3MGEA

X-ray structure of hexameric hiv-1 ca
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
204
Chain Sequence
PIVMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSCLSEGATPQDLNCMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Disulfide Bond Stabilization of the Hexameric Capsomer of Human Immunodeficiency Virus.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 71
structure length 204
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3mgeA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3mgeA02
1AK4C 3BP9A 4LQWC 1D1DA 3DTJA 1EM9A 2XT1A 4U0DA 2XGUA 5DCKA 5JPAA 1M9XC 2X83A 2XV6A 2EIAA 2KODA 4U0BA 1M9FC 1BAJA 1AUMA 2JYGA 4U0EA 1M9DC 1QRJA 2XGVA 4WYMA 3G1IA 2M8PA 1A8OA 3NTEA 5HGOA 4PH0A 4E91A 4E92A 2PXRC 2V4XA 4IPYA 4XRQA 4J93A 4DGEC 4PH2A 2X82A 1U7KA 4M0IA 1M9EC 3H47A 4COPA 2M8LA 4PH1A 4B4NA 4U0AA 3DS4A 2PWMA 3G21A 4XFXA 4NX4C 2JPRA 4DGAC 4HTWA 2XGYA 1EOQA 1A43A 2GONA 3G28A 2XDEA 5HGNA 3G29A 5HGMA 3G26A 4INBA 2Y4ZA 5HGLA 1GWPA 2JYLA 1M9YC 2ONTA 1G03A 2WLVB 3H4EA 3DS1A 2KGFA 3VRLC 2L6EA 3G0VA 1P7NA 2M8NA 3DPHA 1E6JP 1L6NA 5HGKA 5I4TG 4XFYA 3DS0A 4XROA 1M9CC 3DS2A 1AFVA 4COCA 2XXMA 3G1GA 4PH3A 2PWOA 4U0CA 4XFZA 4QNBA 2X2DD 2WLVA 2LF4A 3MGEA 3LRYA 4U0FA 2GOLB 1EIAA 3DS5A 3P05A 2BUOA 3DS3A 2JO0A
chains in the Genus database with same CATH superfamily
1AK4C 3B5IA 4LQWC 3DTJA 2KGCA 1YJNP 4IZ6A 2PEIA 2EIAA 1DNYA 1VQLP 2K0DX 2Z46A 2KORA 2FVEA 3CD6P 2VLQA 1VQ4P 2KG9A 2PY8A 3WBHA 1L0IA 2PEKA 1NQ4A 2LIWA 1VQ5P 2K92A 2M8PA 1A8OA 3NTEA 3E2DA 1VQ8P 5HGOA 1E0HA 4J93A 1GXHA 3RG6C 1HY8A 3GZLA 2DGYA 1KC8Q 2N6ZA 3CCJP 3CC4P 3H47A 1K8AQ 3OW2O 3CCVP 2KG8A 2VLPA 1GPJA 4PXHB 2PWMA 2MY5A 2LKIA 3M1MA 1A43A 2GONA 3G28A 2XDEA 1VQ6P 3CCUP 2QEXP 1M9YC 2EHSA 2K93A 2QA4P 2WLVB 1Q86Q 2L6EA 2ROQA 2K2QA 5HGKA 4XFYA 1IUQA 3DS0A 2LOLA 2FHSC 1AFVA 3CCRP 3G1GA 2AVAA 2N5HA 5BS2A 2PEMA 4XFZA 2X2DD 2BHVA 5F2OA 2GZGA 2MD9A 2FQ0A 2PNGA 2DNWA 3HYBA 1ZNVA 3P05A 1CEIA 3G4SP 3DS3A 4IPYA 2KOOA 1Q82Q 1YHQP 4U0DA 2FAEA 5DCKA 2GZEA 4U0BA 2OARA 1BAJA 2JYGA 4H2YC 5CZDB 2XGVA 4WYMA 3G1IA 3CCSP 4BPHA 1Q7YQ 2XZ1C 2FQ2A 4E92A 2PXRC 2Z44A 1VQNP 1VQOP 2X82A 2AFDA 3CE7A 1U7KA 2KOSA 4H2XC 4DG9A 1Z6MA 1M9EC 4COPA 2X2BA 3GZMA 4PH1A 2CNRA 1X3OA 1GXGA 2L9FA 4NX4C 2JPRA 1YITP 4HKGA 2GZJA 4HTWA 1VQ9P 2N50A 3RG2A 5HGNA 2L0QA 3G26A 1VHNA 2NO8A 3CC2P 2FACA 2AFEA 1KD1Q 3DS1A 2QNWA 3VRLC 4H2WC 3CPWO 3G0VA 2CG5B 1P7NA 3Q20A 2MR7A 1K9MQ 2OTLP 2MVUA 2KGEA 3EJDA 1VQMP 1MZ8A 1M9CC 3DS2A 1RO0A 1AYIA 4COCA 2MVVA 2GDWA 2XXMA 2KWLA 2JAZA 1UJZA 1ACPA 3MGEA 1M74A 2JBGA 2KR5A 3LRYA 2FVFA 5HVCA 2L4BA 2N5IA 2CGQA 3GJNA 1EIAA 3DS5A 2JO0A 4F37A 3BP9A 1W2BO 2K0XA 5JPAA 2XV6A 2MF4A 1FR2A 2FVAA 2KOPA 1M9FC 1K73Q 1AUMA 1VQ7P 2JU2A 5F2NA 4U0EA 1QRJA 1S72P 1QVGO 4R0MA 2EHTA 3H0DA 1VQPP 1M90Q 3GKLC 1RNIA 1YIJP 2KGAA 2FADA 5EW5E 4DGEC 1BXIA 2JQ4A 2LL8A 2JGPA 4UHPB 4B4NA 4U0AA 3DS4A 3CCEP 1OR5A 3G21A 2GYKA 4XFXA 1YJWP 3G6EP 1M6NA 2XGYA 1L0HA 2M5RA 2PENA 3I55P 3CMAP 5HGMA 2CQ8A 5HGLA 2LPKA 1VKUA 2ONTA 5BS1A 5F2KA 2XZ0D 2K94A 5KP8B 3B4QA 2FQ1A 2M8NA 3DPHA 2KGDA 2VSQA 2CWOA 1NJIQ 2OTJP 3CC7P 2VLNA 1N8RQ 2KG6A 2VLOA 4U0CA 3LMOA 3CCMP 1KQSO 2P9XA 4CA3A 3NY7B 2EFJA 2GOLB 4PWVB 1YJ9P 4MRTC 2BUOA 3U43A 3EJBA 1D1DA 3CCLP 1EM9A 3HZQA 2XT1A 2LIUA 2XGUA 2MR8A 1M9XC 2X83A 2GZIA 2KODA 2JU1A 5HV8A 2EG5A 2PEJA 1DV5A 5KP7B 1M9DC 2GZFA 4PH0A 4GR6A 2PEQA 4NEOA 4E91A 2N98A 2WPTA 1Q81Q 2V4XA 4XRQA 3G71P 1IMQA 4BPFA 4PH2A 4M0IA 3CXCO 2E1MA 2LTEA 1AF8A 2M8LA 1F80D 3I56P 1M1KQ 2K0YA 1HQBA 3EJEA 2GDXA 1QVFO 4DGAC 1EOQA 1JJ2O 1EMVA 3G29A 1M6EX 4INBA 2Y4ZA 4GR2A 1GWPA 2JYLA 1ZMBA 1K30A 2KOQA 1G03A 3CCQP 1RO2A 1KLPA 2GDYA 3H4EA 2KGFA 2Z45A 7CEIA 1E6JP 1L6NA 1T8KA 2JB0A 5I4TG 4XROA 2LMLA 1IMPA 5KP6B 2N6YA 2KW2A 4PH3A 2PWOA 3CMEP 1YI2P 1VQKP 4QNBA 2WLVA 4QKOA 5EJDA 2LF4A 4U0FA 1UNKA 2L22A 2ERHA 2K5XA 2PEOA 4BPGA 2AF8A
chains in the Genus database with same CATH topology
1AK4C 3B5IA 3BP9A 4LQWC 1D1DA 3DTJA 1W2BO 3CCLP 1YHQP 1EM9A 3HZQA 2XT1A 1YJNP 4U0DA 2XGUA 5DCKA 5JPAA 1M9XC 2X83A 2XV6A 2PEIA 2EIAA 2KODA 1VQLP 2Z46A 4U0BA 2OARA 3CD6P 1M9FC 1BAJA 2EG5A 1K73Q 1AUMA 2PEJA 2PY8A 3WBHA 1VQ4P 2JYGA 1VQ7P 2PEKA 5F2NA 4U0EA 1M9DC 1QRJA 2XGVA 4WYMA 1S72P 3G1IA 3CCSP 1VQ5P 2M8PA 1QVGO 1A8OA 3NTEA 3E2DA 1VQ8P 5HGOA 4PH0A 4GR6A 3H0DA 2PEQA 1Q7YQ 4E91A 1VQPP 1M90Q 1Q81Q 4E92A 2PXRC 2V4XA 2Z44A 1RNIA 4IPYA 1VQNP 4XRQA 1YIJP 4J93A 1VQOP 3G71P 4DGEC 3RG6C 4PH2A 2X82A 2DGYA 1U7KA 4M0IA 3CXCO 1KC8Q 3CCJP 3CC4P 1M9EC 2E1MA 3H47A 4COPA 2M8LA 4PH1A 4B4NA 3I56P 1K8AQ 3OW2O 1M1KQ 4U0AA 3CCVP 3DS4A 3CCEP 2PWMA 3G21A 4XFXA 4NX4C 2JPRA 1YITP 1YJWP 1QVFO 4DGAC 3M1MA 3G6EP 1M6NA 4HTWA 2XGYA 1EOQA 1A43A 1JJ2O 1VQ9P 2GONA 3G28A 2XDEA 2PENA 5HGNA 3I55P 1VQ6P 3CCUP 3G29A 1M6EX 3CMAP 5HGMA 3G26A 4INBA 2Y4ZA 5HGLA 4GR2A 1GWPA 2JYLA 2QEXP 1ZMBA 1M9YC 1K30A 2ONTA 3CC2P 5BS1A 1G03A 5F2KA 3CCQP 1RO2A 2QA4P 1KD1Q 2WLVB 1Q86Q 3H4EA 3DS1A 2KGFA 3VRLC 3CPWO 2L6EA 3G0VA 1P7NA 3Q20A 2Z45A 1K9MQ 2M8NA 3DPHA 2OTLP 1E6JP 1L6NA 5HGKA 5I4TG 1IUQA 4XFYA 3DS0A 4XROA 1VQMP 2CWOA 1M9CC 1NJIQ 2OTJP 3DS2A 1RO0A 3CC7P 1AFVA 4COCA 1N8RQ 2XXMA 3CCRP 3G1GA 4PH3A 2PWOA 3CMEP 4U0CA 1YI2P 5BS2A 2PEMA 1VQKP 3CCMP 4XFZA 1KQSO 4QNBA 2X2DD 2WLVA 2LF4A 2BHVA 5F2OA 2P9XA 3MGEA 1M74A 3LRYA 2EFJA 4U0FA 2GOLB 1YJ9P 1EIAA 2PEOA 3DS5A 3HYBA 3P05A 2BUOA 3G4SP 3DS3A 2JO0A 1Q82Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AK4 C;  3BP9 A;  4LQW C;  1D1D A;  3DTJ A;  1EM9 A;  2XT1 A;  4U0D A;  2XGU A;  5DCK A;  5JPA A;  1M9X C;  2X83 A;  2XV6 A;  2EIA A;  2KOD A;  4U0B A;  1M9F C;  1BAJ A;  1AUM A;  2JYG A;  4U0E A;  1M9D C;  1QRJ A;  2XGV A;  4WYM A;  3G1I A;  2M8P A;  1A8O A;  3NTE A;  5HGO A;  4PH0 A;  4E91 A;  4E92 A;  2PXR C;  2V4X A;  4IPY A;  4XRQ A;  4J93 A;  4DGE C;  4PH2 A;  2X82 A;  1U7K A;  4M0I A;  1M9E C;  3H47 A;  4COP A;  2M8L A;  4PH1 A;  4B4N A;  4U0A A;  3DS4 A;  2PWM A;  3G21 A;  4XFX A;  4NX4 C;  2JPR A;  4DGA C;  4HTW A;  2XGY A;  1EOQ A;  1A43 A;  2GON A;  3G28 A;  2XDE A;  5HGN A;  3G29 A;  5HGM A;  3G26 A;  4INB A;  2Y4Z A;  5HGL A;  1GWP A;  2JYL A;  1M9Y C;  2ONT A;  1G03 A;  2WLV B;  3H4E A;  3DS1 A;  2KGF A;  3VRL C;  2L6E A;  3G0V A;  1P7N A;  2M8N A;  3DPH A;  1E6J P;  1L6N A;  5HGK A;  5I4T G;  4XFY A;  3DS0 A;  4XRO A;  1M9C C;  3DS2 A;  1AFV A;  4COC A;  2XXM A;  3G1G A;  4PH3 A;  2PWO A;  4U0C A;  4XFZ A;  4QNB A;  2X2D D;  2WLV A;  2LF4 A;  3MGE A;  3LRY A;  4U0F A;  2GOL B;  1EIA A;  3DS5 A;  3P05 A;  2BUO A;  3DS3 A;  2JO0 A; 
#chains in the Genus database with same CATH topology
 1AK4 C;  3B5I A;  4LQW C;  3DTJ A;  2KGC A;  1YJN P;  4IZ6 A;  2PEI A;  2EIA A;  1DNY A;  1VQL P;  2K0D X;  2Z46 A;  2KOR A;  2FVE A;  3CD6 P;  2VLQ A;  1VQ4 P;  2KG9 A;  2PY8 A;  3WBH A;  1L0I A;  2PEK A;  1NQ4 A;  2LIW A;  1VQ5 P;  2K92 A;  2M8P A;  1A8O A;  3NTE A;  3E2D A;  1VQ8 P;  5HGO A;  1E0H A;  4J93 A;  1GXH A;  3RG6 C;  1HY8 A;  3GZL A;  2DGY A;  1KC8 Q;  2N6Z A;  3CCJ P;  3CC4 P;  3H47 A;  1K8A Q;  3OW2 O;  3CCV P;  2KG8 A;  2VLP A;  1GPJ A;  4PXH B;  2PWM A;  2MY5 A;  2LKI A;  3M1M A;  1A43 A;  2GON A;  3G28 A;  2XDE A;  1VQ6 P;  3CCU P;  2QEX P;  1M9Y C;  2EHS A;  2K93 A;  2QA4 P;  2WLV B;  1Q86 Q;  2L6E A;  2ROQ A;  2K2Q A;  5HGK A;  4XFY A;  1IUQ A;  3DS0 A;  2LOL A;  2FHS C;  1AFV A;  3CCR P;  3G1G A;  2AVA A;  2N5H A;  5BS2 A;  2PEM A;  4XFZ A;  2X2D D;  2BHV A;  5F2O A;  2GZG A;  2MD9 A;  2FQ0 A;  2PNG A;  2DNW A;  3HYB A;  1ZNV A;  3P05 A;  1CEI A;  3G4S P;  3DS3 A;  4IPY A;  2KOO A;  1Q82 Q;  1YHQ P;  4U0D A;  2FAE A;  5DCK A;  2GZE A;  4U0B A;  2OAR A;  1BAJ A;  2JYG A;  4H2Y C;  5CZD B;  2XGV A;  4WYM A;  3G1I A;  3CCS P;  4BPH A;  1Q7Y Q;  2XZ1 C;  2FQ2 A;  4E92 A;  2PXR C;  2Z44 A;  1VQN P;  1VQO P;  2X82 A;  2AFD A;  3CE7 A;  1U7K A;  2KOS A;  4H2X C;  4DG9 A;  1Z6M A;  1M9E C;  4COP A;  2X2B A;  3GZM A;  4PH1 A;  2CNR A;  1X3O A;  1GXG A;  2L9F A;  4NX4 C;  2JPR A;  1YIT P;  4HKG A;  2GZJ A;  4HTW A;  1VQ9 P;  2N50 A;  3RG2 A;  5HGN A;  2L0Q A;  3G26 A;  1VHN A;  2NO8 A;  3CC2 P;  2FAC A;  2AFE A;  1KD1 Q;  3DS1 A;  2QNW A;  3VRL C;  4H2W C;  3CPW O;  3G0V A;  2CG5 B;  1P7N A;  3Q20 A;  2MR7 A;  1K9M Q;  2OTL P;  2MVU A;  2KGE A;  3EJD A;  1VQM P;  1MZ8 A;  1M9C C;  3DS2 A;  1RO0 A;  1AYI A;  4COC A;  2MVV A;  2GDW A;  2XXM A;  2KWL A;  2JAZ A;  1UJZ A;  1ACP A;  3MGE A;  1M74 A;  2JBG A;  2KR5 A;  3LRY A;  2FVF A;  5HVC A;  2L4B A;  2N5I A;  2CGQ A;  3GJN A;  1EIA A;  3DS5 A;  2JO0 A;  4F37 A;  3BP9 A;  1W2B O;  2K0X A;  5JPA A;  2XV6 A;  2MF4 A;  1FR2 A;  2FVA A;  2KOP A;  1M9F C;  1K73 Q;  1AUM A;  1VQ7 P;  2JU2 A;  5F2N A;  4U0E A;  1QRJ A;  1S72 P;  1QVG O;  4R0M A;  2EHT A;  3H0D A;  1VQP P;  1M90 Q;  3GKL C;  1RNI A;  1YIJ P;  2KGA A;  2FAD A;  5EW5 E;  4DGE C;  1BXI A;  2JQ4 A;  2LL8 A;  2JGP A;  4UHP B;  4B4N A;  4U0A A;  3DS4 A;  3CCE P;  1OR5 A;  3G21 A;  2GYK A;  4XFX A;  1YJW P;  3G6E P;  1M6N A;  2XGY A;  1L0H A;  2M5R A;  2PEN A;  3I55 P;  3CMA P;  5HGM A;  2CQ8 A;  5HGL A;  2LPK A;  1VKU A;  2ONT A;  5BS1 A;  5F2K A;  2XZ0 D;  2K94 A;  5KP8 B;  3B4Q A;  2FQ1 A;  2M8N A;  3DPH A;  2KGD A;  2VSQ A;  2CWO A;  1NJI Q;  2OTJ P;  3CC7 P;  2VLN A;  1N8R Q;  2KG6 A;  2VLO A;  4U0C A;  3LMO A;  3CCM P;  1KQS O;  2P9X A;  4CA3 A;  3NY7 B;  2EFJ A;  2GOL B;  4PWV B;  1YJ9 P;  4MRT C;  2BUO A;  3U43 A;  3EJB A;  1D1D A;  3CCL P;  1EM9 A;  3HZQ A;  2XT1 A;  2LIU A;  2XGU A;  2MR8 A;  1M9X C;  2X83 A;  2GZI A;  2KOD A;  2JU1 A;  5HV8 A;  2EG5 A;  2PEJ A;  1DV5 A;  5KP7 B;  1M9D C;  2GZF A;  4PH0 A;  4GR6 A;  2PEQ A;  4NEO A;  4E91 A;  2N98 A;  2WPT A;  1Q81 Q;  2V4X A;  4XRQ A;  3G71 P;  1IMQ A;  4BPF A;  4PH2 A;  4M0I A;  3CXC O;  2E1M A;  2LTE A;  1AF8 A;  2M8L A;  1F80 D;  3I56 P;  1M1K Q;  2K0Y A;  1HQB A;  3EJE A;  2GDX A;  1QVF O;  4DGA C;  1EOQ A;  1JJ2 O;  1EMV A;  3G29 A;  1M6E X;  4INB A;  2Y4Z A;  4GR2 A;  1GWP A;  2JYL A;  1ZMB A;  1K30 A;  2KOQ A;  1G03 A;  3CCQ P;  1RO2 A;  1KLP A;  2GDY A;  3H4E A;  2KGF A;  2Z45 A;  7CEI A;  1E6J P;  1L6N A;  1T8K A;  2JB0 A;  5I4T G;  4XRO A;  2LML A;  1IMP A;  5KP6 B;  2N6Y A;  2KW2 A;  4PH3 A;  2PWO A;  3CME P;  1YI2 P;  1VQK P;  4QNB A;  2WLV A;  4QKO A;  5EJD A;  2LF4 A;  4U0F A;  1UNK A;  2L22 A;  2ERH A;  2K5X A;  2PEO A;  4BPG A;  2AF8 A; 
#chains in the Genus database with same CATH homology
 1AK4 C;  3B5I A;  3BP9 A;  4LQW C;  1D1D A;  3DTJ A;  1W2B O;  3CCL P;  1YHQ P;  1EM9 A;  3HZQ A;  2XT1 A;  1YJN P;  4U0D A;  2XGU A;  5DCK A;  5JPA A;  1M9X C;  2X83 A;  2XV6 A;  2PEI A;  2EIA A;  2KOD A;  1VQL P;  2Z46 A;  4U0B A;  2OAR A;  3CD6 P;  1M9F C;  1BAJ A;  2EG5 A;  1K73 Q;  1AUM A;  2PEJ A;  2PY8 A;  3WBH A;  1VQ4 P;  2JYG A;  1VQ7 P;  2PEK A;  5F2N A;  4U0E A;  1M9D C;  1QRJ A;  2XGV A;  4WYM A;  1S72 P;  3G1I A;  3CCS P;  1VQ5 P;  2M8P A;  1QVG O;  1A8O A;  3NTE A;  3E2D A;  1VQ8 P;  5HGO A;  4PH0 A;  4GR6 A;  3H0D A;  2PEQ A;  1Q7Y Q;  4E91 A;  1VQP P;  1M90 Q;  1Q81 Q;  4E92 A;  2PXR C;  2V4X A;  2Z44 A;  1RNI A;  4IPY A;  1VQN P;  4XRQ A;  1YIJ P;  4J93 A;  1VQO P;  3G71 P;  4DGE C;  3RG6 C;  4PH2 A;  2X82 A;  2DGY A;  1U7K A;  4M0I A;  3CXC O;  1KC8 Q;  3CCJ P;  3CC4 P;  1M9E C;  2E1M A;  3H47 A;  4COP A;  2M8L A;  4PH1 A;  4B4N A;  3I56 P;  1K8A Q;  3OW2 O;  1M1K Q;  4U0A A;  3CCV P;  3DS4 A;  3CCE P;  2PWM A;  3G21 A;  4XFX A;  4NX4 C;  2JPR A;  1YIT P;  1YJW P;  1QVF O;  4DGA C;  3M1M A;  3G6E P;  1M6N A;  4HTW A;  2XGY A;  1EOQ A;  1A43 A;  1JJ2 O;  1VQ9 P;  2GON A;  3G28 A;  2XDE A;  2PEN A;  5HGN A;  3I55 P;  1VQ6 P;  3CCU P;  3G29 A;  1M6E X;  3CMA P;  5HGM A;  3G26 A;  4INB A;  2Y4Z A;  5HGL A;  4GR2 A;  1GWP A;  2JYL A;  2QEX P;  1ZMB A;  1M9Y C;  1K30 A;  2ONT A;  3CC2 P;  5BS1 A;  1G03 A;  5F2K A;  3CCQ P;  1RO2 A;  2QA4 P;  1KD1 Q;  2WLV B;  1Q86 Q;  3H4E A;  3DS1 A;  2KGF A;  3VRL C;  3CPW O;  2L6E A;  3G0V A;  1P7N A;  3Q20 A;  2Z45 A;  1K9M Q;  2M8N A;  3DPH A;  2OTL P;  1E6J P;  1L6N A;  5HGK A;  5I4T G;  1IUQ A;  4XFY A;  3DS0 A;  4XRO A;  1VQM P;  2CWO A;  1M9C C;  1NJI Q;  2OTJ P;  3DS2 A;  1RO0 A;  3CC7 P;  1AFV A;  4COC A;  1N8R Q;  2XXM A;  3CCR P;  3G1G A;  4PH3 A;  2PWO A;  3CME P;  4U0C A;  1YI2 P;  5BS2 A;  2PEM A;  1VQK P;  3CCM P;  4XFZ A;  1KQS O;  4QNB A;  2X2D D;  2WLV A;  2LF4 A;  2BHV A;  5F2O A;  2P9X A;  3MGE A;  1M74 A;  3LRY A;  2EFJ A;  4U0F A;  2GOL B;  1YJ9 P;  1EIA A;  2PEO A;  3DS5 A;  3HYB A;  3P05 A;  2BUO A;  3G4S P;  3DS3 A;  2JO0 A;  1Q82 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...