1E6JP

Crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
VHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mutual Conformational Adaptations in Antigen and Antibody Upon Complex Formation between an Fab and HIV-1 Capsid Protein P24
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Viral protein
molecule keywords IMMUNOGLOBULIN
total genus 66
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1e6jP01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1e6jP02
4E91A 4U0CA 1M9FC 2WLVA 3G0VA 1G03A 3H4EA 4DGEC 1AK4C 1M9CC 3G29A 3P05A 4HTWA 4E92A 1EIAA 2X82A 5HGOA 3G1GA 2XDEA 4INBA 4XFZA 4B4NA 2X83A 4PH0A 3G28A 3VRLC 2LF4A 4U0FA 5HGNA 2JPRA 4XFYA 4LQWC 2X2DD 1D1DA 3G26A 1U7KA 2M8NA 5HGMA 1AFVA 1M9XC 3DS1A 4M0IA 2GOLB 2M8PA 3DS4A 4COPA 2V4XA 1A8OA 3G1IA 2WLVB 2JYGA 5I4TG 4U0EA 4XFXA 1A43A 5HGKA 2XGUA 5DCKA 4XRQA 4WYMA 2L6EA 2KGFA 4U0AA 2XT1A 4IPYA 2ONTA 2BUOA 1M9DC 2JYLA 4COCA 4U0BA 3MGEA 1L6NA 2Y4ZA 2XV6A 2PWMA 4PH2A 4QNBA 1M9YC 1E6JP 2XGYA 3DPHA 4XROA 3LRYA 3BP9A 4NX4C 2M8LA 1AUMA 3DS5A 1M9EC 3H47A 3NTEA 1EOQA 1QRJA 4U0DA 2JO0A 3DS0A 4DGAC 3DTJA 1GWPA 2KODA 5HGLA 1BAJA 4PH1A 3G21A 1P7NA 3DS2A 5JPAA 2GONA 2PXRC 4J93A 3DS3A 2XGVA 2EIAA 2XXMA 2PWOA 4PH3A 1EM9A
chains in the Genus database with same CATH superfamily
3M1MA 2N50A 2K2QA 2WLVA 4DGEC 2FADA 2KG9A 1AK4C 2JAZA 4H2WC 3G29A 2Z44A 4INBA 2MR7A 4B4NA 2MR8A 2X83A 2K93A 1S72P 3G28A 2MY5A 2PEQA 1OR5A 2FHSC 1IUQA 5F2NA 4GR6A 2X2DD 2KOSA 2JU1A 1VQLP 4MRTC 1VQ4P 1VHNA 1QVFO 2KOPA 2N5HA 2N6YA 2VLNA 3DS4A 1A8OA 3CCLP 5F2OA 2GDXA 2LIUA 5HGKA 2VLQA 3H0DA 2N5IA 2GZIA 2KR5A 3HZQA 4IPYA 4COCA 2Y4ZA 1HQBA 3CCMP 2XGYA 1RNIA 2WPTA 3CC4P 2N98A 4DGAC 2KGCA 2K94A 3CXCO 2XZ0D 1VQ9P 5HGLA 2P9XA 2GYKA 2PXRC 4UHPB 2GZEA 1YJNP 3E2DA 2FQ2A 4E91A 2L9FA 5BS2A 3OW2O 2FACA 3H4EA 2GZFA 2PENA 1NJIQ 2N6ZA 1EIAA 2CNRA 2QNWA 1GXGA 2LL8A 1KC8Q 4PH0A 2X2BA 1Q81Q 1Q82Q 2L4BA 2L22A 2PEIA 4U0FA 1VKUA 2KOQA 1VQKP 1M6EX 2LMLA 5HGNA 2LTEA 3GZMA 5BS1A 2K0XA 3WBHA 3G4SP 1GXHA 1U7KA 1M1KQ 1AFVA 1M9XC 1MZ8A 3DS1A 2KGEA 4BPFA 3CMAP 3B5IA 4PXHB 2V4XA 1YHQP 2JYGA 1IMPA 1YITP 5KP7B 2KWLA 1YJ9P 1VQ8P 2AFDA 2QEXP 3CCUP 1L0IA 1Z6MA 5DCKA 2CQ8A 1HY8A 2KGDA 2L6EA 2AFEA 2M5RA 2XT1A 1Q86Q 2KW2A 2BUOA 2JYLA 3G71P 1L6NA 2XV6A 2LIWA 2BHVA 4CA3A 2PWMA 4QNBA 4HKGA 1JJ2O 1M9YC 1DV5A 2KGAA 2JBGA 1NQ4A 3BP9A 3LRYA 2KG8A 1ZNVA 5KP8B 2FAEA 1X3OA 2L0QA 2AVAA 3LMOA 1EOQA 4U0DA 2JO0A 3DS0A 2PEMA 3DTJA 1GWPA 2KODA 1KQSO 1BAJA 1K9MQ 2MD9A 4PH1A 1ZMBA 2PY8A 3CCVP 1VQMP 1L0HA 5CZDB 2XXMA 1BXIA 4U0CA 1GPJA 4NEOA 4R0MA 1M9FC 3HYBA 2PEKA 3G0VA 1G03A 2ROQA 1Q7YQ 1UJZA 2QA4P 2E1MA 1VQ7P 3EJEA 1T8KA 2LF4A 1UNKA 4PWVB 7CEIA 3CCQP 1RO0A 1N8RQ 2VLPA 1CEIA 4XFYA 4LQWC 2K5XA 3B4QA 2AF8A 2K0YA 3G26A 1EMVA 4M0IA 2FVEA 3RG2A 3CCEP 4DG9A 1VQ5P 3I56P 4BPGA 2PEJA 2GDWA 3G1IA 1M74A 2WLVB 4GR2A 2MVUA 5EJDA 2FQ1A 1A43A 2Z46A 2DNWA 2XGUA 2PEOA 3Q20A 1FR2A 4XRQA 3CE7A 3MGEA 2JU2A 4PH2A 2LKIA 2JGPA 3DPHA 4XROA 4NX4C 2M8LA 5EW5E 3GJNA 1AUMA 1W2BO 2LOLA 3DS5A 2FVFA 1M9EC 2JB0A 3NTEA 3G6EP 5KP6B 2EHTA 1QRJA 2EHSA 1ACPA 2KG6A 3CC7P 5HV8A 2FVAA 2MVVA 1P7NA 2GONA 2XGVA 2EIAA 2CG5B 2PWOA 3EJBA 4QKOA 1EM9A 1K73Q 3RG6C 3CC2P 1KD1Q 2DGYA 5HVCA 2GZGA 1IMQA 1M9CC 2K92A 3P05A 4HTWA 2GDYA 4E92A 2KORA 2X82A 5HGOA 3CPWO 3G1GA 2XZ1C 2XDEA 1AF8A 4XFZA 1K30A 3VRLC 1K8AQ 2LPKA 2GZJA 2OARA 1AYIA 2JPRA 4F37A 5F2KA 1D1DA 3GKLC 1VQOP 2FQ0A 2Z45A 2M8NA 5HGMA 1M6NA 2NO8A 1E0HA 2GOLB 2JQ4A 3CCRP 2M8PA 2EFJA 1YJWP 3CD6P 4COPA 3CCJP 2OTJP 2PNGA 1M90Q 1RO2A 5I4TG 1F80D 4U0EA 4XFXA 2VSQA 2KOOA 1VQPP 1VQNP 3EJDA 3GZLA 4H2YC 4WYMA 2KGFA 3CMEP 4U0AA 2ONTA 1M9DC 1KLPA 4U0BA 1YIJP 1E6JP 2OTLP 4BPHA 1YI2P 3I55P 3NY7B 2MF4A 2CGQA 2K0DX 3H47A 3CCSP 2ERHA 1QVGO 4IZ6A 2VLOA 1DNYA 3G21A 3DS2A 4H2XC 5JPAA 4J93A 2EG5A 3DS3A 1VQ6P 4PH3A 2CWOA 3U43A
chains in the Genus database with same CATH topology
3CC2P 4E91A 4U0CA 3M1MA 5BS2A 1KD1Q 2DGYA 3OW2O 1M9FC 3HYBA 2PEKA 2WLVA 3G0VA 1G03A 3H4EA 4DGEC 1Q7YQ 1AK4C 1M9CC 2QA4P 2PENA 2E1MA 3G29A 3P05A 1NJIQ 4HTWA 1VQ7P 4E92A 1EIAA 2X82A 5HGOA 3CPWO 1K73Q 3G1GA 2Z44A 2XDEA 4INBA 4XFZA 4B4NA 1K30A 2X83A 1KC8Q 1S72P 4PH0A 3G28A 3VRLC 1Q81Q 1K8AQ 1Q82Q 2LF4A 2PEIA 2PEQA 4U0FA 1VQKP 3CCQP 2OARA 1RO0A 1M6EX 1IUQA 1N8RQ 5HGNA 5F2NA 5BS1A 2JPRA 4XFYA 4LQWC 4GR6A 2X2DD 5F2KA 1D1DA 1VQOP 3WBHA 3G4SP 3G26A 1VQLP 1U7KA 2Z45A 2M8NA 1M1KQ 5HGMA 1AFVA 1M6NA 1VQ4P 1M9XC 3DS1A 1QVFO 4M0IA 2GOLB 3CMAP 3CCRP 2M8PA 2EFJA 3B5IA 1YJWP 3CCEP 3CD6P 1VQ5P 3DS4A 4COPA 2V4XA 3I56P 1YHQP 2PEJA 3CCJP 1A8OA 3G1IA 2OTJP 1M90Q 1M74A 2WLVB 2JYGA 1RO2A 4GR2A 5I4TG 3CCLP 4U0EA 5F2OA 1YITP 4XFXA 1YJ9P 1VQPP 1VQ8P 1A43A 2Z46A 1VQNP 5HGKA 2QEXP 3CCUP 2XGUA 2PEOA 3Q20A 5DCKA 4XRQA 4WYMA 2L6EA 2KGFA 3CMEP 3H0DA 4U0AA 2XT1A 1Q86Q 4IPYA 2ONTA 2BUOA 1M9DC 2JYLA 3HZQA 4COCA 3G71P 4U0BA 3MGEA 1L6NA 2Y4ZA 2XV6A 3CCMP 2BHVA 2PWMA 4PH2A 4QNBA 1JJ2O 1M9YC 1YIJP 1E6JP 2OTLP 2XGYA 1YI2P 3DPHA 4XROA 3LRYA 3BP9A 4NX4C 2M8LA 3I55P 1AUMA 1W2BO 1RNIA 3DS5A 1M9EC 3H47A 3NTEA 3G6EP 1EOQA 3CCSP 3CC4P 1QRJA 4U0DA 2JO0A 3DS0A 3RG6C 1QVGO 2PEMA 4DGAC 3DTJA 3CXCO 1GWPA 2KODA 3CC7P 1VQ9P 5HGLA 1KQSO 1BAJA 1K9MQ 4PH1A 3G21A 1ZMBA 1P7NA 2PY8A 3DS2A 3CCVP 5JPAA 2P9XA 1VQMP 2GONA 2PXRC 4J93A 2EG5A 3DS3A 2XGVA 2EIAA 2XXMA 2PWOA 4PH3A 1YJNP 1VQ6P 1EM9A 2CWOA 3E2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E91 A;  4U0C A;  1M9F C;  2WLV A;  3G0V A;  1G03 A;  3H4E A;  4DGE C;  1AK4 C;  1M9C C;  3G29 A;  3P05 A;  4HTW A;  4E92 A;  1EIA A;  2X82 A;  5HGO A;  3G1G A;  2XDE A;  4INB A;  4XFZ A;  4B4N A;  2X83 A;  4PH0 A;  3G28 A;  3VRL C;  2LF4 A;  4U0F A;  5HGN A;  2JPR A;  4XFY A;  4LQW C;  2X2D D;  1D1D A;  3G26 A;  1U7K A;  2M8N A;  5HGM A;  1AFV A;  1M9X C;  3DS1 A;  4M0I A;  2GOL B;  2M8P A;  3DS4 A;  4COP A;  2V4X A;  1A8O A;  3G1I A;  2WLV B;  2JYG A;  5I4T G;  4U0E A;  4XFX A;  1A43 A;  5HGK A;  2XGU A;  5DCK A;  4XRQ A;  4WYM A;  2L6E A;  2KGF A;  4U0A A;  2XT1 A;  4IPY A;  2ONT A;  2BUO A;  1M9D C;  2JYL A;  4COC A;  4U0B A;  3MGE A;  1L6N A;  2Y4Z A;  2XV6 A;  2PWM A;  4PH2 A;  4QNB A;  1M9Y C;  1E6J P;  2XGY A;  3DPH A;  4XRO A;  3LRY A;  3BP9 A;  4NX4 C;  2M8L A;  1AUM A;  3DS5 A;  1M9E C;  3H47 A;  3NTE A;  1EOQ A;  1QRJ A;  4U0D A;  2JO0 A;  3DS0 A;  4DGA C;  3DTJ A;  1GWP A;  2KOD A;  5HGL A;  1BAJ A;  4PH1 A;  3G21 A;  1P7N A;  3DS2 A;  5JPA A;  2GON A;  2PXR C;  4J93 A;  3DS3 A;  2XGV A;  2EIA A;  2XXM A;  2PWO A;  4PH3 A;  1EM9 A; 
#chains in the Genus database with same CATH topology
 3M1M A;  2N50 A;  2K2Q A;  2WLV A;  4DGE C;  2FAD A;  2KG9 A;  1AK4 C;  2JAZ A;  4H2W C;  3G29 A;  2Z44 A;  4INB A;  2MR7 A;  4B4N A;  2MR8 A;  2X83 A;  2K93 A;  1S72 P;  3G28 A;  2MY5 A;  2PEQ A;  1OR5 A;  2FHS C;  1IUQ A;  5F2N A;  4GR6 A;  2X2D D;  2KOS A;  2JU1 A;  1VQL P;  4MRT C;  1VQ4 P;  1VHN A;  1QVF O;  2KOP A;  2N5H A;  2N6Y A;  2VLN A;  3DS4 A;  1A8O A;  3CCL P;  5F2O A;  2GDX A;  2LIU A;  5HGK A;  2VLQ A;  3H0D A;  2N5I A;  2GZI A;  2KR5 A;  3HZQ A;  4IPY A;  4COC A;  2Y4Z A;  1HQB A;  3CCM P;  2XGY A;  1RNI A;  2WPT A;  3CC4 P;  2N98 A;  4DGA C;  2KGC A;  2K94 A;  3CXC O;  2XZ0 D;  1VQ9 P;  5HGL A;  2P9X A;  2GYK A;  2PXR C;  4UHP B;  2GZE A;  1YJN P;  3E2D A;  2FQ2 A;  4E91 A;  2L9F A;  5BS2 A;  3OW2 O;  2FAC A;  3H4E A;  2GZF A;  2PEN A;  1NJI Q;  2N6Z A;  1EIA A;  2CNR A;  2QNW A;  1GXG A;  2LL8 A;  1KC8 Q;  4PH0 A;  2X2B A;  1Q81 Q;  1Q82 Q;  2L4B A;  2L22 A;  2PEI A;  4U0F A;  1VKU A;  2KOQ A;  1VQK P;  1M6E X;  2LML A;  5HGN A;  2LTE A;  3GZM A;  5BS1 A;  2K0X A;  3WBH A;  3G4S P;  1GXH A;  1U7K A;  1M1K Q;  1AFV A;  1M9X C;  1MZ8 A;  3DS1 A;  2KGE A;  4BPF A;  3CMA P;  3B5I A;  4PXH B;  2V4X A;  1YHQ P;  2JYG A;  1IMP A;  1YIT P;  5KP7 B;  2KWL A;  1YJ9 P;  1VQ8 P;  2AFD A;  2QEX P;  3CCU P;  1L0I A;  1Z6M A;  5DCK A;  2CQ8 A;  1HY8 A;  2KGD A;  2L6E A;  2AFE A;  2M5R A;  2XT1 A;  1Q86 Q;  2KW2 A;  2BUO A;  2JYL A;  3G71 P;  1L6N A;  2XV6 A;  2LIW A;  2BHV A;  4CA3 A;  2PWM A;  4QNB A;  4HKG A;  1JJ2 O;  1M9Y C;  1DV5 A;  2KGA A;  2JBG A;  1NQ4 A;  3BP9 A;  3LRY A;  2KG8 A;  1ZNV A;  5KP8 B;  2FAE A;  1X3O A;  2L0Q A;  2AVA A;  3LMO A;  1EOQ A;  4U0D A;  2JO0 A;  3DS0 A;  2PEM A;  3DTJ A;  1GWP A;  2KOD A;  1KQS O;  1BAJ A;  1K9M Q;  2MD9 A;  4PH1 A;  1ZMB A;  2PY8 A;  3CCV P;  1VQM P;  1L0H A;  5CZD B;  2XXM A;  1BXI A;  4U0C A;  1GPJ A;  4NEO A;  4R0M A;  1M9F C;  3HYB A;  2PEK A;  3G0V A;  1G03 A;  2ROQ A;  1Q7Y Q;  1UJZ A;  2QA4 P;  2E1M A;  1VQ7 P;  3EJE A;  1T8K A;  2LF4 A;  1UNK A;  4PWV B;  7CEI A;  3CCQ P;  1RO0 A;  1N8R Q;  2VLP A;  1CEI A;  4XFY A;  4LQW C;  2K5X A;  3B4Q A;  2AF8 A;  2K0Y A;  3G26 A;  1EMV A;  4M0I A;  2FVE A;  3RG2 A;  3CCE P;  4DG9 A;  1VQ5 P;  3I56 P;  4BPG A;  2PEJ A;  2GDW A;  3G1I A;  1M74 A;  2WLV B;  4GR2 A;  2MVU A;  5EJD A;  2FQ1 A;  1A43 A;  2Z46 A;  2DNW A;  2XGU A;  2PEO A;  3Q20 A;  1FR2 A;  4XRQ A;  3CE7 A;  3MGE A;  2JU2 A;  4PH2 A;  2LKI A;  2JGP A;  3DPH A;  4XRO A;  4NX4 C;  2M8L A;  5EW5 E;  3GJN A;  1AUM A;  1W2B O;  2LOL A;  3DS5 A;  2FVF A;  1M9E C;  2JB0 A;  3NTE A;  3G6E P;  5KP6 B;  2EHT A;  1QRJ A;  2EHS A;  1ACP A;  2KG6 A;  3CC7 P;  5HV8 A;  2FVA A;  2MVV A;  1P7N A;  2GON A;  2XGV A;  2EIA A;  2CG5 B;  2PWO A;  3EJB A;  4QKO A;  1EM9 A;  1K73 Q;  3RG6 C;  3CC2 P;  1KD1 Q;  2DGY A;  5HVC A;  2GZG A;  1IMQ A;  1M9C C;  2K92 A;  3P05 A;  4HTW A;  2GDY A;  4E92 A;  2KOR A;  2X82 A;  5HGO A;  3CPW O;  3G1G A;  2XZ1 C;  2XDE A;  1AF8 A;  4XFZ A;  1K30 A;  3VRL C;  1K8A Q;  2LPK A;  2GZJ A;  2OAR A;  1AYI A;  2JPR A;  4F37 A;  5F2K A;  1D1D A;  3GKL C;  1VQO P;  2FQ0 A;  2Z45 A;  2M8N A;  5HGM A;  1M6N A;  2NO8 A;  1E0H A;  2GOL B;  2JQ4 A;  3CCR P;  2M8P A;  2EFJ A;  1YJW P;  3CD6 P;  4COP A;  3CCJ P;  2OTJ P;  2PNG A;  1M90 Q;  1RO2 A;  5I4T G;  1F80 D;  4U0E A;  4XFX A;  2VSQ A;  2KOO A;  1VQP P;  1VQN P;  3EJD A;  3GZL A;  4H2Y C;  4WYM A;  2KGF A;  3CME P;  4U0A A;  2ONT A;  1M9D C;  1KLP A;  4U0B A;  1YIJ P;  1E6J P;  2OTL P;  4BPH A;  1YI2 P;  3I55 P;  3NY7 B;  2MF4 A;  2CGQ A;  2K0D X;  3H47 A;  3CCS P;  2ERH A;  1QVG O;  4IZ6 A;  2VLO A;  1DNY A;  3G21 A;  3DS2 A;  4H2X C;  5JPA A;  4J93 A;  2EG5 A;  3DS3 A;  1VQ6 P;  4PH3 A;  2CWO A;  3U43 A; 
#chains in the Genus database with same CATH homology
 3CC2 P;  4E91 A;  4U0C A;  3M1M A;  5BS2 A;  1KD1 Q;  2DGY A;  3OW2 O;  1M9F C;  3HYB A;  2PEK A;  2WLV A;  3G0V A;  1G03 A;  3H4E A;  4DGE C;  1Q7Y Q;  1AK4 C;  1M9C C;  2QA4 P;  2PEN A;  2E1M A;  3G29 A;  3P05 A;  1NJI Q;  4HTW A;  1VQ7 P;  4E92 A;  1EIA A;  2X82 A;  5HGO A;  3CPW O;  1K73 Q;  3G1G A;  2Z44 A;  2XDE A;  4INB A;  4XFZ A;  4B4N A;  1K30 A;  2X83 A;  1KC8 Q;  1S72 P;  4PH0 A;  3G28 A;  3VRL C;  1Q81 Q;  1K8A Q;  1Q82 Q;  2LF4 A;  2PEI A;  2PEQ A;  4U0F A;  1VQK P;  3CCQ P;  2OAR A;  1RO0 A;  1M6E X;  1IUQ A;  1N8R Q;  5HGN A;  5F2N A;  5BS1 A;  2JPR A;  4XFY A;  4LQW C;  4GR6 A;  2X2D D;  5F2K A;  1D1D A;  1VQO P;  3WBH A;  3G4S P;  3G26 A;  1VQL P;  1U7K A;  2Z45 A;  2M8N A;  1M1K Q;  5HGM A;  1AFV A;  1M6N A;  1VQ4 P;  1M9X C;  3DS1 A;  1QVF O;  4M0I A;  2GOL B;  3CMA P;  3CCR P;  2M8P A;  2EFJ A;  3B5I A;  1YJW P;  3CCE P;  3CD6 P;  1VQ5 P;  3DS4 A;  4COP A;  2V4X A;  3I56 P;  1YHQ P;  2PEJ A;  3CCJ P;  1A8O A;  3G1I A;  2OTJ P;  1M90 Q;  1M74 A;  2WLV B;  2JYG A;  1RO2 A;  4GR2 A;  5I4T G;  3CCL P;  4U0E A;  5F2O A;  1YIT P;  4XFX A;  1YJ9 P;  1VQP P;  1VQ8 P;  1A43 A;  2Z46 A;  1VQN P;  5HGK A;  2QEX P;  3CCU P;  2XGU A;  2PEO A;  3Q20 A;  5DCK A;  4XRQ A;  4WYM A;  2L6E A;  2KGF A;  3CME P;  3H0D A;  4U0A A;  2XT1 A;  1Q86 Q;  4IPY A;  2ONT A;  2BUO A;  1M9D C;  2JYL A;  3HZQ A;  4COC A;  3G71 P;  4U0B A;  3MGE A;  1L6N A;  2Y4Z A;  2XV6 A;  3CCM P;  2BHV A;  2PWM A;  4PH2 A;  4QNB A;  1JJ2 O;  1M9Y C;  1YIJ P;  1E6J P;  2OTL P;  2XGY A;  1YI2 P;  3DPH A;  4XRO A;  3LRY A;  3BP9 A;  4NX4 C;  2M8L A;  3I55 P;  1AUM A;  1W2B O;  1RNI A;  3DS5 A;  1M9E C;  3H47 A;  3NTE A;  3G6E P;  1EOQ A;  3CCS P;  3CC4 P;  1QRJ A;  4U0D A;  2JO0 A;  3DS0 A;  3RG6 C;  1QVG O;  2PEM A;  4DGA C;  3DTJ A;  3CXC O;  1GWP A;  2KOD A;  3CC7 P;  1VQ9 P;  5HGL A;  1KQS O;  1BAJ A;  1K9M Q;  4PH1 A;  3G21 A;  1ZMB A;  1P7N A;  2PY8 A;  3DS2 A;  3CCV P;  5JPA A;  2P9X A;  1VQM P;  2GON A;  2PXR C;  4J93 A;  2EG5 A;  3DS3 A;  2XGV A;  2EIA A;  2XXM A;  2PWO A;  4PH3 A;  1YJN P;  1VQ6 P;  1EM9 A;  2CWO A;  3E2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...