1E6JP

Crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
VHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutual Conformational Adaptations in Antigen and Antibody Upon Complex Formation between an Fab and HIV-1 Capsid Protein P24
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Viral protein
molecule keywords IMMUNOGLOBULIN
total genus 66
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1e6jP01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1e6jP02
4XRQA 3H4EA 3DS4A 3DS3A 1M9EC 4PH3A 4E91A 4IPYA 4HTWA 4XROA 4J93A 4COPA 1GWPA 4U0BA 4DGEC 1AK4C 4XFYA 3DS2A 4LQWC 5JPAA 5I4TG 1EOQA 2XGUA 5HGKA 2ONTA 2XGYA 5HGLA 1M9DC 1G03A 2JYLA 3LRYA 2XT1A 4XFXA 3DS1A 4NX4C 4U0FA 3G21A 4U0CA 1U7KA 2XXMA 2L6EA 3G29A 4U0AA 2PWOA 2WLVB 2KGFA 4XFZA 2M8PA 2GOLB 2PWMA 3H47A 1AFVA 2X83A 2M8LA 3G1GA 4E92A 2JO0A 2X2DD 3DPHA 4U0DA 5DCKA 3VRLC 3MGEA 3DS5A 2M8NA 2X82A 2BUOA 3NTEA 4QNBA 5HGOA 1M9YC 4PH2A 2Y4ZA 4INBA 4COCA 1M9FC 2XDEA 2EIAA 2JPRA 4U0EA 4B4NA 1A43A 3G1IA 4WYMA 1EM9A 4DGAC 2GONA 2PXRC 3DTJA 3DS0A 1L6NA 1A8OA 2KODA 2JYGA 3G0VA 1AUMA 3P05A 1P7NA 2LF4A 1E6JP 1EIAA 5HGMA 2WLVA 3G28A 2V4XA 3BP9A 2XV6A 4PH1A 1BAJA 5HGNA 3G26A 1M9CC 1M9XC 1D1DA 4PH0A 4M0IA 2XGVA 1QRJA
chains in the Genus database with same CATH superfamily
2K0DX 4H2XC 3WBHA 2CWOA 3H4EA 4R0MA 2MR7A 4PH3A 4HTWA 4XROA 4J93A 1GWPA 2ROQA 2E1MA 2VLNA 1AK4C 2LPKA 1VQ8P 1HQBA 2EFJA 3CE7A 5I4TG 1BXIA 3CMEP 4QKOA 2PEIA 1N8RQ 1M9DC 5EJDA 3GKLC 1IMQA 4GR6A 3I56P 3LRYA 2XT1A 4NX4C 3G21A 1W2BO 1Q86Q 2L22A 3H0DA 1GPJA 2PWMA 1AFVA 2MR8A 1YJWP 1KC8Q 1YHQP 2LKIA 2X2BA 2KGEA 1NQ4A 2X2DD 2Z44A 1VQ5P 5EW5E 2KG6A 2MVVA 1YJNP 4U0DA 4DG9A 5HV8A 3MGEA 2JB0A 1ZMBA 2X82A 1M9YC 3LMOA 4INBA 3G6EP 4U0EA 1KQSO 3G1IA 3EJDA 4WYMA 2VLOA 3U43A 1YIJP 3CC2P 2JGPA 2FVAA 1A8OA 1T8KA 1UNKA 4PXHB 2N6YA 3G0VA 3CCUP 2WLVA 2KG9A 2KW2A 3BP9A 2M5RA 2KR5A 5HGNA 2VSQA 2AFEA 3OW2O 2XGVA 5CZDB 2CNRA 2AVAA 3I55P 1GXHA 3CCVP 1Q7YQ 3Q20A 2N5HA 3RG6C 2KOQA 3B5IA 4DGEC 4XFYA 5JPAA 2KGAA 2EHTA 2GZIA 1RO0A 1UJZA 2XGYA 2FHSC 5KP6B 3G71P 1G03A 2JYLA 4XFXA 2FAEA 3DS1A 2JU1A 2XXMA 2PNGA 1VQ7P 2L6EA 3G29A 4MRTC 4BPGA 2PWOA 2VLPA 2KGFA 4H2WC 4XFZA 3H47A 2JAZA 1Q81Q 2GZEA 2KG8A 3B4QA 5BS1A 2EHSA 2L9FA 2P9XA 1RO2A 3EJEA 2GDYA 1E0HA 1M74A 2KWLA 3CPWO 4BPFA 2CQ8A 2M8NA 1GXGA 2QEXP 1M6NA 4UHPB 1KLPA 2LIWA 2Z46A 2QA4P 2GONA 3DS0A 1L6NA 2VLQA 2KODA 2FVFA 1AUMA 3P05A 2K2QA 1VQMP 1EIAA 3HYBA 1AF8A 3G28A 2CG5B 4PH1A 1BAJA 2GZJA 3G26A 2Z45A 1Z6MA 1M9XC 1YJ9P 4M0IA 1L0IA 1QRJA 3GZMA 3HZQA 2GDWA 1YITP 4XRQA 3DS4A 5HVCA 2KOPA 5F2KA 3CCSP 4HKGA 4E91A 1K30A 4IPYA 2MVUA 1VQKP 2EG5A 2FQ0A 4LQWC 2KOOA 1EOQA 1K73Q 5HGKA 2N5IA 1IUQA 2ONTA 2KGCA 5HGLA 2K0YA 2LL8A 3CCMP 2PENA 2GZGA 1NJIQ 2XZ1C 4U0FA 3CMAP 4U0CA 1VKUA 5KP8B 2ERHA 1KD1Q 4U0AA 2JQ4A 1AYIA 2M8PA 2K94A 2PY8A 2FQ1A 3NY7B 1VQLP 1DV5A 3G1GA 4F37A 2L4BA 1QVGO 3DPHA 4NEOA 1VQOP 2PEKA 1ZNVA 2XZ0D 2MY5A 3VRLC 3DS5A 2K93A 1IMPA 2BUOA 3NTEA 2QNWA 4IZ6A 2LMLA 2K5XA 1VQNP 2JPRA 2KGDA 4B4NA 2MD9A 1A43A 1YI2P 3EJBA 4DGAC 2PXRC 5F2OA 2CGQA 3CCEP 2GDXA 2N98A 2JYGA 2LOLA 2FQ2A 2PEMA 1QVFO 1VHNA 1K8AQ 1DNYA 1P7NA 2LF4A 3CD6P 2N6ZA 5HGMA 2V4XA 3CCLP 2K0XA 3CCJP 2FVEA 2BHVA 1VQ4P 1VQ9P 3DS3A 1M9EC 2N50A 3CC4P 4COPA 1JJ2O 4U0BA 4H2YC 2GYKA 2AFDA 2PEOA 7CEIA 4GR2A 3DS2A 5BS2A 2XGUA 2DNWA 2OTJP 1CEIA 2LTEA 2KORA 3GZLA 3M1MA 5F2NA 3G4SP 1VQPP 1F80D 1MZ8A 3CXCO 1ACPA 3CCQP 1U7KA 1X3OA 3CCRP 2AF8A 2LIUA 4CA3A 1Q82Q 2WLVB 2FACA 2GOLB 2GZFA 1S72P 2X83A 1VQ6P 5KP7B 2M8LA 4E92A 2JO0A 2KOSA 2DGYA 3RG2A 1M1KQ 2PEQA 4BPHA 3GJNA 1RNIA 1K9MQ 5DCKA 2FADA 2NO8A 3E2DA 2JU2A 2OTLP 4QNBA 5HGOA 4PH2A 2Y4ZA 4COCA 2JBGA 1M9FC 2XDEA 2EIAA 2PEJA 1L0HA 2OARA 1M6EX 2WPTA 1EM9A 1EMVA 4PWVB 3DTJA 1HY8A 3CC7P 1M90Q 1FR2A 2K92A 1E6JP 2MF4A 2L0QA 1OR5A 2XV6A 1M9CC 1D1DA 4PH0A
chains in the Genus database with same CATH topology
3CCLP 3CCJP 3HZQA 3WBHA 2BHVA 2CWOA 1YITP 4XRQA 3H4EA 3DS4A 3DS3A 5F2KA 3I55P 3CCSP 3CCVP 1Q7YQ 1VQ4P 1VQ9P 1M9EC 4PH3A 3Q20A 4E91A 1K30A 4HTWA 4IPYA 4XROA 4J93A 3CC4P 4COPA 1GWPA 3RG6C 1JJ2O 4U0BA 1VQKP 2E1MA 4DGEC 2PEOA 3B5IA 1AK4C 4XFYA 2EG5A 4GR2A 1VQ8P 3DS2A 4LQWC 2EFJA 5BS2A 5JPAA 5I4TG 1EOQA 1K73Q 2XGUA 3CMEP 5HGKA 1RO0A 1IUQA 2ONTA 2OTJP 2PEIA 2XGYA 1N8RQ 5HGLA 1M9DC 3CCMP 2PENA 3M1MA 3G71P 5F2NA 1NJIQ 4GR6A 1G03A 2JYLA 3I56P 3LRYA 2XT1A 3G4SP 4XFXA 1VQPP 3CXCO 3DS1A 4NX4C 4U0FA 3G21A 3CMAP 4U0CA 3CCQP 1U7KA 2XXMA 1W2BO 1Q86Q 3CCRP 1VQ7P 2L6EA 3G29A 1KD1Q 4U0AA 1Q82Q 2PWOA 2WLVB 2KGFA 3H0DA 4XFZA 2M8PA 2GOLB 2PWMA 2PY8A 3H47A 1AFVA 1YJWP 1KC8Q 1S72P 2X83A 1YHQP 1VQ6P 1Q81Q 1VQLP 2M8LA 5BS1A 3G1GA 2P9XA 4E92A 2JO0A 2X2DD 2Z44A 1VQ5P 1RO2A 2DGYA 1QVGO 3DPHA 1M1KQ 1VQOP 2PEKA 2PEQA 1RNIA 1K9MQ 1YJNP 4U0DA 5DCKA 1M74A 3VRLC 3CPWO 3MGEA 3DS5A 1ZMBA 2M8NA 2X82A 2BUOA 3E2DA 3NTEA 2OTLP 4QNBA 5HGOA 2QEXP 1M9YC 4PH2A 1M6NA 2Y4ZA 4INBA 3G6EP 4COCA 1M9FC 2XDEA 2EIAA 2JPRA 2PEJA 4U0EA 1VQNP 4B4NA 1KQSO 1A43A 2Z46A 2OARA 3G1IA 1YI2P 1M6EX 4WYMA 1EM9A 2QA4P 1YIJP 4DGAC 3CC2P 2GONA 2PXRC 3DTJA 5F2OA 3DS0A 3CCEP 3CC7P 1L6NA 1A8OA 2KODA 2JYGA 1M90Q 2PEMA 1QVFO 3G0VA 1K8AQ 1AUMA 3P05A 1P7NA 2LF4A 1VQMP 1E6JP 3CD6P 1EIAA 3HYBA 3CCUP 5HGMA 2WLVA 3G28A 2V4XA 3BP9A 2XV6A 4PH1A 1BAJA 5HGNA 3G26A 1M9CC 2Z45A 1M9XC 1D1DA 1YJ9P 4PH0A 4M0IA 3OW2O 2XGVA 1QRJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRQ A;  3H4E A;  3DS4 A;  3DS3 A;  1M9E C;  4PH3 A;  4E91 A;  4IPY A;  4HTW A;  4XRO A;  4J93 A;  4COP A;  1GWP A;  4U0B A;  4DGE C;  1AK4 C;  4XFY A;  3DS2 A;  4LQW C;  5JPA A;  5I4T G;  1EOQ A;  2XGU A;  5HGK A;  2ONT A;  2XGY A;  5HGL A;  1M9D C;  1G03 A;  2JYL A;  3LRY A;  2XT1 A;  4XFX A;  3DS1 A;  4NX4 C;  4U0F A;  3G21 A;  4U0C A;  1U7K A;  2XXM A;  2L6E A;  3G29 A;  4U0A A;  2PWO A;  2WLV B;  2KGF A;  4XFZ A;  2M8P A;  2GOL B;  2PWM A;  3H47 A;  1AFV A;  2X83 A;  2M8L A;  3G1G A;  4E92 A;  2JO0 A;  2X2D D;  3DPH A;  4U0D A;  5DCK A;  3VRL C;  3MGE A;  3DS5 A;  2M8N A;  2X82 A;  2BUO A;  3NTE A;  4QNB A;  5HGO A;  1M9Y C;  4PH2 A;  2Y4Z A;  4INB A;  4COC A;  1M9F C;  2XDE A;  2EIA A;  2JPR A;  4U0E A;  4B4N A;  1A43 A;  3G1I A;  4WYM A;  1EM9 A;  4DGA C;  2GON A;  2PXR C;  3DTJ A;  3DS0 A;  1L6N A;  1A8O A;  2KOD A;  2JYG A;  3G0V A;  1AUM A;  3P05 A;  1P7N A;  2LF4 A;  1E6J P;  1EIA A;  5HGM A;  2WLV A;  3G28 A;  2V4X A;  3BP9 A;  2XV6 A;  4PH1 A;  1BAJ A;  5HGN A;  3G26 A;  1M9C C;  1M9X C;  1D1D A;  4PH0 A;  4M0I A;  2XGV A;  1QRJ A; 
#chains in the Genus database with same CATH topology
 2K0D X;  4H2X C;  3WBH A;  2CWO A;  3H4E A;  4R0M A;  2MR7 A;  4PH3 A;  4HTW A;  4XRO A;  4J93 A;  1GWP A;  2ROQ A;  2E1M A;  2VLN A;  1AK4 C;  2LPK A;  1VQ8 P;  1HQB A;  2EFJ A;  3CE7 A;  5I4T G;  1BXI A;  3CME P;  4QKO A;  2PEI A;  1N8R Q;  1M9D C;  5EJD A;  3GKL C;  1IMQ A;  4GR6 A;  3I56 P;  3LRY A;  2XT1 A;  4NX4 C;  3G21 A;  1W2B O;  1Q86 Q;  2L22 A;  3H0D A;  1GPJ A;  2PWM A;  1AFV A;  2MR8 A;  1YJW P;  1KC8 Q;  1YHQ P;  2LKI A;  2X2B A;  2KGE A;  1NQ4 A;  2X2D D;  2Z44 A;  1VQ5 P;  5EW5 E;  2KG6 A;  2MVV A;  1YJN P;  4U0D A;  4DG9 A;  5HV8 A;  3MGE A;  2JB0 A;  1ZMB A;  2X82 A;  1M9Y C;  3LMO A;  4INB A;  3G6E P;  4U0E A;  1KQS O;  3G1I A;  3EJD A;  4WYM A;  2VLO A;  3U43 A;  1YIJ P;  3CC2 P;  2JGP A;  2FVA A;  1A8O A;  1T8K A;  1UNK A;  4PXH B;  2N6Y A;  3G0V A;  3CCU P;  2WLV A;  2KG9 A;  2KW2 A;  3BP9 A;  2M5R A;  2KR5 A;  5HGN A;  2VSQ A;  2AFE A;  3OW2 O;  2XGV A;  5CZD B;  2CNR A;  2AVA A;  3I55 P;  1GXH A;  3CCV P;  1Q7Y Q;  3Q20 A;  2N5H A;  3RG6 C;  2KOQ A;  3B5I A;  4DGE C;  4XFY A;  5JPA A;  2KGA A;  2EHT A;  2GZI A;  1RO0 A;  1UJZ A;  2XGY A;  2FHS C;  5KP6 B;  3G71 P;  1G03 A;  2JYL A;  4XFX A;  2FAE A;  3DS1 A;  2JU1 A;  2XXM A;  2PNG A;  1VQ7 P;  2L6E A;  3G29 A;  4MRT C;  4BPG A;  2PWO A;  2VLP A;  2KGF A;  4H2W C;  4XFZ A;  3H47 A;  2JAZ A;  1Q81 Q;  2GZE A;  2KG8 A;  3B4Q A;  5BS1 A;  2EHS A;  2L9F A;  2P9X A;  1RO2 A;  3EJE A;  2GDY A;  1E0H A;  1M74 A;  2KWL A;  3CPW O;  4BPF A;  2CQ8 A;  2M8N A;  1GXG A;  2QEX P;  1M6N A;  4UHP B;  1KLP A;  2LIW A;  2Z46 A;  2QA4 P;  2GON A;  3DS0 A;  1L6N A;  2VLQ A;  2KOD A;  2FVF A;  1AUM A;  3P05 A;  2K2Q A;  1VQM P;  1EIA A;  3HYB A;  1AF8 A;  3G28 A;  2CG5 B;  4PH1 A;  1BAJ A;  2GZJ A;  3G26 A;  2Z45 A;  1Z6M A;  1M9X C;  1YJ9 P;  4M0I A;  1L0I A;  1QRJ A;  3GZM A;  3HZQ A;  2GDW A;  1YIT P;  4XRQ A;  3DS4 A;  5HVC A;  2KOP A;  5F2K A;  3CCS P;  4HKG A;  4E91 A;  1K30 A;  4IPY A;  2MVU A;  1VQK P;  2EG5 A;  2FQ0 A;  4LQW C;  2KOO A;  1EOQ A;  1K73 Q;  5HGK A;  2N5I A;  1IUQ A;  2ONT A;  2KGC A;  5HGL A;  2K0Y A;  2LL8 A;  3CCM P;  2PEN A;  2GZG A;  1NJI Q;  2XZ1 C;  4U0F A;  3CMA P;  4U0C A;  1VKU A;  5KP8 B;  2ERH A;  1KD1 Q;  4U0A A;  2JQ4 A;  1AYI A;  2M8P A;  2K94 A;  2PY8 A;  2FQ1 A;  3NY7 B;  1VQL P;  1DV5 A;  3G1G A;  4F37 A;  2L4B A;  1QVG O;  3DPH A;  4NEO A;  1VQO P;  2PEK A;  1ZNV A;  2XZ0 D;  2MY5 A;  3VRL C;  3DS5 A;  2K93 A;  1IMP A;  2BUO A;  3NTE A;  2QNW A;  4IZ6 A;  2LML A;  2K5X A;  1VQN P;  2JPR A;  2KGD A;  4B4N A;  2MD9 A;  1A43 A;  1YI2 P;  3EJB A;  4DGA C;  2PXR C;  5F2O A;  2CGQ A;  3CCE P;  2GDX A;  2N98 A;  2JYG A;  2LOL A;  2FQ2 A;  2PEM A;  1QVF O;  1VHN A;  1K8A Q;  1DNY A;  1P7N A;  2LF4 A;  3CD6 P;  2N6Z A;  5HGM A;  2V4X A;  3CCL P;  2K0X A;  3CCJ P;  2FVE A;  2BHV A;  1VQ4 P;  1VQ9 P;  3DS3 A;  1M9E C;  2N50 A;  3CC4 P;  4COP A;  1JJ2 O;  4U0B A;  4H2Y C;  2GYK A;  2AFD A;  2PEO A;  7CEI A;  4GR2 A;  3DS2 A;  5BS2 A;  2XGU A;  2DNW A;  2OTJ P;  1CEI A;  2LTE A;  2KOR A;  3GZL A;  3M1M A;  5F2N A;  3G4S P;  1VQP P;  1F80 D;  1MZ8 A;  3CXC O;  1ACP A;  3CCQ P;  1U7K A;  1X3O A;  3CCR P;  2AF8 A;  2LIU A;  4CA3 A;  1Q82 Q;  2WLV B;  2FAC A;  2GOL B;  2GZF A;  1S72 P;  2X83 A;  1VQ6 P;  5KP7 B;  2M8L A;  4E92 A;  2JO0 A;  2KOS A;  2DGY A;  3RG2 A;  1M1K Q;  2PEQ A;  4BPH A;  3GJN A;  1RNI A;  1K9M Q;  5DCK A;  2FAD A;  2NO8 A;  3E2D A;  2JU2 A;  2OTL P;  4QNB A;  5HGO A;  4PH2 A;  2Y4Z A;  4COC A;  2JBG A;  1M9F C;  2XDE A;  2EIA A;  2PEJ A;  1L0H A;  2OAR A;  1M6E X;  2WPT A;  1EM9 A;  1EMV A;  4PWV B;  3DTJ A;  1HY8 A;  3CC7 P;  1M90 Q;  1FR2 A;  2K92 A;  1E6J P;  2MF4 A;  2L0Q A;  1OR5 A;  2XV6 A;  1M9C C;  1D1D A;  4PH0 A; 
#chains in the Genus database with same CATH homology
 3CCL P;  3CCJ P;  3HZQ A;  3WBH A;  2BHV A;  2CWO A;  1YIT P;  4XRQ A;  3H4E A;  3DS4 A;  3DS3 A;  5F2K A;  3I55 P;  3CCS P;  3CCV P;  1Q7Y Q;  1VQ4 P;  1VQ9 P;  1M9E C;  4PH3 A;  3Q20 A;  4E91 A;  1K30 A;  4HTW A;  4IPY A;  4XRO A;  4J93 A;  3CC4 P;  4COP A;  1GWP A;  3RG6 C;  1JJ2 O;  4U0B A;  1VQK P;  2E1M A;  4DGE C;  2PEO A;  3B5I A;  1AK4 C;  4XFY A;  2EG5 A;  4GR2 A;  1VQ8 P;  3DS2 A;  4LQW C;  2EFJ A;  5BS2 A;  5JPA A;  5I4T G;  1EOQ A;  1K73 Q;  2XGU A;  3CME P;  5HGK A;  1RO0 A;  1IUQ A;  2ONT A;  2OTJ P;  2PEI A;  2XGY A;  1N8R Q;  5HGL A;  1M9D C;  3CCM P;  2PEN A;  3M1M A;  3G71 P;  5F2N A;  1NJI Q;  4GR6 A;  1G03 A;  2JYL A;  3I56 P;  3LRY A;  2XT1 A;  3G4S P;  4XFX A;  1VQP P;  3CXC O;  3DS1 A;  4NX4 C;  4U0F A;  3G21 A;  3CMA P;  4U0C A;  3CCQ P;  1U7K A;  2XXM A;  1W2B O;  1Q86 Q;  3CCR P;  1VQ7 P;  2L6E A;  3G29 A;  1KD1 Q;  4U0A A;  1Q82 Q;  2PWO A;  2WLV B;  2KGF A;  3H0D A;  4XFZ A;  2M8P A;  2GOL B;  2PWM A;  2PY8 A;  3H47 A;  1AFV A;  1YJW P;  1KC8 Q;  1S72 P;  2X83 A;  1YHQ P;  1VQ6 P;  1Q81 Q;  1VQL P;  2M8L A;  5BS1 A;  3G1G A;  2P9X A;  4E92 A;  2JO0 A;  2X2D D;  2Z44 A;  1VQ5 P;  1RO2 A;  2DGY A;  1QVG O;  3DPH A;  1M1K Q;  1VQO P;  2PEK A;  2PEQ A;  1RNI A;  1K9M Q;  1YJN P;  4U0D A;  5DCK A;  1M74 A;  3VRL C;  3CPW O;  3MGE A;  3DS5 A;  1ZMB A;  2M8N A;  2X82 A;  2BUO A;  3E2D A;  3NTE A;  2OTL P;  4QNB A;  5HGO A;  2QEX P;  1M9Y C;  4PH2 A;  1M6N A;  2Y4Z A;  4INB A;  3G6E P;  4COC A;  1M9F C;  2XDE A;  2EIA A;  2JPR A;  2PEJ A;  4U0E A;  1VQN P;  4B4N A;  1KQS O;  1A43 A;  2Z46 A;  2OAR A;  3G1I A;  1YI2 P;  1M6E X;  4WYM A;  1EM9 A;  2QA4 P;  1YIJ P;  4DGA C;  3CC2 P;  2GON A;  2PXR C;  3DTJ A;  5F2O A;  3DS0 A;  3CCE P;  3CC7 P;  1L6N A;  1A8O A;  2KOD A;  2JYG A;  1M90 Q;  2PEM A;  1QVF O;  3G0V A;  1K8A Q;  1AUM A;  3P05 A;  1P7N A;  2LF4 A;  1VQM P;  1E6J P;  3CD6 P;  1EIA A;  3HYB A;  3CCU P;  5HGM A;  2WLV A;  3G28 A;  2V4X A;  3BP9 A;  2XV6 A;  4PH1 A;  1BAJ A;  5HGN A;  3G26 A;  1M9C C;  2Z45 A;  1M9X C;  1D1D A;  1YJ9 P;  4PH0 A;  4M0I A;  3OW2 O;  2XGV A;  1QRJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...