 A;  5HVC A;  1M6N A;  3G6E P;  2PEJ A;  2EHS A;  4GR6 A;  3CCR P;  3I55 P;  3GZL A;  2BUO A;  3G29 A;  2JU2 A;  2ROQ A;  5F2K A;  5KP7 B;  1VQ7 P;  4U0D A;  1M9Y C;  2WPT A;  1AF8 A;  2GYK A;  4UHP B;  4E92 A;  2LF4 A;  3OW2 O;  2EFJ A;  1Q86 Q;  2KG6 A;  1M9E C;  4QNB A;  4PH0 A;  2OTJ P;  3G28 A;  4PXH B;  2PWM A;  2N5H A;  4H2Y C;  2XXM A;  5KP6 B;  1N8R Q;  2KGA A;  1VQ5 P;  2JAZ A;  1T8K A;  3HZQ A;  1HY8 A;  1OR5 A;  4PH2 A;  3CE7 A;  2NO8 A;  1U7K A;  2Z45 A;  2PY8 A;  2CWO A;  2PWO A;  1GPJ A;  3CXC O;  3VRL C;  2E1M A;  4M0I A;  2M5R A;  3CPW O;  2N50 A;  3HYB A;  2N6Y A;  4QKO A;  2XZ1 C;  3B4Q A;  2XZ0 D;  3CCV P;  2KR5 A;  3CCM P;  2LPK A;  3LMO A;  4IZ6 A;  2GDY A;  1RO2 A;  1MZ8 A;  4U0A A;  1RO0 A;  2QEX P;  1EIA A;  2PEQ A;  3P05 A;  1IUQ A;  3CCU P;  4WYM A;  3G0V A;  3H4E A;  2MF4 A;  1K73 Q;  2OAR A;  4INB A;  5EW5 E;  2PEI A;  4GR2 A;  2GDW A;  1VQ6 P;  2N98 A;  5CZD B;  1VQO P;  2Y4Z A;  4XFY A;  1AK4 C;  2MVU A;  1K30 A;  4J93 A;  2JYL A;  2EIA A;  3I56 P;  3CCL P;  2KOS A;  2X2B A;  3CD6 P;  2GZE A;  2XGV A;  1QRJ A;  1S72 P;  2V4X A;  2M8L A;  1M1K Q;  2ERH A;  2JU1 A;  2VLQ A;  2Z44 A;  4BPF A;  5KP8 B;  2FAE A;  2KOD A;  2KOP A;  4B4N A;  2GOL B;  2K92 A;  5F2N A;  2PEN A;  1A8O A;  2M8N A;  3GKL C;  1IMP A;  2VLP A;  2OTL P;  2FHS C;  1GXG A;  2GZF A;  2MVV A;  2FAD A;  3CCE P;  4U0F A;  4R0M A;  3CC2 P;  2AFD A;  4LQW C;  4PWV B;  2ONT A;  1M9C C;  1ACP A;  1M6E X;  3G1I A;  2X83 A;  4MRT C;  1FR2 A;  1M9F C;  3G4S P;  2XGY A;  1VQK P;  1VQM P;  4U0E A;  1YHQ P;  1QVF O;  1L0H A;  5HGK A;  3LRY A; 
#chains in the Genus database with same CATH homology
 2DGY A;  1BAJ A;  4U0A A;  2WLV A;  1RO0 A;  5BS2 A;  2QEX P;  2JPR A;  1M9D C;  4IPY A;  1EIA A;  2PEQ A;  5DCK A;  3G71 P;  1YIJ P;  3P05 A;  1IUQ A;  3CCU P;  3WBH A;  3CCS P;  4PH3 A;  4XRQ A;  3CC7 P;  1EM9 A;  4COP A;  3DS3 A;  4WYM A;  2PEK A;  1VQP P;  3G0V A;  1VQN P;  3H4E A;  3B5I A;  2XGU A;  1E6J P;  1K73 Q;  4E91 A;  1Q82 Q;  1VQL P;  2OAR A;  3Q20 A;  1P7N A;  4INB A;  1M6N A;  3G6E P;  1K9M Q;  5I4T G;  2PEI A;  1RNI A;  4GR2 A;  1NJI Q;  2M8P A;  2PEJ A;  1D1D A;  2PXR C;  1VQ6 P;  3DS0 A;  4GR6 A;  2GON A;  3I55 P;  3CCR P;  4XRO A;  2PEO A;  1VQO P;  2Y4Z A;  1AFV A;  4XFY A;  2JYG A;  2QA4 P;  2BUO A;  1AK4 C;  3G29 A;  1QVG O;  5F2K A;  1K30 A;  5HGL A;  2XT1 A;  1VQ7 P;  4J93 A;  4U0D A;  1M9Y C;  4XFX A;  2JYL A;  3CME P;  1GWP A;  2EIA A;  2JO0 A;  3I56 P;  3CCQ P;  3CCL P;  3CD6 P;  2P9X A;  2KGF A;  2XGV A;  1QRJ A;  4E92 A;  1S72 P;  5HGM A;  2LF4 A;  2V4X A;  2M8L A;  1M74 A;  3CMA P;  2EFJ A;  3OW2 O;  1Q86 Q;  1M1K Q;  1YJW P;  1YJ9 P;  2Z44 A;  3BP9 A;  1M9E C;  4QNB A;  4PH0 A;  3G21 A;  2OTJ P;  2KOD A;  3G28 A;  2X2D D;  4U0B A;  4B4N A;  2GOL B;  2PWM A;  4DGE C;  1W2B O;  3DS5 A;  2XXM A;  5F2N A;  2XDE A;  1N8R Q;  1M9X C;  1KQS O;  2PEN A;  1A8O A;  2M8N A;  3LRY A;  2OTL P;  1VQ5 P;  5JPA A;  3DS4 A;  2Z46 A;  2BHV A;  4PH1 A;  5HGN A;  5HGO A;  1VQ8 P;  1JJ2 O;  3CCE P;  4NX4 C;  4U0F A;  1VQ9 P;  3HZQ A;  1KC8 Q;  4COC A;  1Q7Y Q;  3CC4 P;  4PH2 A;  4DGA C;  2L6E A;  3CC2 P;  4LQW C;  1U7K A;  2Z45 A;  3H47 A;  2XV6 A;  2PY8 A;  1ZMB A;  2ONT A;  1Q81 Q;  2CWO A;  3NTE A;  2PWO A;  1A43 A;  3CXC O;  1M9C C;  1M6E X;  3MGE A;  4XFZ A;  3RG6 C;  3VRL C;  2E1M A;  1KD1 Q;  3G1I A;  1YJN P;  3M1M A;  1VQ4 P;  2X83 A;  4U0C A;  1EOQ A;  1YIT P;  4M0I A;  3CPW O;  5BS1 A;  3G26 A;  1M9F C;  4HTW A;  3CCJ P;  3HYB A;  3G4S P;  1K8A Q;  3DS1 A;  2X82 A;  1AUM A;  2XGY A;  1M90 Q;  3DS2 A;  1VQK P;  5F2O A;  3CCV P;  3G1G A;  2EG5 A;  3CCM P;  1VQM P;  4U0E A;  1YHQ P;  1L6N A;  3DTJ A;  3E2D A;  1YI2 P;  1QVF O;  2WLV B;  3H0D A;  5HGK A;  2PEM A;  1RO2 A;  3DPH A;  1G03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...