1M9FC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m complex.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAMGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/viral protein
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9fC00
5HGMA 1U7KA 2X82A 4XFYA 1AFVA 1L6NA 2X83A 2X2DD 4NX4C 4XFZA 2GOLB 1M9CC 1M9FC 4U0BA 2WLVB 4U0AA 4QNBA 4B4NA 2WLVA 2PWMA 4DGAC 4PH0A 2V4XA 2PWOA 1GWPA 2JPRA 4J93A 4XRQA 2M8LA 4INBA 4LQWC 4U0EA 3H47A 4HTWA 2KGFA 1G03A 5HGLA 4E92A 4WYMA 2XGUA 2XGYA 2XDEA 1AK4C 5HGNA 2LF4A 2XGVA 3BP9A 4PH2A 4U0DA 4E91A 5HGKA 2PXRC 5JPAA 4DGEC 1P7NA 1M9XC 3P05A 3NTEA 3H4EA 2EIAA 4PH3A 4XROA 1M9EC 4U0CA 1M9DC 1EIAA 5HGOA 2Y4ZA 1D1DA 1QRJA 4XFXA 1EM9A 1M9YC 1E6JP 4U0FA 2GONA 3MGEA 2M8NA 2M8PA
chains in the Genus database with same CATH superfamily
5HGMA 1U7KA 2X82A 4XFYA 1AFVA 1L6NA 2X83A 2X2DD 4NX4C 4XFZA 2GOLB 1M9CC 1M9FC 4U0BA 2WLVB 4U0AA 4QNBA 4B4NA 2WLVA 2PWMA 4DGAC 4PH0A 2V4XA 2PWOA 1GWPA 2JPRA 4J93A 4XRQA 2M8LA 4INBA 4LQWC 4U0EA 3H47A 4HTWA 2KGFA 1G03A 5HGLA 4E92A 4WYMA 2XGUA 2XGYA 2XDEA 1AK4C 5HGNA 2LF4A 2XGVA 3BP9A 4PH2A 4U0DA 4E91A 5HGKA 2PXRC 5JPAA 4DGEC 1P7NA 1M9XC 3P05A 3NTEA 3H4EA 2EIAA 4PH3A 4XROA 1M9EC 4U0CA 1M9DC 1EIAA 5HGOA 2Y4ZA 1D1DA 1QRJA 4XFXA 1EM9A 1M9YC 1E6JP 4U0FA 2GONA 3MGEA 2M8NA 2M8PA
chains in the Genus database with same CATH topology
5HGMA 1U7KA 2X82A 4XFYA 1AFVA 1L6NA 2X83A 2X2DD 4NX4C 4XFZA 2GOLB 1M9CC 1M9FC 4U0BA 2WLVB 4U0AA 4QNBA 4B4NA 2WLVA 2PWMA 4DGAC 4PH0A 2V4XA 2PWOA 1GWPA 2JPRA 4J93A 4XRQA 2M8LA 4INBA 4LQWC 4U0EA 3H47A 4HTWA 2KGFA 1G03A 5HGLA 4E92A 4WYMA 2XGUA 2XGYA 2XDEA 1AK4C 5HGNA 2LF4A 2XGVA 3BP9A 4PH2A 4U0DA 4E91A 5HGKA 2PXRC 5JPAA 4DGEC 1P7NA 1M9XC 3P05A 3NTEA 3H4EA 2EIAA 4PH3A 4XROA 1M9EC 4U0CA 1M9DC 1EIAA 5HGOA 2Y4ZA 1D1DA 1QRJA 4XFXA 1EM9A 1M9YC 1E6JP 4U0FA 2GONA 3MGEA 2M8NA 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGM A;  1U7K A;  2X82 A;  4XFY A;  1AFV A;  1L6N A;  2X83 A;  2X2D D;  4NX4 C;  4XFZ A;  2GOL B;  1M9C C;  1M9F C;  4U0B A;  2WLV B;  4U0A A;  4QNB A;  4B4N A;  2WLV A;  2PWM A;  4DGA C;  4PH0 A;  2V4X A;  2PWO A;  1GWP A;  2JPR A;  4J93 A;  4XRQ A;  2M8L A;  4INB A;  4LQW C;  4U0E A;  3H47 A;  4HTW A;  2KGF A;  1G03 A;  5HGL A;  4E92 A;  4WYM A;  2XGU A;  2XGY A;  2XDE A;  1AK4 C;  5HGN A;  2LF4 A;  2XGV A;  3BP9 A;  4PH2 A;  4U0D A;  4E91 A;  5HGK A;  2PXR C;  5JPA A;  4DGE C;  1P7N A;  1M9X C;  3P05 A;  3NTE A;  3H4E A;  2EIA A;  4PH3 A;  4XRO A;  1M9E C;  4U0C A;  1M9D C;  1EIA A;  5HGO A;  2Y4Z A;  1D1D A;  1QRJ A;  4XFX A;  1EM9 A;  1M9Y C;  1E6J P;  4U0F A;  2GON A;  3MGE A;  2M8N A;  2M8P A; 
#chains in the Genus database with same CATH topology
 5HGM A;  1U7K A;  2X82 A;  4XFY A;  1AFV A;  1L6N A;  2X83 A;  2X2D D;  4NX4 C;  4XFZ A;  2GOL B;  1M9C C;  1M9F C;  4U0B A;  2WLV B;  4U0A A;  4QNB A;  4B4N A;  2WLV A;  2PWM A;  4DGA C;  4PH0 A;  2V4X A;  2PWO A;  1GWP A;  2JPR A;  4J93 A;  4XRQ A;  2M8L A;  4INB A;  4LQW C;  4U0E A;  3H47 A;  4HTW A;  2KGF A;  1G03 A;  5HGL A;  4E92 A;  4WYM A;  2XGU A;  2XGY A;  2XDE A;  1AK4 C;  5HGN A;  2LF4 A;  2XGV A;  3BP9 A;  4PH2 A;  4U0D A;  4E91 A;  5HGK A;  2PXR C;  5JPA A;  4DGE C;  1P7N A;  1M9X C;  3P05 A;  3NTE A;  3H4E A;  2EIA A;  4PH3 A;  4XRO A;  1M9E C;  4U0C A;  1M9D C;  1EIA A;  5HGO A;  2Y4Z A;  1D1D A;  1QRJ A;  4XFX A;  1EM9 A;  1M9Y C;  1E6J P;  4U0F A;  2GON A;  3MGE A;  2M8N A;  2M8P A; 
#chains in the Genus database with same CATH homology
 5HGM A;  1U7K A;  2X82 A;  4XFY A;  1AFV A;  1L6N A;  2X83 A;  2X2D D;  4NX4 C;  4XFZ A;  2GOL B;  1M9C C;  1M9F C;  4U0B A;  2WLV B;  4U0A A;  4QNB A;  4B4N A;  2WLV A;  2PWM A;  4DGA C;  4PH0 A;  2V4X A;  2PWO A;  1GWP A;  2JPR A;  4J93 A;  4XRQ A;  2M8L A;  4INB A;  4LQW C;  4U0E A;  3H47 A;  4HTW A;  2KGF A;  1G03 A;  5HGL A;  4E92 A;  4WYM A;  2XGU A;  2XGY A;  2XDE A;  1AK4 C;  5HGN A;  2LF4 A;  2XGV A;  3BP9 A;  4PH2 A;  4U0D A;  4E91 A;  5HGK A;  2PXR C;  5JPA A;  4DGE C;  1P7N A;  1M9X C;  3P05 A;  3NTE A;  3H4E A;  2EIA A;  4PH3 A;  4XRO A;  1M9E C;  4U0C A;  1M9D C;  1EIA A;  5HGO A;  2Y4Z A;  1D1D A;  1QRJ A;  4XFX A;  1EM9 A;  1M9Y C;  1E6J P;  4U0F A;  2GON A;  3MGE A;  2M8N A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...