3MGEA

X-ray structure of hexameric hiv-1 ca
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
219
structure length
204
Chain Sequence
PIVMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSCLSEGATPQDLNCMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Disulfide Bond Stabilization of the Hexameric Capsomer of Human Immunodeficiency Virus.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 71
structure length 204
sequence length 219
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2010-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3mgeA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3mgeA02
3P05A 4E91A 1QRJA 5I4TG 4WYMA 1D1DA 1M9XC 2X82A 4J93A 1AFVA 2PXRC 2KGFA 3G1GA 1M9FC 4XROA 4NX4C 1EOQA 3MGEA 3DS4A 2XGUA 3NTEA 2XDEA 5DCKA 2JPRA 2X2DD 4PH1A 2XXMA 2M8PA 3G21A 4COPA 4PH3A 2GONA 2PWMA 1EM9A 2XGYA 3G1IA 5HGOA 1U7KA 4QNBA 1AK4C 4XFYA 2M8NA 2JYGA 2BUOA 3DS2A 3H47A 1E6JP 4DGEC 3DS3A 2EIAA 3DS1A 2WLVA 1EIAA 4XFXA 4B4NA 2PWOA 3G0VA 3BP9A 4U0CA 5HGNA 4M0IA 4U0DA 4XRQA 2KODA 1M9YC 4HTWA 2JYLA 2XT1A 1M9CC 4PH2A 1G03A 1GWPA 4U0BA 3G26A 1P7NA 1L6NA 4XFZA 4IPYA 3G29A 1A8OA 1M9EC 4U0EA 1AUMA 2M8LA 4LQWC 2XGVA 2GOLB 2ONTA 1A43A 2L6EA 2JO0A 5HGLA 2Y4ZA 4INBA 2XV6A 3DS5A 2LF4A 3DS0A 2X83A 3H4EA 4U0FA 2V4XA 3DPHA 3DTJA 3VRLC 4COCA 5HGKA 4PH0A 5HGMA 5JPAA 4E92A 2WLVB 3G28A 4U0AA 3LRYA 1M9DC 1BAJA 4DGAC
chains in the Genus database with same CATH superfamily
2Z44A 5I4TG 3WBHA 2MY5A 1M9XC 3M1MA 1UNKA 5KP6B 2MR8A 2K93A 2PENA 1AFVA 2PXRC 3G1GA 4CA3A 4XROA 2GDXA 1EOQA 3G6EP 2PEOA 3CC4P 2MD9A 2X2DD 2K0YA 2PY8A 1K9MQ 1L0IA 2N6ZA 2GONA 1EM9A 3G71P 3RG2A 1M90Q 1AYIA 4QNBA 4XFYA 3G4SP 2KG6A 1K73Q 5HV8A 1IUQA 3DS2A 3H47A 1E6JP 2EIAA 1UJZA 2WLVA 4B4NA 2PWOA 1K30A 3BP9A 3GKLC 3CCEP 5HGNA 4U0DA 2KODA 4HTWA 2OARA 1VQ9P 5EJDA 1YJ9P 1OR5A 2KW2A 1M9EC 2JAZA 2WPTA 1VQKP 2K2QA 2CG5B 2LIUA 2LMLA 1E0HA 2XGVA 1VQ8P 1A43A 1X3OA 5HGLA 4MRTC 3GJNA 3GZMA 2FACA 3DS0A 2X83A 2GZIA 2JQ4A 1VQLP 2CNRA 2MF4A 2EFJA 4R0MA 2GYKA 5HGMA 2P9XA 2DGYA 2WLVB 2KWLA 1MZ8A 4H2WC 5KP7B 2MVVA 2KGEA 2M5RA 3HZQA 1QRJA 2FADA 2JU2A 1KQSO 2N98A 2JB0A 3CCQP 2X82A 1YITP 2K0DX 3CMAP 4IZ6A 3GZLA 3MGEA 3DS4A 3NTEA 2XDEA 5DCKA 1GXGA 2PEIA 1GPJA 1Q7YQ 4PH1A 2FVEA 1DNYA 2FVAA 4QKOA 4PH3A 2PWMA 2XGYA 3B4QA 3U43A 1W2BO 1ZNVA 2E1MA 3CCUP 1YHQP 5HGOA 2FQ0A 2JYGA 1JJ2O 2CWOA 2LKIA 2PEMA 4U0CA 2QEXP 1KC8Q 1K8AQ 2NO8A 1NQ4A 2LOLA 4M0IA 3CE7A 2ERHA 1M9YC 4UHPB 2JYLA 4BPGA 1G03A 2PEJA 4BPFA 1VKUA 4U0BA 3CCLP 3G26A 2KG9A 5HVCA 1L6NA 4XFZA 1YIJP 1VHNA 1S72P 5F2NA 2X2BA 1IMQA 1EMVA 1BXIA 3CCRP 1VQOP 2KOOA 2L6EA 2FVFA 2VSQA 2XV6A 2FAEA 2V4XA 3DPHA 1QVGO 2Z46A 2L9FA 3I55P 2LTEA 4COCA 4HKGA 2MR7A 4PH0A 1QVFO 2N5IA 4U0AA 1HY8A 2XZ0D 3CCSP 2EHSA 3CC7P 4DGAC 3P05A 5CZDB 4WYMA 1HQBA 2OTLP 4GR2A 1ACPA 1Q81Q 2XZ1C 1VQPP 5F2KA 1M6NA 3LMOA 1Q86Q 4NX4C 1CEIA 2GZFA 7CEIA 2JPRA 2XXMA 2M8PA 1AF8A 2CGQA 3G21A 3CPWO 4COPA 4H2YC 1VQ6P 2K0XA 3G1IA 4PXHB 2JU1A 1AK4C 2M8NA 2GZJA 4DGEC 3NY7B 3DS1A 1IMPA 3H0DA 1EIAA 4XFXA 3Q20A 3G0VA 3E2DA 2K92A 1FR2A 1M9CC 4PH2A 1VQNP 1GWPA 1RO0A 4IPYA 1A8OA 2M8LA 5KP8B 2K5XA 2BHVA 3B5IA 2K94A 2GDYA 3CMEP 2ONTA 2LL8A 2JO0A 5BS2A 2Y4ZA 3DS5A 4PWVB 4NEOA 3CCVP 3CC2P 2FQ1A 3H4EA 2ROQA 4U0FA 2LPKA 2PEKA 2Z45A 2EHTA 5HGKA 2KOSA 2GZGA 5JPAA 1RO2A 2CQ8A 1M9DC 3CCMP 1YJNP 4E91A 2DNWA 1YJWP 2N50A 1D1DA 1Z6MA 2KGAA 2KGDA 4J93A 2MVUA 2KGFA 1M9FC 2KR5A 2QA4P 2XGUA 2FQ2A 2AVAA 2LIWA 1N8RQ 2AFDA 1Q82Q 2OTJP 3CXCO 3EJDA 1M6EX 1VQMP 2VLQA 4BPHA 4H2XC 4F37A 4DG9A 1U7KA 3I56P 2KOPA 1VQ5P 2BUOA 1L0HA 3DS3A 3EJEA 2KOQA 2KORA 1T8KA 5F2OA 1M1KQ 4GR6A 3CCJP 4XRQA 2XT1A 5BS1A 3EJBA 2VLPA 1P7NA 2GZEA 1VQ4P 1M74A 2QNWA 2KGCA 3G29A 3HYBA 4U0EA 1AUMA 2FHSC 2VLOA 3CD6P 2L22A 4LQWC 3OW2O 1NJIQ 2GOLB 2AF8A 2L4BA 2GDWA 3RG6C 2EG5A 2JGPA 4INBA 1RNIA 1ZMBA 2LF4A 1VQ7P 1YI2P 1GXHA 2N6YA 1DV5A 2PNGA 2JBGA 3DTJA 2PEQA 2KG8A 2L0QA 3VRLC 2AFEA 2N5HA 1KD1Q 2VLNA 1KLPA 4E92A 3G28A 1F80D 3LRYA 5EW5E 1BAJA
chains in the Genus database with same CATH topology
3P05A 2Z44A 1YJNP 4E91A 1QRJA 3HZQA 5I4TG 4WYMA 1YJWP 3WBHA 1KQSO 1D1DA 2OTLP 3CCQP 4GR2A 1M9XC 3M1MA 2X82A 1YITP 1Q81Q 2PENA 4J93A 1VQPP 1AFVA 2PXRC 5F2KA 2KGFA 3G1GA 3CMAP 1M9FC 1M6NA 1Q86Q 4XROA 4NX4C 1EOQA 3MGEA 3DS4A 2QA4P 2XGUA 3NTEA 2XDEA 3G6EP 2PEOA 2PEIA 5DCKA 2JPRA 3CC4P 1Q7YQ 1N8RQ 1Q82Q 2OTJP 2X2DD 4PH1A 2XXMA 2M8PA 3CXCO 3G21A 3CPWO 4COPA 1M6EX 2PY8A 1K9MQ 4PH3A 2GONA 2PWMA 1VQMP 1VQ6P 1EM9A 2XGYA 3G71P 1W2BO 2E1MA 3G1IA 3CCUP 1M90Q 1YHQP 5HGOA 1U7KA 4QNBA 3I56P 1AK4C 4XFYA 2M8NA 3G4SP 1VQ5P 2JYGA 1IUQA 2BUOA 3DS2A 1K73Q 3H47A 1E6JP 4DGEC 3DS3A 1JJ2O 2EIAA 3DS1A 2CWOA 3H0DA 2WLVA 1EIAA 4XFXA 4B4NA 3Q20A 2PWOA 1K30A 3BP9A 2PEMA 3G0VA 4U0CA 5F2OA 3CCEP 1M1KQ 3E2DA 4GR6A 2QEXP 3CCJP 1KC8Q 1K8AQ 5HGNA 4M0IA 4U0DA 4XRQA 2KODA 1M9YC 4HTWA 2JYLA 2XT1A 1M9CC 5BS1A 4PH2A 1G03A 1VQNP 1GWPA 2PEJA 1RO0A 2OARA 4U0BA 3CCLP 3G26A 1VQ9P 1P7NA 1L6NA 4XFZA 1YJ9P 1VQ4P 1YIJP 1M74A 4IPYA 3G29A 1A8OA 1M9EC 3HYBA 1S72P 4U0EA 5F2NA 1AUMA 1VQKP 2M8LA 3CD6P 4LQWC 2BHVA 3B5IA 3OW2O 3CCRP 2XGVA 1NJIQ 1VQOP 2GOLB 1VQ8P 3CMEP 2ONTA 1A43A 2L6EA 2JO0A 3RG6C 5BS2A 5HGLA 2EG5A 2Y4ZA 4INBA 1RNIA 1ZMBA 2XV6A 3DS5A 3CCVP 2LF4A 1VQ7P 1YI2P 3CC2P 3DS0A 2X83A 3H4EA 4U0FA 2V4XA 3DPHA 1QVGO 2Z46A 1VQLP 2PEKA 2PEQA 3DTJA 2EFJA 2Z45A 3I55P 3VRLC 4COCA 5HGKA 4PH0A 5HGMA 2P9XA 2DGYA 1KD1Q 5JPAA 4E92A 1QVFO 2WLVB 3G28A 4U0AA 1RO2A 3LRYA 1M9DC 3CCSP 3CC7P 1BAJA 4DGAC 3CCMP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P05 A;  4E91 A;  1QRJ A;  5I4T G;  4WYM A;  1D1D A;  1M9X C;  2X82 A;  4J93 A;  1AFV A;  2PXR C;  2KGF A;  3G1G A;  1M9F C;  4XRO A;  4NX4 C;  1EOQ A;  3MGE A;  3DS4 A;  2XGU A;  3NTE A;  2XDE A;  5DCK A;  2JPR A;  2X2D D;  4PH1 A;  2XXM A;  2M8P A;  3G21 A;  4COP A;  4PH3 A;  2GON A;  2PWM A;  1EM9 A;  2XGY A;  3G1I A;  5HGO A;  1U7K A;  4QNB A;  1AK4 C;  4XFY A;  2M8N A;  2JYG A;  2BUO A;  3DS2 A;  3H47 A;  1E6J P;  4DGE C;  3DS3 A;  2EIA A;  3DS1 A;  2WLV A;  1EIA A;  4XFX A;  4B4N A;  2PWO A;  3G0V A;  3BP9 A;  4U0C A;  5HGN A;  4M0I A;  4U0D A;  4XRQ A;  2KOD A;  1M9Y C;  4HTW A;  2JYL A;  2XT1 A;  1M9C C;  4PH2 A;  1G03 A;  1GWP A;  4U0B A;  3G26 A;  1P7N A;  1L6N A;  4XFZ A;  4IPY A;  3G29 A;  1A8O A;  1M9E C;  4U0E A;  1AUM A;  2M8L A;  4LQW C;  2XGV A;  2GOL B;  2ONT A;  1A43 A;  2L6E A;  2JO0 A;  5HGL A;  2Y4Z A;  4INB A;  2XV6 A;  3DS5 A;  2LF4 A;  3DS0 A;  2X83 A;  3H4E A;  4U0F A;  2V4X A;  3DPH A;  3DTJ A;  3VRL C;  4COC A;  5HGK A;  4PH0 A;  5HGM A;  5JPA A;  4E92 A;  2WLV B;  3G28 A;  4U0A A;  3LRY A;  1M9D C;  1BAJ A;  4DGA C; 
#chains in the Genus database with same CATH topology
 2Z44 A;  5I4T G;  3WBH A;  2MY5 A;  1M9X C;  3M1M A;  1UNK A;  5KP6 B;  2MR8 A;  2K93 A;  2PEN A;  1AFV A;  2PXR C;  3G1G A;  4CA3 A;  4XRO A;  2GDX A;  1EOQ A;  3G6E P;  2PEO A;  3CC4 P;  2MD9 A;  2X2D D;  2K0Y A;  2PY8 A;  1K9M Q;  1L0I A;  2N6Z A;  2GON A;  1EM9 A;  3G71 P;  3RG2 A;  1M90 Q;  1AYI A;  4QNB A;  4XFY A;  3G4S P;  2KG6 A;  1K73 Q;  5HV8 A;  1IUQ A;  3DS2 A;  3H47 A;  1E6J P;  2EIA A;  1UJZ A;  2WLV A;  4B4N A;  2PWO A;  1K30 A;  3BP9 A;  3GKL C;  3CCE P;  5HGN A;  4U0D A;  2KOD A;  4HTW A;  2OAR A;  1VQ9 P;  5EJD A;  1YJ9 P;  1OR5 A;  2KW2 A;  1M9E C;  2JAZ A;  2WPT A;  1VQK P;  2K2Q A;  2CG5 B;  2LIU A;  2LML A;  1E0H A;  2XGV A;  1VQ8 P;  1A43 A;  1X3O A;  5HGL A;  4MRT C;  3GJN A;  3GZM A;  2FAC A;  3DS0 A;  2X83 A;  2GZI A;  2JQ4 A;  1VQL P;  2CNR A;  2MF4 A;  2EFJ A;  4R0M A;  2GYK A;  5HGM A;  2P9X A;  2DGY A;  2WLV B;  2KWL A;  1MZ8 A;  4H2W C;  5KP7 B;  2MVV A;  2KGE A;  2M5R A;  3HZQ A;  1QRJ A;  2FAD A;  2JU2 A;  1KQS O;  2N98 A;  2JB0 A;  3CCQ P;  2X82 A;  1YIT P;  2K0D X;  3CMA P;  4IZ6 A;  3GZL A;  3MGE A;  3DS4 A;  3NTE A;  2XDE A;  5DCK A;  1GXG A;  2PEI A;  1GPJ A;  1Q7Y Q;  4PH1 A;  2FVE A;  1DNY A;  2FVA A;  4QKO A;  4PH3 A;  2PWM A;  2XGY A;  3B4Q A;  3U43 A;  1W2B O;  1ZNV A;  2E1M A;  3CCU P;  1YHQ P;  5HGO A;  2FQ0 A;  2JYG A;  1JJ2 O;  2CWO A;  2LKI A;  2PEM A;  4U0C A;  2QEX P;  1KC8 Q;  1K8A Q;  2NO8 A;  1NQ4 A;  2LOL A;  4M0I A;  3CE7 A;  2ERH A;  1M9Y C;  4UHP B;  2JYL A;  4BPG A;  1G03 A;  2PEJ A;  4BPF A;  1VKU A;  4U0B A;  3CCL P;  3G26 A;  2KG9 A;  5HVC A;  1L6N A;  4XFZ A;  1YIJ P;  1VHN A;  1S72 P;  5F2N A;  2X2B A;  1IMQ A;  1EMV A;  1BXI A;  3CCR P;  1VQO P;  2KOO A;  2L6E A;  2FVF A;  2VSQ A;  2XV6 A;  2FAE A;  2V4X A;  3DPH A;  1QVG O;  2Z46 A;  2L9F A;  3I55 P;  2LTE A;  4COC A;  4HKG A;  2MR7 A;  4PH0 A;  1QVF O;  2N5I A;  4U0A A;  1HY8 A;  2XZ0 D;  3CCS P;  2EHS A;  3CC7 P;  4DGA C;  3P05 A;  5CZD B;  4WYM A;  1HQB A;  2OTL P;  4GR2 A;  1ACP A;  1Q81 Q;  2XZ1 C;  1VQP P;  5F2K A;  1M6N A;  3LMO A;  1Q86 Q;  4NX4 C;  1CEI A;  2GZF A;  7CEI A;  2JPR A;  2XXM A;  2M8P A;  1AF8 A;  2CGQ A;  3G21 A;  3CPW O;  4COP A;  4H2Y C;  1VQ6 P;  2K0X A;  3G1I A;  4PXH B;  2JU1 A;  1AK4 C;  2M8N A;  2GZJ A;  4DGE C;  3NY7 B;  3DS1 A;  1IMP A;  3H0D A;  1EIA A;  4XFX A;  3Q20 A;  3G0V A;  3E2D A;  2K92 A;  1FR2 A;  1M9C C;  4PH2 A;  1VQN P;  1GWP A;  1RO0 A;  4IPY A;  1A8O A;  2M8L A;  5KP8 B;  2K5X A;  2BHV A;  3B5I A;  2K94 A;  2GDY A;  3CME P;  2ONT A;  2LL8 A;  2JO0 A;  5BS2 A;  2Y4Z A;  3DS5 A;  4PWV B;  4NEO A;  3CCV P;  3CC2 P;  2FQ1 A;  3H4E A;  2ROQ A;  4U0F A;  2LPK A;  2PEK A;  2Z45 A;  2EHT A;  5HGK A;  2KOS A;  2GZG A;  5JPA A;  1RO2 A;  2CQ8 A;  1M9D C;  3CCM P;  1YJN P;  4E91 A;  2DNW A;  1YJW P;  2N50 A;  1D1D A;  1Z6M A;  2KGA A;  2KGD A;  4J93 A;  2MVU A;  2KGF A;  1M9F C;  2KR5 A;  2QA4 P;  2XGU A;  2FQ2 A;  2AVA A;  2LIW A;  1N8R Q;  2AFD A;  1Q82 Q;  2OTJ P;  3CXC O;  3EJD A;  1M6E X;  1VQM P;  2VLQ A;  4BPH A;  4H2X C;  4F37 A;  4DG9 A;  1U7K A;  3I56 P;  2KOP A;  1VQ5 P;  2BUO A;  1L0H A;  3DS3 A;  3EJE A;  2KOQ A;  2KOR A;  1T8K A;  5F2O A;  1M1K Q;  4GR6 A;  3CCJ P;  4XRQ A;  2XT1 A;  5BS1 A;  3EJB A;  2VLP A;  1P7N A;  2GZE A;  1VQ4 P;  1M74 A;  2QNW A;  2KGC A;  3G29 A;  3HYB A;  4U0E A;  1AUM A;  2FHS C;  2VLO A;  3CD6 P;  2L22 A;  4LQW C;  3OW2 O;  1NJI Q;  2GOL B;  2AF8 A;  2L4B A;  2GDW A;  3RG6 C;  2EG5 A;  2JGP A;  4INB A;  1RNI A;  1ZMB A;  2LF4 A;  1VQ7 P;  1YI2 P;  1GXH A;  2N6Y A;  1DV5 A;  2PNG A;  2JBG A;  3DTJ A;  2PEQ A;  2KG8 A;  2L0Q A;  3VRL C;  2AFE A;  2N5H A;  1KD1 Q;  2VLN A;  1KLP A;  4E92 A;  3G28 A;  1F80 D;  3LRY A;  5EW5 E;  1BAJ A; 
#chains in the Genus database with same CATH homology
 3P05 A;  2Z44 A;  1YJN P;  4E91 A;  1QRJ A;  3HZQ A;  5I4T G;  4WYM A;  1YJW P;  3WBH A;  1KQS O;  1D1D A;  2OTL P;  3CCQ P;  4GR2 A;  1M9X C;  3M1M A;  2X82 A;  1YIT P;  1Q81 Q;  2PEN A;  4J93 A;  1VQP P;  1AFV A;  2PXR C;  5F2K A;  2KGF A;  3G1G A;  3CMA P;  1M9F C;  1M6N A;  1Q86 Q;  4XRO A;  4NX4 C;  1EOQ A;  3MGE A;  3DS4 A;  2QA4 P;  2XGU A;  3NTE A;  2XDE A;  3G6E P;  2PEO A;  2PEI A;  5DCK A;  2JPR A;  3CC4 P;  1Q7Y Q;  1N8R Q;  1Q82 Q;  2OTJ P;  2X2D D;  4PH1 A;  2XXM A;  2M8P A;  3CXC O;  3G21 A;  3CPW O;  4COP A;  1M6E X;  2PY8 A;  1K9M Q;  4PH3 A;  2GON A;  2PWM A;  1VQM P;  1VQ6 P;  1EM9 A;  2XGY A;  3G71 P;  1W2B O;  2E1M A;  3G1I A;  3CCU P;  1M90 Q;  1YHQ P;  5HGO A;  1U7K A;  4QNB A;  3I56 P;  1AK4 C;  4XFY A;  2M8N A;  3G4S P;  1VQ5 P;  2JYG A;  1IUQ A;  2BUO A;  3DS2 A;  1K73 Q;  3H47 A;  1E6J P;  4DGE C;  3DS3 A;  1JJ2 O;  2EIA A;  3DS1 A;  2CWO A;  3H0D A;  2WLV A;  1EIA A;  4XFX A;  4B4N A;  3Q20 A;  2PWO A;  1K30 A;  3BP9 A;  2PEM A;  3G0V A;  4U0C A;  5F2O A;  3CCE P;  1M1K Q;  3E2D A;  4GR6 A;  2QEX P;  3CCJ P;  1KC8 Q;  1K8A Q;  5HGN A;  4M0I A;  4U0D A;  4XRQ A;  2KOD A;  1M9Y C;  4HTW A;  2JYL A;  2XT1 A;  1M9C C;  5BS1 A;  4PH2 A;  1G03 A;  1VQN P;  1GWP A;  2PEJ A;  1RO0 A;  2OAR A;  4U0B A;  3CCL P;  3G26 A;  1VQ9 P;  1P7N A;  1L6N A;  4XFZ A;  1YJ9 P;  1VQ4 P;  1YIJ P;  1M74 A;  4IPY A;  3G29 A;  1A8O A;  1M9E C;  3HYB A;  1S72 P;  4U0E A;  5F2N A;  1AUM A;  1VQK P;  2M8L A;  3CD6 P;  4LQW C;  2BHV A;  3B5I A;  3OW2 O;  3CCR P;  2XGV A;  1NJI Q;  1VQO P;  2GOL B;  1VQ8 P;  3CME P;  2ONT A;  1A43 A;  2L6E A;  2JO0 A;  3RG6 C;  5BS2 A;  5HGL A;  2EG5 A;  2Y4Z A;  4INB A;  1RNI A;  1ZMB A;  2XV6 A;  3DS5 A;  3CCV P;  2LF4 A;  1VQ7 P;  1YI2 P;  3CC2 P;  3DS0 A;  2X83 A;  3H4E A;  4U0F A;  2V4X A;  3DPH A;  1QVG O;  2Z46 A;  1VQL P;  2PEK A;  2PEQ A;  3DTJ A;  2EFJ A;  2Z45 A;  3I55 P;  3VRL C;  4COC A;  5HGK A;  4PH0 A;  5HGM A;  2P9X A;  2DGY A;  1KD1 Q;  5JPA A;  4E92 A;  1QVF O;  2WLV B;  3G28 A;  4U0A A;  1RO2 A;  3LRY A;  1M9D C;  3CCS P;  3CC7 P;  1BAJ A;  4DGA C;  3CCM P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...