3MGEA

X-ray structure of hexameric hiv-1 ca
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
204
Chain Sequence
b'PIVMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSCLSEGATPQDLNCMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Disulfide Bond Stabilization of the Hexameric Capsomer of Human Immunodeficiency Virus.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 71
structure length 204
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3mgeA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3mgeA02
4COPA 2XXMA 3MGEA 4M0IA 2XT1A 5HGLA 3DS5A 4IPYA 2EIAA 4U0CA 2XGYA 1M9EC 3G1IA 4PH2A 2KGFA 2JYLA 2X83A 4DGEC 2BUOA 4PH0A 1P7NA 2XV6A 3H4EA 5HGOA 1L6NA 1M9CC 1AK4C 2WLVA 4INBA 2PWMA 4U0FA 3DS1A 1EOQA 1QRJA 5JPAA 3G28A 2XDEA 5HGMA 1M9YC 4XRQA 5HGNA 2M8NA 3DS4A 2LF4A 4HTWA 4J93A 1AUMA 1AFVA 2M8LA 1G03A 4COCA 2M8PA 2V4XA 2X2DD 3H47A 5DCKA 1E6JP 4U0BA 3DS2A 2L6EA 2XGUA 4U0AA 3VRLC 3G29A 5I4TG 4NX4C 1EIAA 4PH3A 4E92A 3G21A 2ONTA 1EM9A 4XFXA 4U0EA 2JO0A 4DGAC 4U0DA 2KODA 3G1GA 3NTEA 2PWOA 2JYGA 3LRYA 1A8OA 1GWPA 2WLVB 3DS0A 1BAJA 1D1DA 2GONA 4B4NA 3G26A 3BP9A 1M9XC 3G0VA 4XFZA 3DTJA 1A43A 5HGKA 3P05A 1M9DC 4XROA 3DS3A 2GOLB 3DPHA 4WYMA 4XFYA 2JPRA 4QNBA 2Y4ZA 4PH1A 1U7KA 4E91A 2PXRC 2X82A 4LQWC 1M9FC 2XGVA
chains in the Genus database with same CATH superfamily
2XXMA 2VLOA 3CCMP 2GDXA 4U0CA 1QVFO 3B5IA 1RO0A 2QNWA 2WPTA 1YHQP 4PH2A 2X83A 2LL8A 3OW2O 1N8RQ 1ACPA 2LKIA 2KR5A 4HKGA 1Q82Q 2MY5A 2PWMA 3EJEA 3DS1A 1EOQA 2L4BA 1L0HA 2N98A 1M9YC 2GDYA 1EMVA 3CC2P 2LF4A 2LPKA 2CNRA 4HTWA 2M8LA 3HYBA 1VQNP 2FADA 2V4XA 2PEJA 3CCLP 1VKUA 2PEIA 2K5XA 4U0BA 2JQ4A 3VRLC 1HQBA 2VLNA 3CMAP 3I55P 2ONTA 2JU1A 3G6EP 3GZMA 4BPHA 2DNWA 1BXIA 1IMQA 2MVUA 2PWOA 2KW2A 2XZ1C 2JYGA 7CEIA 4H2XC 2PNGA 2PEMA 2EHSA 3BP9A 1M74A 2DGYA 1FR2A 4XFZA 3DTJA 2EHTA 1A43A 5HGKA 3G71P 1M9DC 3GKLC 2GZFA 2JGPA 2GZJA 2GZGA 1S72P 2PEQA 1U7KA 4E91A 1Q7YQ 1M6EX 2PENA 1RO2A 2FQ0A 3WBHA 5HGLA 2K0XA 3DS5A 4IPYA 1VQ8P 3G1IA 2FAEA 1AYIA 2L22A 2GYKA 3HZQA 4PH0A 1P7NA 2JB0A 3H4EA 2E1MA 5F2KA 2VSQA 1QVGO 2WLVA 4INBA 2CG5B 1VQ6P 1VQ5P 1IUQA 2FVEA 1QRJA 3U43A 5JPAA 2KWLA 1VQLP 3CXCO 5HGMA 5HGNA 2K2QA 2M8NA 2MR8A 3CCEP 1AUMA 1G03A 3CPWO 4COCA 2M8PA 3CC7P 3H0DA 2Z45A 5DCKA 1E0HA 1K73Q 2GDWA 3GZLA 3DS2A 2XGUA 2PEKA 5I4TG 4PXHB 4PH3A 5F2NA 4QKOA 4DG9A 2JU2A 3G21A 2KG8A 2LOLA 2M5RA 5BS2A 5HV8A 1T8KA 2N5HA 3CCRP 1F80D 4U0DA 2KODA 2LIUA 3NTEA 4GR2A 1KQSO 1A8OA 2K94A 4BPFA 2WLVB 1UNKA 3DS0A 1BAJA 2N50A 1VQ7P 3G26A 3CC4P 1X3OA 2PY8A 2JAZA 4IZ6A 3P05A 1MZ8A 2KGAA 5HVCA 1NQ4A 2GOLB 3DPHA 3EJBA 3CCJP 2MD9A 2JPRA 4H2YC 4PH1A 3CE7A 2X82A 4LQWC 4CA3A 2XGVA 2BHVA 4COPA 3MGEA 1ZMBA 2EIAA 4R0MA 2XGYA 2KORA 3RG2A 2KGCA 1K8AQ 3CCSP 1JJ2O 3E2DA 2ROQA 1K9MQ 1UJZA 2XV6A 2FACA 3GJNA 4NEOA 1M9CC 1AK4C 5KP8B 2EFJA 5EW5E 2CQ8A 3G28A 4XRQA 2K93A 2FQ1A 2VLPA 3DS4A 1VQ9P 2QEXP 1YJWP 2X2BA 2KG6A 2Z46A 1DV5A 4J93A 1K30A 2NO8A 2AFEA 3B4QA 2X2DD 3CCVP 2MVVA 2FHSC 5EJDA 1Q81Q 3CD6P 4U0AA 2Z44A 2K0YA 1KD1Q 4E92A 1EM9A 3G4SP 4XFXA 1VQPP 1YJ9P 5BS1A 1VQKP 2JO0A 1M1KQ 3CCUP 3G1GA 2QA4P 1Q86Q 1YI2P 2MR7A 3NY7B 4BPGA 1GWPA 4H2WC 2LMLA 1GXHA 2KOQA 2JBGA 2GONA 4B4NA 1M6NA 2CGQA 1M9XC 1KLPA 2KOPA 3LMOA 5KP7B 3G0VA 4XROA 1NJIQ 2GZIA 3DS3A 3M1MA 1CEIA 1OR5A 2AVAA 2OARA 2Y4ZA 3Q20A 1M90Q 2EG5A 1VQMP 2LTEA 2K92A 1W2BO 2L0QA 2VLQA 4M0IA 1VHNA 4F37A 2XT1A 1GXGA 4MRTC 1VQ4P 1M9EC 2FVFA 2LIWA 2KGFA 2JYLA 4DGEC 2BUOA 1YIJP 2PEOA 2L9FA 5HGOA 2N5IA 1L6NA 2KOSA 2MF4A 1HY8A 2XZ0D 4U0FA 2GZEA 3CCQP 2P9XA 1Z6MA 2XDEA 4PWVB 2AF8A 2KGDA 2FQ2A 3EJDA 1RNIA 3I56P 1AFVA 1L0IA 2OTLP 3CMEP 1IMPA 3H47A 5CZDB 1E6JP 2L6EA 1ZNVA 3G29A 1YJNP 4NX4C 1EIAA 2N6ZA 1KC8Q 4UHPB 1AF8A 1DNYA 4U0EA 2ERHA 4DGAC 2OTJP 2CWOA 2N6YA 1VQOP 3LRYA 1D1DA 5KP6B 2KGEA 2KOOA 5F2OA 4WYMA 3RG6C 2KG9A 4GR6A 1GPJA 4XFYA 4QNBA 2AFDA 2PXRC 1M9FC 2FVAA 1YITP 2K0DX
chains in the Genus database with same CATH topology
2BHVA 1RO2A 2XXMA 4COPA 3MGEA 4M0IA 3WBHA 2XT1A 5HGLA 1ZMBA 3DS5A 4IPYA 2EIAA 3CCMP 1VQ4P 1VQ8P 4U0CA 2XGYA 1QVFO 3B5IA 1M9EC 3G1IA 1RO0A 1K8AQ 3CCSP 1YHQP 1JJ2O 4PH2A 2KGFA 3E2DA 2JYLA 1K9MQ 2X83A 4DGEC 2BUOA 3HZQA 1YIJP 4PH0A 3OW2O 1P7NA 2PEOA 1N8RQ 2XV6A 3H4EA 2E1MA 5HGOA 5F2KA 1L6NA 1Q82Q 1M9CC 1QVGO 1AK4C 2WLVA 4INBA 2PWMA 1VQ6P 1VQ5P 1IUQA 4U0FA 3DS1A 1EOQA 3CCQP 2EFJA 2P9XA 1QRJA 5JPAA 1VQLP 3G28A 2XDEA 3CXCO 5HGMA 1M9YC 4XRQA 5HGNA 2M8NA 1RNIA 3DS4A 3CC2P 1VQ9P 2QEXP 1YJWP 2LF4A 2Z46A 3I56P 4HTWA 3CCEP 4J93A 1AUMA 1AFVA 2M8LA 1G03A 3CPWO 1K30A 3HYBA 4COCA 2OTLP 2M8PA 3CC7P 3CMEP 1VQNP 2V4XA 3CCVP 2X2DD 3H0DA 2Z45A 2PEJA 3CCLP 3H47A 2PEIA 5DCKA 1K73Q 1E6JP 4U0BA 3DS2A 2L6EA 2XGUA 1Q81Q 2PEKA 3CD6P 4U0AA 2Z44A 3VRLC 3G29A 5I4TG 1YJNP 4NX4C 1EIAA 4PH3A 5F2NA 3I55P 3CMAP 4E92A 3G21A 1KC8Q 1KD1Q 2ONTA 1EM9A 5BS2A 4XFXA 3G4SP 1VQPP 1YJ9P 5BS1A 4U0EA 3G6EP 1VQKP 2JO0A 3CCRP 1M1KQ 4DGAC 3CCUP 4U0DA 2KODA 3G1GA 3NTEA 2QA4P 1Q86Q 2OTJP 4GR2A 2PWOA 2CWOA 1YI2P 1KQSO 2JYGA 1VQOP 3LRYA 1A8OA 1GWPA 2PEMA 2WLVB 3DS0A 1BAJA 1VQ7P 1D1DA 2GONA 4B4NA 3G26A 3BP9A 3CC4P 1M6NA 1M9XC 2PY8A 1M74A 2DGYA 3G0VA 4XFZA 5F2OA 3DTJA 1A43A 5HGKA 3G71P 3P05A 1M9DC 4XROA 1NJIQ 3DS3A 2GOLB 3M1MA 3DPHA 4WYMA 3RG6C 3CCJP 4GR6A 4XFYA 2JPRA 2OARA 4QNBA 1S72P 2Y4ZA 2PEQA 1U7KA 4PH1A 4E91A 3Q20A 2PXRC 2X82A 4LQWC 1M90Q 2EG5A 1VQMP 1M9FC 1Q7YQ 1M6EX 1YITP 2XGVA 2PENA 1W2BO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COP A;  2XXM A;  3MGE A;  4M0I A;  2XT1 A;  5HGL A;  3DS5 A;  4IPY A;  2EIA A;  4U0C A;  2XGY A;  1M9E C;  3G1I A;  4PH2 A;  2KGF A;  2JYL A;  2X83 A;  4DGE C;  2BUO A;  4PH0 A;  1P7N A;  2XV6 A;  3H4E A;  5HGO A;  1L6N A;  1M9C C;  1AK4 C;  2WLV A;  4INB A;  2PWM A;  4U0F A;  3DS1 A;  1EOQ A;  1QRJ A;  5JPA A;  3G28 A;  2XDE A;  5HGM A;  1M9Y C;  4XRQ A;  5HGN A;  2M8N A;  3DS4 A;  2LF4 A;  4HTW A;  4J93 A;  1AUM A;  1AFV A;  2M8L A;  1G03 A;  4COC A;  2M8P A;  2V4X A;  2X2D D;  3H47 A;  5DCK A;  1E6J P;  4U0B A;  3DS2 A;  2L6E A;  2XGU A;  4U0A A;  3VRL C;  3G29 A;  5I4T G;  4NX4 C;  1EIA A;  4PH3 A;  4E92 A;  3G21 A;  2ONT A;  1EM9 A;  4XFX A;  4U0E A;  2JO0 A;  4DGA C;  4U0D A;  2KOD A;  3G1G A;  3NTE A;  2PWO A;  2JYG A;  3LRY A;  1A8O A;  1GWP A;  2WLV B;  3DS0 A;  1BAJ A;  1D1D A;  2GON A;  4B4N A;  3G26 A;  3BP9 A;  1M9X C;  3G0V A;  4XFZ A;  3DTJ A;  1A43 A;  5HGK A;  3P05 A;  1M9D C;  4XRO A;  3DS3 A;  2GOL B;  3DPH A;  4WYM A;  4XFY A;  2JPR A;  4QNB A;  2Y4Z A;  4PH1 A;  1U7K A;  4E91 A;  2PXR C;  2X82 A;  4LQW C;  1M9F C;  2XGV A; 
#chains in the Genus database with same CATH topology
 2XXM A;  2VLO A;  3CCM P;  2GDX A;  4U0C A;  1QVF O;  3B5I A;  1RO0 A;  2QNW A;  2WPT A;  1YHQ P;  4PH2 A;  2X83 A;  2LL8 A;  3OW2 O;  1N8R Q;  1ACP A;  2LKI A;  2KR5 A;  4HKG A;  1Q82 Q;  2MY5 A;  2PWM A;  3EJE A;  3DS1 A;  1EOQ A;  2L4B A;  1L0H A;  2N98 A;  1M9Y C;  2GDY A;  1EMV A;  3CC2 P;  2LF4 A;  2LPK A;  2CNR A;  4HTW A;  2M8L A;  3HYB A;  1VQN P;  2FAD A;  2V4X A;  2PEJ A;  3CCL P;  1VKU A;  2PEI A;  2K5X A;  4U0B A;  2JQ4 A;  3VRL C;  1HQB A;  2VLN A;  3CMA P;  3I55 P;  2ONT A;  2JU1 A;  3G6E P;  3GZM A;  4BPH A;  2DNW A;  1BXI A;  1IMQ A;  2MVU A;  2PWO A;  2KW2 A;  2XZ1 C;  2JYG A;  7CEI A;  4H2X C;  2PNG A;  2PEM A;  2EHS A;  3BP9 A;  1M74 A;  2DGY A;  1FR2 A;  4XFZ A;  3DTJ A;  2EHT A;  1A43 A;  5HGK A;  3G71 P;  1M9D C;  3GKL C;  2GZF A;  2JGP A;  2GZJ A;  2GZG A;  1S72 P;  2PEQ A;  1U7K A;  4E91 A;  1Q7Y Q;  1M6E X;  2PEN A;  1RO2 A;  2FQ0 A;  3WBH A;  5HGL A;  2K0X A;  3DS5 A;  4IPY A;  1VQ8 P;  3G1I A;  2FAE A;  1AYI A;  2L22 A;  2GYK A;  3HZQ A;  4PH0 A;  1P7N A;  2JB0 A;  3H4E A;  2E1M A;  5F2K A;  2VSQ A;  1QVG O;  2WLV A;  4INB A;  2CG5 B;  1VQ6 P;  1VQ5 P;  1IUQ A;  2FVE A;  1QRJ A;  3U43 A;  5JPA A;  2KWL A;  1VQL P;  3CXC O;  5HGM A;  5HGN A;  2K2Q A;  2M8N A;  2MR8 A;  3CCE P;  1AUM A;  1G03 A;  3CPW O;  4COC A;  2M8P A;  3CC7 P;  3H0D A;  2Z45 A;  5DCK A;  1E0H A;  1K73 Q;  2GDW A;  3GZL A;  3DS2 A;  2XGU A;  2PEK A;  5I4T G;  4PXH B;  4PH3 A;  5F2N A;  4QKO A;  4DG9 A;  2JU2 A;  3G21 A;  2KG8 A;  2LOL A;  2M5R A;  5BS2 A;  5HV8 A;  1T8K A;  2N5H A;  3CCR P;  1F80 D;  4U0D A;  2KOD A;  2LIU A;  3NTE A;  4GR2 A;  1KQS O;  1A8O A;  2K94 A;  4BPF A;  2WLV B;  1UNK A;  3DS0 A;  1BAJ A;  2N50 A;  1VQ7 P;  3G26 A;  3CC4 P;  1X3O A;  2PY8 A;  2JAZ A;  4IZ6 A;  3P05 A;  1MZ8 A;  2KGA A;  5HVC A;  1NQ4 A;  2GOL B;  3DPH A;  3EJB A;  3CCJ P;  2MD9 A;  2JPR A;  4H2Y C;  4PH1 A;  3CE7 A;  2X82 A;  4LQW C;  4CA3 A;  2XGV A;  2BHV A;  4COP A;  3MGE A;  1ZMB A;  2EIA A;  4R0M A;  2XGY A;  2KOR A;  3RG2 A;  2KGC A;  1K8A Q;  3CCS P;  1JJ2 O;  3E2D A;  2ROQ A;  1K9M Q;  1UJZ A;  2XV6 A;  2FAC A;  3GJN A;  4NEO A;  1M9C C;  1AK4 C;  5KP8 B;  2EFJ A;  5EW5 E;  2CQ8 A;  3G28 A;  4XRQ A;  2K93 A;  2FQ1 A;  2VLP A;  3DS4 A;  1VQ9 P;  2QEX P;  1YJW P;  2X2B A;  2KG6 A;  2Z46 A;  1DV5 A;  4J93 A;  1K30 A;  2NO8 A;  2AFE A;  3B4Q A;  2X2D D;  3CCV P;  2MVV A;  2FHS C;  5EJD A;  1Q81 Q;  3CD6 P;  4U0A A;  2Z44 A;  2K0Y A;  1KD1 Q;  4E92 A;  1EM9 A;  3G4S P;  4XFX A;  1VQP P;  1YJ9 P;  5BS1 A;  1VQK P;  2JO0 A;  1M1K Q;  3CCU P;  3G1G A;  2QA4 P;  1Q86 Q;  1YI2 P;  2MR7 A;  3NY7 B;  4BPG A;  1GWP A;  4H2W C;  2LML A;  1GXH A;  2KOQ A;  2JBG A;  2GON A;  4B4N A;  1M6N A;  2CGQ A;  1M9X C;  1KLP A;  2KOP A;  3LMO A;  5KP7 B;  3G0V A;  4XRO A;  1NJI Q;  2GZI A;  3DS3 A;  3M1M A;  1CEI A;  1OR5 A;  2AVA A;  2OAR A;  2Y4Z A;  3Q20 A;  1M90 Q;  2EG5 A;  1VQM P;  2LTE A;  2K92 A;  1W2B O;  2L0Q A;  2VLQ A;  4M0I A;  1VHN A;  4F37 A;  2XT1 A;  1GXG A;  4MRT C;  1VQ4 P;  1M9E C;  2FVF A;  2LIW A;  2KGF A;  2JYL A;  4DGE C;  2BUO A;  1YIJ P;  2PEO A;  2L9F A;  5HGO A;  2N5I A;  1L6N A;  2KOS A;  2MF4 A;  1HY8 A;  2XZ0 D;  4U0F A;  2GZE A;  3CCQ P;  2P9X A;  1Z6M A;  2XDE A;  4PWV B;  2AF8 A;  2KGD A;  2FQ2 A;  3EJD A;  1RNI A;  3I56 P;  1AFV A;  1L0I A;  2OTL P;  3CME P;  1IMP A;  3H47 A;  5CZD B;  1E6J P;  2L6E A;  1ZNV A;  3G29 A;  1YJN P;  4NX4 C;  1EIA A;  2N6Z A;  1KC8 Q;  4UHP B;  1AF8 A;  1DNY A;  4U0E A;  2ERH A;  4DGA C;  2OTJ P;  2CWO A;  2N6Y A;  1VQO P;  3LRY A;  1D1D A;  5KP6 B;  2KGE A;  2KOO A;  5F2O A;  4WYM A;  3RG6 C;  2KG9 A;  4GR6 A;  1GPJ A;  4XFY A;  4QNB A;  2AFD A;  2PXR C;  1M9F C;  2FVA A;  1YIT P;  2K0D X; 
#chains in the Genus database with same CATH homology
 2BHV A;  1RO2 A;  2XXM A;  4COP A;  3MGE A;  4M0I A;  3WBH A;  2XT1 A;  5HGL A;  1ZMB A;  3DS5 A;  4IPY A;  2EIA A;  3CCM P;  1VQ4 P;  1VQ8 P;  4U0C A;  2XGY A;  1QVF O;  3B5I A;  1M9E C;  3G1I A;  1RO0 A;  1K8A Q;  3CCS P;  1YHQ P;  1JJ2 O;  4PH2 A;  2KGF A;  3E2D A;  2JYL A;  1K9M Q;  2X83 A;  4DGE C;  2BUO A;  3HZQ A;  1YIJ P;  4PH0 A;  3OW2 O;  1P7N A;  2PEO A;  1N8R Q;  2XV6 A;  3H4E A;  2E1M A;  5HGO A;  5F2K A;  1L6N A;  1Q82 Q;  1M9C C;  1QVG O;  1AK4 C;  2WLV A;  4INB A;  2PWM A;  1VQ6 P;  1VQ5 P;  1IUQ A;  4U0F A;  3DS1 A;  1EOQ A;  3CCQ P;  2EFJ A;  2P9X A;  1QRJ A;  5JPA A;  1VQL P;  3G28 A;  2XDE A;  3CXC O;  5HGM A;  1M9Y C;  4XRQ A;  5HGN A;  2M8N A;  1RNI A;  3DS4 A;  3CC2 P;  1VQ9 P;  2QEX P;  1YJW P;  2LF4 A;  2Z46 A;  3I56 P;  4HTW A;  3CCE P;  4J93 A;  1AUM A;  1AFV A;  2M8L A;  1G03 A;  3CPW O;  1K30 A;  3HYB A;  4COC A;  2OTL P;  2M8P A;  3CC7 P;  3CME P;  1VQN P;  2V4X A;  3CCV P;  2X2D D;  3H0D A;  2Z45 A;  2PEJ A;  3CCL P;  3H47 A;  2PEI A;  5DCK A;  1K73 Q;  1E6J P;  4U0B A;  3DS2 A;  2L6E A;  2XGU A;  1Q81 Q;  2PEK A;  3CD6 P;  4U0A A;  2Z44 A;  3VRL C;  3G29 A;  5I4T G;  1YJN P;  4NX4 C;  1EIA A;  4PH3 A;  5F2N A;  3I55 P;  3CMA P;  4E92 A;  3G21 A;  1KC8 Q;  1KD1 Q;  2ONT A;  1EM9 A;  5BS2 A;  4XFX A;  3G4S P;  1VQP P;  1YJ9 P;  5BS1 A;  4U0E A;  3G6E P;  1VQK P;  2JO0 A;  3CCR P;  1M1K Q;  4DGA C;  3CCU P;  4U0D A;  2KOD A;  3G1G A;  3NTE A;  2QA4 P;  1Q86 Q;  2OTJ P;  4GR2 A;  2PWO A;  2CWO A;  1YI2 P;  1KQS O;  2JYG A;  1VQO P;  3LRY A;  1A8O A;  1GWP A;  2PEM A;  2WLV B;  3DS0 A;  1BAJ A;  1VQ7 P;  1D1D A;  2GON A;  4B4N A;  3G26 A;  3BP9 A;  3CC4 P;  1M6N A;  1M9X C;  2PY8 A;  1M74 A;  2DGY A;  3G0V A;  4XFZ A;  5F2O A;  3DTJ A;  1A43 A;  5HGK A;  3G71 P;  3P05 A;  1M9D C;  4XRO A;  1NJI Q;  3DS3 A;  2GOL B;  3M1M A;  3DPH A;  4WYM A;  3RG6 C;  3CCJ P;  4GR6 A;  4XFY A;  2JPR A;  2OAR A;  4QNB A;  1S72 P;  2Y4Z A;  2PEQ A;  1U7K A;  4PH1 A;  4E91 A;  3Q20 A;  2PXR C;  2X82 A;  4LQW C;  1M90 Q;  2EG5 A;  1VQM P;  1M9F C;  1Q7Y Q;  1M6E X;  1YIT P;  2XGV A;  2PEN A;  1W2B O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...