1M9FC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m complex.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAMGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 50
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9fC00
4QNBA 2X82A 2XGUA 4DGAC 1D1DA 3P05A 5HGKA 1M9DC 4J93A 3NTEA 4INBA 1P7NA 5HGMA 2X2DD 2EIAA 2KGFA 1M9YC 2GONA 4U0EA 4HTWA 1M9CC 2XGVA 2JPRA 4XFYA 4U0BA 2PWMA 4U0CA 2GOLB 2WLVB 4NX4C 2Y4ZA 4PH0A 1EIAA 3BP9A 4LQWC 4B4NA 4PH2A 5HGLA 3MGEA 4PH3A 4DGEC 4E91A 2LF4A 4XFXA 4XFZA 1AK4C 2V4XA 1M9FC 4XROA 1U7KA 2M8PA 2XGYA 4U0FA 4XRQA 4WYMA 1M9XC 4E92A 2M8NA 4U0AA 1G03A 1E6JP 1EM9A 5HGOA 1L6NA 2X83A 1QRJA 4U0DA 1M9EC 3H47A 2XDEA 5HGNA 1AFVA 5JPAA 1GWPA 2PWOA 2M8LA 2PXRC 2WLVA 3H4EA
chains in the Genus database with same CATH superfamily
4QNBA 2X82A 2XGUA 4DGAC 1D1DA 3P05A 5HGKA 1M9DC 4J93A 3NTEA 4INBA 1P7NA 5HGMA 2X2DD 2EIAA 2KGFA 1M9YC 2GONA 4U0EA 4HTWA 1M9CC 2XGVA 2JPRA 4XFYA 4U0BA 2PWMA 4U0CA 2GOLB 2WLVB 4NX4C 2Y4ZA 4PH0A 1EIAA 3BP9A 4LQWC 4B4NA 4PH2A 5HGLA 3MGEA 4PH3A 4DGEC 4E91A 2LF4A 4XFXA 4XFZA 1AK4C 2V4XA 1M9FC 4XROA 1U7KA 2M8PA 2XGYA 4U0FA 4XRQA 4WYMA 1M9XC 4E92A 2M8NA 4U0AA 1G03A 1E6JP 1EM9A 5HGOA 1L6NA 2X83A 1QRJA 4U0DA 1M9EC 3H47A 2XDEA 5HGNA 1AFVA 5JPAA 1GWPA 2PWOA 2M8LA 2PXRC 2WLVA 3H4EA
chains in the Genus database with same CATH topology
4QNBA 2X82A 2XGUA 4DGAC 1D1DA 3P05A 5HGKA 1M9DC 4J93A 3NTEA 4INBA 1P7NA 5HGMA 2X2DD 2EIAA 2KGFA 1M9YC 2GONA 4U0EA 4HTWA 1M9CC 2XGVA 2JPRA 4XFYA 4U0BA 2PWMA 4U0CA 2GOLB 2WLVB 4NX4C 2Y4ZA 4PH0A 1EIAA 3BP9A 4LQWC 4B4NA 4PH2A 5HGLA 3MGEA 4PH3A 4DGEC 4E91A 2LF4A 4XFXA 4XFZA 1AK4C 2V4XA 1M9FC 4XROA 1U7KA 2M8PA 2XGYA 4U0FA 4XRQA 4WYMA 1M9XC 4E92A 2M8NA 4U0AA 1G03A 1E6JP 1EM9A 5HGOA 1L6NA 2X83A 1QRJA 4U0DA 1M9EC 3H47A 2XDEA 5HGNA 1AFVA 5JPAA 1GWPA 2PWOA 2M8LA 2PXRC 2WLVA 3H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNB A;  2X82 A;  2XGU A;  4DGA C;  1D1D A;  3P05 A;  5HGK A;  1M9D C;  4J93 A;  3NTE A;  4INB A;  1P7N A;  5HGM A;  2X2D D;  2EIA A;  2KGF A;  1M9Y C;  2GON A;  4U0E A;  4HTW A;  1M9C C;  2XGV A;  2JPR A;  4XFY A;  4U0B A;  2PWM A;  4U0C A;  2GOL B;  2WLV B;  4NX4 C;  2Y4Z A;  4PH0 A;  1EIA A;  3BP9 A;  4LQW C;  4B4N A;  4PH2 A;  5HGL A;  3MGE A;  4PH3 A;  4DGE C;  4E91 A;  2LF4 A;  4XFX A;  4XFZ A;  1AK4 C;  2V4X A;  1M9F C;  4XRO A;  1U7K A;  2M8P A;  2XGY A;  4U0F A;  4XRQ A;  4WYM A;  1M9X C;  4E92 A;  2M8N A;  4U0A A;  1G03 A;  1E6J P;  1EM9 A;  5HGO A;  1L6N A;  2X83 A;  1QRJ A;  4U0D A;  1M9E C;  3H47 A;  2XDE A;  5HGN A;  1AFV A;  5JPA A;  1GWP A;  2PWO A;  2M8L A;  2PXR C;  2WLV A;  3H4E A; 
#chains in the Genus database with same CATH topology
 4QNB A;  2X82 A;  2XGU A;  4DGA C;  1D1D A;  3P05 A;  5HGK A;  1M9D C;  4J93 A;  3NTE A;  4INB A;  1P7N A;  5HGM A;  2X2D D;  2EIA A;  2KGF A;  1M9Y C;  2GON A;  4U0E A;  4HTW A;  1M9C C;  2XGV A;  2JPR A;  4XFY A;  4U0B A;  2PWM A;  4U0C A;  2GOL B;  2WLV B;  4NX4 C;  2Y4Z A;  4PH0 A;  1EIA A;  3BP9 A;  4LQW C;  4B4N A;  4PH2 A;  5HGL A;  3MGE A;  4PH3 A;  4DGE C;  4E91 A;  2LF4 A;  4XFX A;  4XFZ A;  1AK4 C;  2V4X A;  1M9F C;  4XRO A;  1U7K A;  2M8P A;  2XGY A;  4U0F A;  4XRQ A;  4WYM A;  1M9X C;  4E92 A;  2M8N A;  4U0A A;  1G03 A;  1E6J P;  1EM9 A;  5HGO A;  1L6N A;  2X83 A;  1QRJ A;  4U0D A;  1M9E C;  3H47 A;  2XDE A;  5HGN A;  1AFV A;  5JPA A;  1GWP A;  2PWO A;  2M8L A;  2PXR C;  2WLV A;  3H4E A; 
#chains in the Genus database with same CATH homology
 4QNB A;  2X82 A;  2XGU A;  4DGA C;  1D1D A;  3P05 A;  5HGK A;  1M9D C;  4J93 A;  3NTE A;  4INB A;  1P7N A;  5HGM A;  2X2D D;  2EIA A;  2KGF A;  1M9Y C;  2GON A;  4U0E A;  4HTW A;  1M9C C;  2XGV A;  2JPR A;  4XFY A;  4U0B A;  2PWM A;  4U0C A;  2GOL B;  2WLV B;  4NX4 C;  2Y4Z A;  4PH0 A;  1EIA A;  3BP9 A;  4LQW C;  4B4N A;  4PH2 A;  5HGL A;  3MGE A;  4PH3 A;  4DGE C;  4E91 A;  2LF4 A;  4XFX A;  4XFZ A;  1AK4 C;  2V4X A;  1M9F C;  4XRO A;  1U7K A;  2M8P A;  2XGY A;  4U0F A;  4XRQ A;  4WYM A;  1M9X C;  4E92 A;  2M8N A;  4U0A A;  1G03 A;  1E6J P;  1EM9 A;  5HGO A;  1L6N A;  2X83 A;  1QRJ A;  4U0D A;  1M9E C;  3H47 A;  2XDE A;  5HGN A;  1AFV A;  5JPA A;  1GWP A;  2PWO A;  2M8L A;  2PXR C;  2WLV A;  3H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...