1M9FC

X-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m complex.
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
146
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVAMGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cyclophilin A
publication title Structural insights into the catalytic mechanism of cyclophilin A
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/viral protein
total genus 50
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1m9fC00
4U0AA 5HGMA 2JPRA 4J93A 4NX4C 2PXRC 4DGEC 5HGNA 4XFZA 2M8NA 2X2DD 1EIAA 3H4EA 1QRJA 1M9FC 4U0EA 3H47A 1E6JP 2X82A 4XFYA 4PH0A 2LF4A 5HGOA 1AFVA 2V4XA 5JPAA 2M8LA 1M9YC 2WLVB 4WYMA 1P7NA 2XDEA 2X83A 4U0DA 4U0FA 4E92A 3NTEA 3BP9A 1M9EC 2EIAA 4DGAC 3MGEA 4U0BA 4LQWC 4XROA 4HTWA 1M9DC 2XGVA 1L6NA 2PWMA 5HGKA 1AK4C 1G03A 1EM9A 4INBA 2PWOA 2M8PA 4PH2A 4XRQA 1M9XC 2XGYA 3P05A 4PH3A 5HGLA 1M9CC 4QNBA 2GONA 4E91A 2Y4ZA 1D1DA 4B4NA 2GOLB 1U7KA 4U0CA 2XGUA 4XFXA 1GWPA 2KGFA 2WLVA
chains in the Genus database with same CATH superfamily
4U0AA 5HGMA 2JPRA 4J93A 4NX4C 2PXRC 4DGEC 5HGNA 4XFZA 2M8NA 2X2DD 1EIAA 3H4EA 1QRJA 1M9FC 4U0EA 3H47A 1E6JP 2X82A 4XFYA 4PH0A 2LF4A 5HGOA 1AFVA 2V4XA 5JPAA 2M8LA 1M9YC 2WLVB 4WYMA 1P7NA 2XDEA 2X83A 4U0DA 4U0FA 4E92A 3NTEA 3BP9A 1M9EC 2EIAA 4DGAC 3MGEA 4U0BA 4LQWC 4XROA 4HTWA 1M9DC 2XGVA 1L6NA 2PWMA 5HGKA 1AK4C 1G03A 1EM9A 4INBA 2PWOA 2M8PA 4PH2A 4XRQA 1M9XC 2XGYA 3P05A 4PH3A 5HGLA 1M9CC 4QNBA 2GONA 4E91A 2Y4ZA 1D1DA 4B4NA 2GOLB 1U7KA 4U0CA 2XGUA 4XFXA 1GWPA 2KGFA 2WLVA
chains in the Genus database with same CATH topology
4U0AA 5HGMA 2JPRA 4J93A 4NX4C 2PXRC 4DGEC 5HGNA 4XFZA 2M8NA 2X2DD 1EIAA 3H4EA 1QRJA 1M9FC 4U0EA 3H47A 1E6JP 2X82A 4XFYA 4PH0A 2LF4A 5HGOA 1AFVA 2V4XA 5JPAA 2M8LA 1M9YC 2WLVB 4WYMA 1P7NA 2XDEA 2X83A 4U0DA 4U0FA 4E92A 3NTEA 3BP9A 1M9EC 2EIAA 4DGAC 3MGEA 4U0BA 4LQWC 4XROA 4HTWA 1M9DC 2XGVA 1L6NA 2PWMA 5HGKA 1AK4C 1G03A 1EM9A 4INBA 2PWOA 2M8PA 4PH2A 4XRQA 1M9XC 2XGYA 3P05A 4PH3A 5HGLA 1M9CC 4QNBA 2GONA 4E91A 2Y4ZA 1D1DA 4B4NA 2GOLB 1U7KA 4U0CA 2XGUA 4XFXA 1GWPA 2KGFA 2WLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0A A;  5HGM A;  2JPR A;  4J93 A;  4NX4 C;  2PXR C;  4DGE C;  5HGN A;  4XFZ A;  2M8N A;  2X2D D;  1EIA A;  3H4E A;  1QRJ A;  1M9F C;  4U0E A;  3H47 A;  1E6J P;  2X82 A;  4XFY A;  4PH0 A;  2LF4 A;  5HGO A;  1AFV A;  2V4X A;  5JPA A;  2M8L A;  1M9Y C;  2WLV B;  4WYM A;  1P7N A;  2XDE A;  2X83 A;  4U0D A;  4U0F A;  4E92 A;  3NTE A;  3BP9 A;  1M9E C;  2EIA A;  4DGA C;  3MGE A;  4U0B A;  4LQW C;  4XRO A;  4HTW A;  1M9D C;  2XGV A;  1L6N A;  2PWM A;  5HGK A;  1AK4 C;  1G03 A;  1EM9 A;  4INB A;  2PWO A;  2M8P A;  4PH2 A;  4XRQ A;  1M9X C;  2XGY A;  3P05 A;  4PH3 A;  5HGL A;  1M9C C;  4QNB A;  2GON A;  4E91 A;  2Y4Z A;  1D1D A;  4B4N A;  2GOL B;  1U7K A;  4U0C A;  2XGU A;  4XFX A;  1GWP A;  2KGF A;  2WLV A; 
#chains in the Genus database with same CATH topology
 4U0A A;  5HGM A;  2JPR A;  4J93 A;  4NX4 C;  2PXR C;  4DGE C;  5HGN A;  4XFZ A;  2M8N A;  2X2D D;  1EIA A;  3H4E A;  1QRJ A;  1M9F C;  4U0E A;  3H47 A;  1E6J P;  2X82 A;  4XFY A;  4PH0 A;  2LF4 A;  5HGO A;  1AFV A;  2V4X A;  5JPA A;  2M8L A;  1M9Y C;  2WLV B;  4WYM A;  1P7N A;  2XDE A;  2X83 A;  4U0D A;  4U0F A;  4E92 A;  3NTE A;  3BP9 A;  1M9E C;  2EIA A;  4DGA C;  3MGE A;  4U0B A;  4LQW C;  4XRO A;  4HTW A;  1M9D C;  2XGV A;  1L6N A;  2PWM A;  5HGK A;  1AK4 C;  1G03 A;  1EM9 A;  4INB A;  2PWO A;  2M8P A;  4PH2 A;  4XRQ A;  1M9X C;  2XGY A;  3P05 A;  4PH3 A;  5HGL A;  1M9C C;  4QNB A;  2GON A;  4E91 A;  2Y4Z A;  1D1D A;  4B4N A;  2GOL B;  1U7K A;  4U0C A;  2XGU A;  4XFX A;  1GWP A;  2KGF A;  2WLV A; 
#chains in the Genus database with same CATH homology
 4U0A A;  5HGM A;  2JPR A;  4J93 A;  4NX4 C;  2PXR C;  4DGE C;  5HGN A;  4XFZ A;  2M8N A;  2X2D D;  1EIA A;  3H4E A;  1QRJ A;  1M9F C;  4U0E A;  3H47 A;  1E6J P;  2X82 A;  4XFY A;  4PH0 A;  2LF4 A;  5HGO A;  1AFV A;  2V4X A;  5JPA A;  2M8L A;  1M9Y C;  2WLV B;  4WYM A;  1P7N A;  2XDE A;  2X83 A;  4U0D A;  4U0F A;  4E92 A;  3NTE A;  3BP9 A;  1M9E C;  2EIA A;  4DGA C;  3MGE A;  4U0B A;  4LQW C;  4XRO A;  4HTW A;  1M9D C;  2XGV A;  1L6N A;  2PWM A;  5HGK A;  1AK4 C;  1G03 A;  1EM9 A;  4INB A;  2PWO A;  2M8P A;  4PH2 A;  4XRQ A;  1M9X C;  2XGY A;  3P05 A;  4PH3 A;  5HGL A;  1M9C C;  4QNB A;  2GON A;  4E91 A;  2Y4Z A;  1D1D A;  4B4N A;  2GOL B;  1U7K A;  4U0C A;  2XGU A;  4XFX A;  1GWP A;  2KGF A;  2WLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...