3MGEA

X-ray structure of hexameric hiv-1 ca
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
204
Chain Sequence
PIVMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSCLSEGATPQDLNCMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disulfide Bond Stabilization of the Hexameric Capsomer of Human Immunodeficiency Virus.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 71
structure length 204
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3mgeA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3mgeA02
2XGUA 4J93A 3DS0A 2GOLB 2ONTA 3MGEA 1M9FC 1GWPA 2XGVA 1AFVA 1EIAA 4M0IA 4DGAC 1M9EC 3DTJA 4E92A 3DS4A 1G03A 3H4EA 3G28A 3P05A 4U0FA 4U0EA 4WYMA 5HGLA 1E6JP 4HTWA 1M9YC 2L6EA 3DS1A 2PWOA 4COCA 4XRQA 2XDEA 3VRLC 2Y4ZA 4PH0A 5DCKA 2PWMA 2JYLA 4E91A 3G26A 2BUOA 1M9CC 1BAJA 3DS3A 2M8NA 3G21A 1A8OA 2WLVB 1AK4C 4XFZA 1U7KA 2XV6A 4LQWC 2WLVA 2EIAA 4B4NA 4IPYA 4XFYA 2V4XA 4NX4C 4XFXA 4U0AA 2JPRA 2X2DD 1L6NA 1P7NA 2M8PA 4U0DA 1A43A 1M9XC 1EOQA 4QNBA 3H47A 4PH2A 3G29A 3G1GA 4U0BA 3G1IA 4PH3A 2KGFA 1AUMA 3DS2A 5HGKA 3DPHA 2PXRC 5HGMA 5HGNA 2LF4A 2X82A 3LRYA 2XXMA 4PH1A 3BP9A 4U0CA 3G0VA 5JPAA 2X83A 4COPA 1QRJA 4DGEC 2JYGA 2KODA 1D1DA 3NTEA 4INBA 2XGYA 2M8LA 5HGOA 3DS5A 2GONA 2XT1A 5I4TG 4XROA 1M9DC 1EM9A 2JO0A
chains in the Genus database with same CATH superfamily
5HVCA 3RG2A 2XGUA 1M1KQ 3CCJP 4J93A 3DS0A 2GOLB 2ONTA 1GWPA 1EIAA 2K0DX 4DGAC 4H2XC 4F37A 2JQ4A 1QVFO 2KGCA 2VLOA 3DS4A 2AFEA 2KGDA 2OTLP 2FQ0A 2L0QA 4HTWA 2FVAA 2K92A 2PWOA 4COCA 3HZQA 4UHPB 2N5HA 2VSQA 1YHQP 3VRLC 1KQSO 3I55P 2KG6A 4PH0A 5DCKA 3CCRP 1BXIA 1L0IA 1UJZA 1YJNP 2M8NA 1FR2A 1KLPA 1AK4C 1U7KA 2XV6A 2EIAA 3CC4P 1Z6MA 2QEXP 1NJIQ 2V4XA 3GKLC 4NX4C 2LKIA 2M5RA 4U0AA 1L0HA 2OTJP 4CA3A 1DV5A 5CZDB 2JGPA 2QA4P 2AF8A 2MD9A 2GZJA 3G1IA 4PH3A 2FHSC 2JU2A 1VQOP 2KGFA 1AUMA 2LTEA 3CCUP 3DPHA 2K0XA 1OR5A 2MF4A 2CNRA 2LL8A 2PY8A 3BP9A 3RG6C 2CGQA 2X83A 1QRJA 4QKOA 2GYKA 5BS1A 5KP8B 1KC8Q 4MRTC 2AVAA 3CE7A 2MR8A 2GONA 1MZ8A 2XT1A 5I4TG 4XROA 2DGYA 1M90Q 1ACPA 1VQNP 2AFDA 1IUQA 3MGEA 1M9FC 2XGVA 5F2OA 2P9XA 2KOPA 3H4EA 4U0FA 1JJ2O 2ROQA 1E6JP 3DS1A 2N98A 2GDWA 2Y4ZA 1QVGO 3CD6P 2PNGA 3DS3A 1VQMP 3G21A 2DNWA 4XFZA 2JB0A 4LQWC 2LIUA 1NQ4A 3EJBA 1VQKP 4DG9A 2KG9A 4GR6A 1VQ7P 1GXHA 1YIJP 2Z44A 1K9MQ 1L6NA 2M8PA 4U0DA 2VLPA 3Q20A 2XZ0D 3H47A 2PEMA 2NO8A 2XZ1C 4PXHB 5BS2A 3M1MA 2PEKA 1VQ8P 2VLQA 2CG5B 5HGKA 2KOOA 2FQ2A 5HGMA 2LF4A 3I56P 3LMOA 4PH1A 1VQLP 4U0CA 2MR7A 5JPAA 2GZFA 2KODA 5HV8A 1RO2A 4INBA 2WPTA 2M8LA 1YJWP 2FAEA 3DS5A 2KORA 2KOQA 5F2KA 1EM9A 2QNWA 4H2WC 1VKUA 1ZMBA 3HYBA 3U43A 2FVEA 3EJDA 1S72P 2N50A 3G71P 1M74A 3EJEA 2ERHA 1G03A 3G28A 2BHVA 3P05A 4U0EA 1RO0A 2KWLA 5HGLA 2MVUA 1VQ6P 1M9YC 2GZGA 3OW2O 4XRQA 2KG8A 3B4QA 2XDEA 2JU1A 1F80D 4R0MA 2PWMA 1VQPP 3G6EP 2JYLA 3G26A 2PEIA 2WLVB 1N8RQ 4HKGA 3H0DA 4B4NA 4IPYA 1HQBA 3CCMP 2KW2A 3CMAP 1GXGA 2PENA 3CCQP 5KP7B 2JPRA 3CC7P 1A43A 1M9XC 4BPHA 4QNBA 2MY5A 3CMEP 2Z45A 4PH2A 2K0YA 2PEQA 3G1GA 4IZ6A 2N6ZA 3NY7B 2L22A 1X3OA 5HGNA 2JBGA 1EMVA 1Q82Q 2LMLA 1K73Q 2X82A 1K8AQ 2Z46A 1HY8A 2GDXA 3GJNA 2N6YA 2GDYA 4COPA 4DGEC 2LPKA 2JYGA 1D1DA 1VQ4P 1VQ5P 2K5XA 5F2NA 3CCVP 1YI2P 3GZMA 2CQ8A 4NEOA 1E0HA 5EW5E 2MVVA 4BPGA 2LIWA 1YITP 2KGAA 2LOLA 4BPFA 1AFVA 4M0IA 1M9EC 3DTJA 4E92A 2K2QA 2PEOA 3G4SP 3CPWO 1YJ9P 2GZIA 4WYMA 2K94A 1W2BO 2L6EA 2FADA 2JAZA 2N5IA 1RNIA 1IMQA 1DNYA 1T8KA 1KD1Q 1CEIA 1GPJA 4E91A 2BUOA 1M9CC 2EG5A 1BAJA 2FACA 1M6NA 5EJDA 2EFJA 1A8OA 1Q81Q 2K93A 7CEIA 2WLVA 1Q86Q 2PEJA 1K30A 3CCSP 1IMPA 1M6EX 1AYIA 3CCLP 5KP6B 4XFYA 4XFXA 3CCEP 4GR2A 2X2DD 1P7NA 2KGEA 2E1MA 1EOQA 3WBHA 3GZLA 2CWOA 2VLNA 2KR5A 3G29A 2FVFA 4U0BA 2X2BA 2L9FA 3DS2A 2KOSA 2PXRC 4H2YC 2OARA 3LRYA 2XXMA 3CXCO 2FQ1A 2EHTA 1VQ9P 1VHNA 3B5IA 1UNKA 3G0VA 3CC2P 4PWVB 3NTEA 2L4BA 3E2DA 2XGYA 5HGOA 2EHSA 1ZNVA 1AF8A 1M9DC 1Q7YQ 2JO0A 2GZEA
chains in the Genus database with same CATH topology
1ZMBA 2XGUA 3HYBA 1YITP 1VQNP 1M1KQ 3CCJP 4J93A 3DS0A 2GOLB 1IUQA 2ONTA 3MGEA 1M9FC 1S72P 1GWPA 2XGVA 1AFVA 1EIAA 5F2OA 4M0IA 4DGAC 3G71P 1M9EC 3DTJA 1M74A 2P9XA 4E92A 1QVFO 3DS4A 1G03A 2PEOA 3H4EA 3G28A 3G4SP 3CPWO 1YJ9P 2BHVA 3P05A 4U0FA 4U0EA 4WYMA 1JJ2O 1RO0A 2OTLP 5HGLA 1W2BO 1VQ6P 1E6JP 4HTWA 1M9YC 2L6EA 3DS1A 2PWOA 4COCA 3HZQA 3OW2O 4XRQA 2XDEA 1RNIA 1YHQP 3VRLC 1KQSO 3I55P 2Y4ZA 4PH0A 1QVGO 3CD6P 5DCKA 2PWMA 3CCRP 3G6EP 1VQPP 1KD1Q 2JYLA 4E91A 3G26A 2BUOA 1M9CC 2EG5A 2PEIA 1YJNP 1BAJA 3DS3A 2M8NA 1VQMP 1M6NA 3G21A 2EFJA 1A8OA 2WLVB 1Q81Q 1AK4C 4XFZA 1U7KA 2XV6A 4LQWC 1N8RQ 2WLVA 2EIAA 1Q86Q 1VQKP 3CC4P 2PEJA 4B4NA 4IPYA 3H0DA 1K30A 3CCSP 3CCMP 4GR6A 1M6EX 2QEXP 1NJIQ 1VQ7P 3CCLP 3CMAP 4XFYA 2V4XA 2PENA 3CCQP 1YIJP 4NX4C 2Z44A 4XFXA 3CCEP 1K9MQ 4GR2A 4U0AA 2JPRA 2X2DD 1L6NA 3CC7P 1P7NA 2M8PA 4U0DA 1A43A 1M9XC 2E1MA 3Q20A 2OTJP 1EOQA 3WBHA 2CWOA 4QNBA 3H47A 2PEMA 3CMEP 2QA4P 2Z45A 4PH2A 3G29A 2PEQA 3G1GA 4U0BA 5BS2A 3M1MA 3G1IA 2PEKA 1VQ8P 4PH3A 1VQOP 2KGFA 1AUMA 3DS2A 5HGKA 3CCUP 3DPHA 2PXRC 5HGMA 5HGNA 2LF4A 1Q82Q 3I56P 1K73Q 2X82A 2PY8A 2OARA 1K8AQ 2Z46A 3LRYA 2XXMA 4PH1A 3CXCO 3BP9A 1VQLP 3RG6C 4U0CA 1VQ9P 3B5IA 3G0VA 5JPAA 2X83A 4COPA 1QRJA 4DGEC 2JYGA 3CC2P 2KODA 1D1DA 3NTEA 1RO2A 4INBA 3E2DA 2XGYA 2M8LA 5HGOA 1VQ5P 5BS1A 1YJWP 1VQ4P 3DS5A 1KC8Q 5F2NA 3CCVP 1YI2P 2GONA 2XT1A 5F2KA 4XROA 1M9DC 1EM9A 2DGYA 5I4TG 1M90Q 1Q7YQ 2JO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGU A;  4J93 A;  3DS0 A;  2GOL B;  2ONT A;  3MGE A;  1M9F C;  1GWP A;  2XGV A;  1AFV A;  1EIA A;  4M0I A;  4DGA C;  1M9E C;  3DTJ A;  4E92 A;  3DS4 A;  1G03 A;  3H4E A;  3G28 A;  3P05 A;  4U0F A;  4U0E A;  4WYM A;  5HGL A;  1E6J P;  4HTW A;  1M9Y C;  2L6E A;  3DS1 A;  2PWO A;  4COC A;  4XRQ A;  2XDE A;  3VRL C;  2Y4Z A;  4PH0 A;  5DCK A;  2PWM A;  2JYL A;  4E91 A;  3G26 A;  2BUO A;  1M9C C;  1BAJ A;  3DS3 A;  2M8N A;  3G21 A;  1A8O A;  2WLV B;  1AK4 C;  4XFZ A;  1U7K A;  2XV6 A;  4LQW C;  2WLV A;  2EIA A;  4B4N A;  4IPY A;  4XFY A;  2V4X A;  4NX4 C;  4XFX A;  4U0A A;  2JPR A;  2X2D D;  1L6N A;  1P7N A;  2M8P A;  4U0D A;  1A43 A;  1M9X C;  1EOQ A;  4QNB A;  3H47 A;  4PH2 A;  3G29 A;  3G1G A;  4U0B A;  3G1I A;  4PH3 A;  2KGF A;  1AUM A;  3DS2 A;  5HGK A;  3DPH A;  2PXR C;  5HGM A;  5HGN A;  2LF4 A;  2X82 A;  3LRY A;  2XXM A;  4PH1 A;  3BP9 A;  4U0C A;  3G0V A;  5JPA A;  2X83 A;  4COP A;  1QRJ A;  4DGE C;  2JYG A;  2KOD A;  1D1D A;  3NTE A;  4INB A;  2XGY A;  2M8L A;  5HGO A;  3DS5 A;  2GON A;  2XT1 A;  5I4T G;  4XRO A;  1M9D C;  1EM9 A;  2JO0 A; 
#chains in the Genus database with same CATH topology
 5HVC A;  3RG2 A;  2XGU A;  1M1K Q;  3CCJ P;  4J93 A;  3DS0 A;  2GOL B;  2ONT A;  1GWP A;  1EIA A;  2K0D X;  4DGA C;  4H2X C;  4F37 A;  2JQ4 A;  1QVF O;  2KGC A;  2VLO A;  3DS4 A;  2AFE A;  2KGD A;  2OTL P;  2FQ0 A;  2L0Q A;  4HTW A;  2FVA A;  2K92 A;  2PWO A;  4COC A;  3HZQ A;  4UHP B;  2N5H A;  2VSQ A;  1YHQ P;  3VRL C;  1KQS O;  3I55 P;  2KG6 A;  4PH0 A;  5DCK A;  3CCR P;  1BXI A;  1L0I A;  1UJZ A;  1YJN P;  2M8N A;  1FR2 A;  1KLP A;  1AK4 C;  1U7K A;  2XV6 A;  2EIA A;  3CC4 P;  1Z6M A;  2QEX P;  1NJI Q;  2V4X A;  3GKL C;  4NX4 C;  2LKI A;  2M5R A;  4U0A A;  1L0H A;  2OTJ P;  4CA3 A;  1DV5 A;  5CZD B;  2JGP A;  2QA4 P;  2AF8 A;  2MD9 A;  2GZJ A;  3G1I A;  4PH3 A;  2FHS C;  2JU2 A;  1VQO P;  2KGF A;  1AUM A;  2LTE A;  3CCU P;  3DPH A;  2K0X A;  1OR5 A;  2MF4 A;  2CNR A;  2LL8 A;  2PY8 A;  3BP9 A;  3RG6 C;  2CGQ A;  2X83 A;  1QRJ A;  4QKO A;  2GYK A;  5BS1 A;  5KP8 B;  1KC8 Q;  4MRT C;  2AVA A;  3CE7 A;  2MR8 A;  2GON A;  1MZ8 A;  2XT1 A;  5I4T G;  4XRO A;  2DGY A;  1M90 Q;  1ACP A;  1VQN P;  2AFD A;  1IUQ A;  3MGE A;  1M9F C;  2XGV A;  5F2O A;  2P9X A;  2KOP A;  3H4E A;  4U0F A;  1JJ2 O;  2ROQ A;  1E6J P;  3DS1 A;  2N98 A;  2GDW A;  2Y4Z A;  1QVG O;  3CD6 P;  2PNG A;  3DS3 A;  1VQM P;  3G21 A;  2DNW A;  4XFZ A;  2JB0 A;  4LQW C;  2LIU A;  1NQ4 A;  3EJB A;  1VQK P;  4DG9 A;  2KG9 A;  4GR6 A;  1VQ7 P;  1GXH A;  1YIJ P;  2Z44 A;  1K9M Q;  1L6N A;  2M8P A;  4U0D A;  2VLP A;  3Q20 A;  2XZ0 D;  3H47 A;  2PEM A;  2NO8 A;  2XZ1 C;  4PXH B;  5BS2 A;  3M1M A;  2PEK A;  1VQ8 P;  2VLQ A;  2CG5 B;  5HGK A;  2KOO A;  2FQ2 A;  5HGM A;  2LF4 A;  3I56 P;  3LMO A;  4PH1 A;  1VQL P;  4U0C A;  2MR7 A;  5JPA A;  2GZF A;  2KOD A;  5HV8 A;  1RO2 A;  4INB A;  2WPT A;  2M8L A;  1YJW P;  2FAE A;  3DS5 A;  2KOR A;  2KOQ A;  5F2K A;  1EM9 A;  2QNW A;  4H2W C;  1VKU A;  1ZMB A;  3HYB A;  3U43 A;  2FVE A;  3EJD A;  1S72 P;  2N50 A;  3G71 P;  1M74 A;  3EJE A;  2ERH A;  1G03 A;  3G28 A;  2BHV A;  3P05 A;  4U0E A;  1RO0 A;  2KWL A;  5HGL A;  2MVU A;  1VQ6 P;  1M9Y C;  2GZG A;  3OW2 O;  4XRQ A;  2KG8 A;  3B4Q A;  2XDE A;  2JU1 A;  1F80 D;  4R0M A;  2PWM A;  1VQP P;  3G6E P;  2JYL A;  3G26 A;  2PEI A;  2WLV B;  1N8R Q;  4HKG A;  3H0D A;  4B4N A;  4IPY A;  1HQB A;  3CCM P;  2KW2 A;  3CMA P;  1GXG A;  2PEN A;  3CCQ P;  5KP7 B;  2JPR A;  3CC7 P;  1A43 A;  1M9X C;  4BPH A;  4QNB A;  2MY5 A;  3CME P;  2Z45 A;  4PH2 A;  2K0Y A;  2PEQ A;  3G1G A;  4IZ6 A;  2N6Z A;  3NY7 B;  2L22 A;  1X3O A;  5HGN A;  2JBG A;  1EMV A;  1Q82 Q;  2LML A;  1K73 Q;  2X82 A;  1K8A Q;  2Z46 A;  1HY8 A;  2GDX A;  3GJN A;  2N6Y A;  2GDY A;  4COP A;  4DGE C;  2LPK A;  2JYG A;  1D1D A;  1VQ4 P;  1VQ5 P;  2K5X A;  5F2N A;  3CCV P;  1YI2 P;  3GZM A;  2CQ8 A;  4NEO A;  1E0H A;  5EW5 E;  2MVV A;  4BPG A;  2LIW A;  1YIT P;  2KGA A;  2LOL A;  4BPF A;  1AFV A;  4M0I A;  1M9E C;  3DTJ A;  4E92 A;  2K2Q A;  2PEO A;  3G4S P;  3CPW O;  1YJ9 P;  2GZI A;  4WYM A;  2K94 A;  1W2B O;  2L6E A;  2FAD A;  2JAZ A;  2N5I A;  1RNI A;  1IMQ A;  1DNY A;  1T8K A;  1KD1 Q;  1CEI A;  1GPJ A;  4E91 A;  2BUO A;  1M9C C;  2EG5 A;  1BAJ A;  2FAC A;  1M6N A;  5EJD A;  2EFJ A;  1A8O A;  1Q81 Q;  2K93 A;  7CEI A;  2WLV A;  1Q86 Q;  2PEJ A;  1K30 A;  3CCS P;  1IMP A;  1M6E X;  1AYI A;  3CCL P;  5KP6 B;  4XFY A;  4XFX A;  3CCE P;  4GR2 A;  2X2D D;  1P7N A;  2KGE A;  2E1M A;  1EOQ A;  3WBH A;  3GZL A;  2CWO A;  2VLN A;  2KR5 A;  3G29 A;  2FVF A;  4U0B A;  2X2B A;  2L9F A;  3DS2 A;  2KOS A;  2PXR C;  4H2Y C;  2OAR A;  3LRY A;  2XXM A;  3CXC O;  2FQ1 A;  2EHT A;  1VQ9 P;  1VHN A;  3B5I A;  1UNK A;  3G0V A;  3CC2 P;  4PWV B;  3NTE A;  2L4B A;  3E2D A;  2XGY A;  5HGO A;  2EHS A;  1ZNV A;  1AF8 A;  1M9D C;  1Q7Y Q;  2JO0 A;  2GZE A; 
#chains in the Genus database with same CATH homology
 1ZMB A;  2XGU A;  3HYB A;  1YIT P;  1VQN P;  1M1K Q;  3CCJ P;  4J93 A;  3DS0 A;  2GOL B;  1IUQ A;  2ONT A;  3MGE A;  1M9F C;  1S72 P;  1GWP A;  2XGV A;  1AFV A;  1EIA A;  5F2O A;  4M0I A;  4DGA C;  3G71 P;  1M9E C;  3DTJ A;  1M74 A;  2P9X A;  4E92 A;  1QVF O;  3DS4 A;  1G03 A;  2PEO A;  3H4E A;  3G28 A;  3G4S P;  3CPW O;  1YJ9 P;  2BHV A;  3P05 A;  4U0F A;  4U0E A;  4WYM A;  1JJ2 O;  1RO0 A;  2OTL P;  5HGL A;  1W2B O;  1VQ6 P;  1E6J P;  4HTW A;  1M9Y C;  2L6E A;  3DS1 A;  2PWO A;  4COC A;  3HZQ A;  3OW2 O;  4XRQ A;  2XDE A;  1RNI A;  1YHQ P;  3VRL C;  1KQS O;  3I55 P;  2Y4Z A;  4PH0 A;  1QVG O;  3CD6 P;  5DCK A;  2PWM A;  3CCR P;  3G6E P;  1VQP P;  1KD1 Q;  2JYL A;  4E91 A;  3G26 A;  2BUO A;  1M9C C;  2EG5 A;  2PEI A;  1YJN P;  1BAJ A;  3DS3 A;  2M8N A;  1VQM P;  1M6N A;  3G21 A;  2EFJ A;  1A8O A;  2WLV B;  1Q81 Q;  1AK4 C;  4XFZ A;  1U7K A;  2XV6 A;  4LQW C;  1N8R Q;  2WLV A;  2EIA A;  1Q86 Q;  1VQK P;  3CC4 P;  2PEJ A;  4B4N A;  4IPY A;  3H0D A;  1K30 A;  3CCS P;  3CCM P;  4GR6 A;  1M6E X;  2QEX P;  1NJI Q;  1VQ7 P;  3CCL P;  3CMA P;  4XFY A;  2V4X A;  2PEN A;  3CCQ P;  1YIJ P;  4NX4 C;  2Z44 A;  4XFX A;  3CCE P;  1K9M Q;  4GR2 A;  4U0A A;  2JPR A;  2X2D D;  1L6N A;  3CC7 P;  1P7N A;  2M8P A;  4U0D A;  1A43 A;  1M9X C;  2E1M A;  3Q20 A;  2OTJ P;  1EOQ A;  3WBH A;  2CWO A;  4QNB A;  3H47 A;  2PEM A;  3CME P;  2QA4 P;  2Z45 A;  4PH2 A;  3G29 A;  2PEQ A;  3G1G A;  4U0B A;  5BS2 A;  3M1M A;  3G1I A;  2PEK A;  1VQ8 P;  4PH3 A;  1VQO P;  2KGF A;  1AUM A;  3DS2 A;  5HGK A;  3CCU P;  3DPH A;  2PXR C;  5HGM A;  5HGN A;  2LF4 A;  1Q82 Q;  3I56 P;  1K73 Q;  2X82 A;  2PY8 A;  2OAR A;  1K8A Q;  2Z46 A;  3LRY A;  2XXM A;  4PH1 A;  3CXC O;  3BP9 A;  1VQL P;  3RG6 C;  4U0C A;  1VQ9 P;  3B5I A;  3G0V A;  5JPA A;  2X83 A;  4COP A;  1QRJ A;  4DGE C;  2JYG A;  3CC2 P;  2KOD A;  1D1D A;  3NTE A;  1RO2 A;  4INB A;  3E2D A;  2XGY A;  2M8L A;  5HGO A;  1VQ5 P;  5BS1 A;  1YJW P;  1VQ4 P;  3DS5 A;  1KC8 Q;  5F2N A;  3CCV P;  1YI2 P;  2GON A;  2XT1 A;  5F2K A;  4XRO A;  1M9D C;  1EM9 A;  2DGY A;  5I4T G;  1M90 Q;  1Q7Y Q;  2JO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...