1E6JP

Crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
b'VHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN
publication title Mutual Conformational Adaptations in Antigen and Antibody Upon Complex Formation between an Fab and HIV-1 Capsid Protein P24
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Viral protein
total genus 66
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1e6jP01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1e6jP02
5HGNA 1AK4C 1D1DA 1E6JP 2ONTA 3H4EA 1M9CC 2M8LA 4IPYA 3G0VA 1EOQA 1L6NA 3G1IA 3LRYA 4NX4C 4COCA 4DGAC 2WLVA 3P05A 2XGYA 4XROA 4XFZA 2Y4ZA 2LF4A 2KGFA 3DS3A 2M8PA 3DS0A 4U0DA 2X83A 4PH3A 4PH0A 1M9EC 4U0FA 3G28A 4B4NA 4E91A 3DPHA 2KODA 1AUMA 2XGVA 5HGLA 1GWPA 5I4TG 2X82A 2V4XA 3G26A 2GOLB 4XFXA 2X2DD 2BUOA 4E92A 3G1GA 1A43A 2JYGA 4WYMA 2XXMA 3G29A 4XFYA 1AFVA 2EIAA 2PXRC 1QRJA 1M9DC 2GONA 2L6EA 3DS2A 4COPA 1EM9A 3BP9A 3MGEA 4INBA 4U0BA 2XV6A 1A8OA 2JPRA 2WLVB 5HGKA 3DTJA 5DCKA 2XT1A 2JYLA 1U7KA 4U0AA 4XRQA 3G21A 4HTWA 3DS4A 4PH1A 3DS1A 1G03A 1M9XC 3H47A 1EIAA 4PH2A 4DGEC 1BAJA 2JO0A 4LQWC 2XDEA 4U0CA 4J93A 2M8NA 2XGUA 1M9FC 5JPAA 5HGOA 2PWMA 1P7NA 3NTEA 2PWOA 4U0EA 4M0IA 1M9YC 3VRLC 3DS5A 4QNBA 5HGMA
chains in the Genus database with same CATH superfamily
5HGNA 3CCUP 1D1DA 1L0IA 2MD9A 3H4EA 3G6EP 1CEIA 1VQLP 3CC2P 1L6NA 4NX4C 1Q7YQ 4COCA 2KGDA 1MZ8A 1M1KQ 3B5IA 2KOQA 3CCRP 2N6YA 3CC4P 2KGFA 2L4BA 2KG9A 4F37A 1VQMP 1UJZA 2OTJP 2EFJA 2AFEA 1M9EC 4U0FA 2K2QA 1VQ6P 2GZFA 2KODA 1VQ9P 2K93A 2X82A 2K94A 7CEIA 2WPTA 4GR6A 3GZLA 4HKGA 1IMPA 1DV5A 3CCVP 4E92A 1A43A 3CCSP 2JYGA 2MR7A 1FR2A 1IMQA 2XZ0D 2EIAA 3I55P 1GXGA 4PWVB 2Z46A 2PEMA 2GZJA 2GONA 1M6NA 5F2OA 3NY7B 1EM9A 2XV6A 5HV8A 2E1MA 2KGAA 1BXIA 4BPHA 2GDWA 1VQNP 2XT1A 2L0QA 1VQ8P 2LL8A 2K0XA 2EHSA 4HTWA 1EIAA 4PH2A 2LKIA 2ROQA 5KP8B 1S72P 1M9FC 5JPAA 2AF8A 3NTEA 2KR5A 2NO8A 4DG9A 1AYIA 4IZ6A 1KLPA 1M9YC 2KOPA 1RO0A 2FQ0A 1M90Q 2DGYA 3M1MA 1AK4C 2FQ2A 1E6JP 2ONTA 2GZGA 1YITP 3OW2O 4IPYA 2L9FA 2N5IA 1EOQA 2KOOA 3G1IA 2KG6A 2PY8A 4XROA 2DNWA 5CZDB 1ACPA 2LF4A 1IUQA 2KORA 3DS3A 1K30A 1GPJA 3DS0A 1Q81Q 1QVGO 2X83A 2FVAA 4PH0A 1NQ4A 3DPHA 1VQ7P 2OARA 1AUMA 2JB0A 1F80D 5HGLA 5I4TG 4XFXA 5F2KA 2BUOA 2PEKA 2VSQA 2XXMA 3CXCO 2N98A 1QRJA 2CWOA 2PNGA 1K9MQ 1M9DC 2CNRA 1YJ9P 1KC8Q 1VQKP 1DNYA 3BP9A 3MGEA 2FVEA 3CCQP 4PXHB 1KD1Q 5DCKA 3I56P 2JYLA 4BPFA 2JAZA 1M74A 2Z44A 4XRQA 1VKUA 3DS4A 3DS1A 2QNWA 1G03A 4DGEC 5BS2A 2PEOA 1VQ5P 2LPKA 4U0CA 2N5HA 2M8NA 2XGUA 1UNKA 2LOLA 1YIJP 2KG8A 2PWOA 2LIUA 5HVCA 2KWLA 4M0IA 5F2NA 2K0DX 1T8KA 3CCLP 3WBHA 2KOSA 2K5XA 3EJEA 2P9XA 2PEJA 1YJNP 1YHQP 2GDYA 2VLOA 1OR5A 1Q86Q 2CQ8A 2AFDA 4MRTC 2VLQA 1JJ2O 2FACA 3LRYA 4QKOA 1ZNVA 4DGAC 3B4QA 3P05A 2MF4A 2M5RA 2PENA 5KP6B 2LIWA 4H2WC 1RNIA 2M8PA 4U0DA 3CMEP 3G28A 3HZQA 1NJIQ 4B4NA 3CD6P 4BPGA 1K8AQ 3CMAP 1ZMBA 2JU1A 1E0HA 2FHSC 2MVVA 2V4XA 3G26A 1RO2A 3CCEP 4H2YC 2JBGA 1HQBA 2FQ1A 3EJDA 3RG2A 4WYMA 3G29A 4XFYA 2AVAA 2FAEA 2QEXP 2ERHA 2PXRC 2JU2A 1QVFO 2Z45A 2EHTA 2L22A 2L6EA 1YJWP 4INBA 1A8OA 3CCMP 2JPRA 2VLNA 3CC7P 5HGKA 3DTJA 4GR2A 2PEQA 5KP7B 2PEIA 3H0DA 1U7KA 2CGQA 1HY8A 1N8RQ 2CG5B 3H47A 1M9XC 2JO0A 1BAJA 2GZIA 4LQWC 4J93A 1KQSO 1YI2P 2PWMA 3HYBA 2QA4P 3Q20A 4U0EA 4H2XC 2XZ1C 3VRLC 1W2BO 4QNBA 2MY5A 1VQ4P 3CCJP 3GZMA 2LTEA 2VLPA 2LMLA 3G71P 1VHNA 1Z6MA 2EG5A 1M9CC 1EMVA 2M8LA 3GJNA 3G0VA 2K92A 5BS1A 1L0HA 2KW2A 2WLVA 2XGYA 2JQ4A 4XFZA 2KGCA 1Q82Q 3EJBA 2Y4ZA 1M6EX 4PH3A 3RG6C 2GZEA 1AF8A 4E91A 2GDXA 2XGVA 1GWPA 1X3OA 2GOLB 2FVFA 2X2DD 1GXHA 3U43A 5EW5E 3G1GA 3G4SP 4R0MA 1AFVA 1VQOP 2GYKA 2JGPA 3LMOA 3DS2A 4COPA 4U0BA 2WLVB 2N6ZA 2N50A 4UHPB 3CPWO 2BHVA 2MR8A 4U0AA 2OTLP 3G21A 5EJDA 4PH1A 2X2BA 2XDEA 4CA3A 4NEOA 5HGOA 3GKLC 1K73Q 3CE7A 1P7NA 2MVUA 2K0YA 3E2DA 2FADA 1VQPP 2KGEA 3DS5A 5HGMA
chains in the Genus database with same CATH topology
5HGNA 3M1MA 2PEJA 1AK4C 3CCUP 1YJNP 1YHQP 1D1DA 1E6JP 2ONTA 3H4EA 3G71P 1Q86Q 2EG5A 1YITP 3G6EP 1M9CC 3OW2O 2M8LA 1VQLP 4IPYA 3CC2P 3G0VA 1EOQA 5BS1A 1JJ2O 1L6NA 3G1IA 3LRYA 4NX4C 1Q7YQ 4COCA 4DGAC 2WLVA 3P05A 2PY8A 2XGYA 4XROA 4XFZA 1M1KQ 1Q82Q 2PENA 3B5IA 2Y4ZA 1M6EX 2LF4A 3CCRP 1IUQA 3CC4P 2KGFA 1RNIA 1K30A 2M8PA 3DS3A 3DS0A 4U0DA 1Q81Q 1VQMP 1QVGO 2X83A 4PH3A 3CMEP 2OTJP 2EFJA 3RG6C 4PH0A 1M9EC 4U0FA 3G28A 3HZQA 1NJIQ 4B4NA 3CD6P 1VQ6P 4E91A 3DPHA 1K8AQ 1VQ7P 2KODA 2OARA 3CMAP 1AUMA 1ZMBA 2XGVA 5HGLA 1GWPA 1VQ9P 5I4TG 2X82A 2V4XA 3G26A 2GOLB 1RO2A 4GR6A 3CCEP 4XFXA 2X2DD 5F2KA 3CCVP 2BUOA 4E92A 2PEKA 3G1GA 3G4SP 1A43A 3CCSP 2JYGA 4WYMA 2XXMA 3G29A 3CXCO 4XFYA 1AFVA 2QEXP 1VQOP 2EIAA 3I55P 2PXRC 1QRJA 2CWOA 1K9MQ 1M9DC 1QVFO 2Z45A 2Z46A 2PEMA 2GONA 1M6NA 5F2OA 1YJ9P 2L6EA 3DS2A 1KC8Q 1YJWP 4COPA 1VQKP 1EM9A 3BP9A 3MGEA 4INBA 4U0BA 2E1MA 2XV6A 1A8OA 3CCMP 2JPRA 3CCQP 2WLVB 3CC7P 1KD1Q 5HGKA 3DTJA 1VQNP 4GR2A 5DCKA 2PEQA 2BHVA 2XT1A 3I56P 2JYLA 2PEIA 3CPWO 3H0DA 1VQ8P 1U7KA 4U0AA 1M74A 2Z44A 4XRQA 3G21A 2OTLP 4HTWA 1N8RQ 3DS4A 4PH1A 3DS1A 1G03A 1M9XC 3H47A 1EIAA 4PH2A 4DGEC 1BAJA 2JO0A 2PEOA 5BS2A 4LQWC 1S72P 2XDEA 1VQ5P 4U0CA 4J93A 2M8NA 1KQSO 2XGUA 1M9FC 5JPAA 5HGOA 1K73Q 1YI2P 2PWMA 1YIJP 3HYBA 1P7NA 3NTEA 2QA4P 2PWOA 3Q20A 4U0EA 4M0IA 5F2NA 1M9YC 3CCLP 3E2DA 3VRLC 1VQPP 3WBHA 1W2BO 1RO0A 3DS5A 4QNBA 5HGMA 1VQ4P 3CCJP 2P9XA 1M90Q 2DGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGN A;  1AK4 C;  1D1D A;  1E6J P;  2ONT A;  3H4E A;  1M9C C;  2M8L A;  4IPY A;  3G0V A;  1EOQ A;  1L6N A;  3G1I A;  3LRY A;  4NX4 C;  4COC A;  4DGA C;  2WLV A;  3P05 A;  2XGY A;  4XRO A;  4XFZ A;  2Y4Z A;  2LF4 A;  2KGF A;  3DS3 A;  2M8P A;  3DS0 A;  4U0D A;  2X83 A;  4PH3 A;  4PH0 A;  1M9E C;  4U0F A;  3G28 A;  4B4N A;  4E91 A;  3DPH A;  2KOD A;  1AUM A;  2XGV A;  5HGL A;  1GWP A;  5I4T G;  2X82 A;  2V4X A;  3G26 A;  2GOL B;  4XFX A;  2X2D D;  2BUO A;  4E92 A;  3G1G A;  1A43 A;  2JYG A;  4WYM A;  2XXM A;  3G29 A;  4XFY A;  1AFV A;  2EIA A;  2PXR C;  1QRJ A;  1M9D C;  2GON A;  2L6E A;  3DS2 A;  4COP A;  1EM9 A;  3BP9 A;  3MGE A;  4INB A;  4U0B A;  2XV6 A;  1A8O A;  2JPR A;  2WLV B;  5HGK A;  3DTJ A;  5DCK A;  2XT1 A;  2JYL A;  1U7K A;  4U0A A;  4XRQ A;  3G21 A;  4HTW A;  3DS4 A;  4PH1 A;  3DS1 A;  1G03 A;  1M9X C;  3H47 A;  1EIA A;  4PH2 A;  4DGE C;  1BAJ A;  2JO0 A;  4LQW C;  2XDE A;  4U0C A;  4J93 A;  2M8N A;  2XGU A;  1M9F C;  5JPA A;  5HGO A;  2PWM A;  1P7N A;  3NTE A;  2PWO A;  4U0E A;  4M0I A;  1M9Y C;  3VRL C;  3DS5 A;  4QNB A;  5HGM A; 
#chains in the Genus database with same CATH topology
 5HGN A;  3CCU P;  1D1D A;  1L0I A;  2MD9 A;  3H4E A;  3G6E P;  1CEI A;  1VQL P;  3CC2 P;  1L6N A;  4NX4 C;  1Q7Y Q;  4COC A;  2KGD A;  1MZ8 A;  1M1K Q;  3B5I A;  2KOQ A;  3CCR P;  2N6Y A;  3CC4 P;  2KGF A;  2L4B A;  2KG9 A;  4F37 A;  1VQM P;  1UJZ A;  2OTJ P;  2EFJ A;  2AFE A;  1M9E C;  4U0F A;  2K2Q A;  1VQ6 P;  2GZF A;  2KOD A;  1VQ9 P;  2K93 A;  2X82 A;  2K94 A;  7CEI A;  2WPT A;  4GR6 A;  3GZL A;  4HKG A;  1IMP A;  1DV5 A;  3CCV P;  4E92 A;  1A43 A;  3CCS P;  2JYG A;  2MR7 A;  1FR2 A;  1IMQ A;  2XZ0 D;  2EIA A;  3I55 P;  1GXG A;  4PWV B;  2Z46 A;  2PEM A;  2GZJ A;  2GON A;  1M6N A;  5F2O A;  3NY7 B;  1EM9 A;  2XV6 A;  5HV8 A;  2E1M A;  2KGA A;  1BXI A;  4BPH A;  2GDW A;  1VQN P;  2XT1 A;  2L0Q A;  1VQ8 P;  2LL8 A;  2K0X A;  2EHS A;  4HTW A;  1EIA A;  4PH2 A;  2LKI A;  2ROQ A;  5KP8 B;  1S72 P;  1M9F C;  5JPA A;  2AF8 A;  3NTE A;  2KR5 A;  2NO8 A;  4DG9 A;  1AYI A;  4IZ6 A;  1KLP A;  1M9Y C;  2KOP A;  1RO0 A;  2FQ0 A;  1M90 Q;  2DGY A;  3M1M A;  1AK4 C;  2FQ2 A;  1E6J P;  2ONT A;  2GZG A;  1YIT P;  3OW2 O;  4IPY A;  2L9F A;  2N5I A;  1EOQ A;  2KOO A;  3G1I A;  2KG6 A;  2PY8 A;  4XRO A;  2DNW A;  5CZD B;  1ACP A;  2LF4 A;  1IUQ A;  2KOR A;  3DS3 A;  1K30 A;  1GPJ A;  3DS0 A;  1Q81 Q;  1QVG O;  2X83 A;  2FVA A;  4PH0 A;  1NQ4 A;  3DPH A;  1VQ7 P;  2OAR A;  1AUM A;  2JB0 A;  1F80 D;  5HGL A;  5I4T G;  4XFX A;  5F2K A;  2BUO A;  2PEK A;  2VSQ A;  2XXM A;  3CXC O;  2N98 A;  1QRJ A;  2CWO A;  2PNG A;  1K9M Q;  1M9D C;  2CNR A;  1YJ9 P;  1KC8 Q;  1VQK P;  1DNY A;  3BP9 A;  3MGE A;  2FVE A;  3CCQ P;  4PXH B;  1KD1 Q;  5DCK A;  3I56 P;  2JYL A;  4BPF A;  2JAZ A;  1M74 A;  2Z44 A;  4XRQ A;  1VKU A;  3DS4 A;  3DS1 A;  2QNW A;  1G03 A;  4DGE C;  5BS2 A;  2PEO A;  1VQ5 P;  2LPK A;  4U0C A;  2N5H A;  2M8N A;  2XGU A;  1UNK A;  2LOL A;  1YIJ P;  2KG8 A;  2PWO A;  2LIU A;  5HVC A;  2KWL A;  4M0I A;  5F2N A;  2K0D X;  1T8K A;  3CCL P;  3WBH A;  2KOS A;  2K5X A;  3EJE A;  2P9X A;  2PEJ A;  1YJN P;  1YHQ P;  2GDY A;  2VLO A;  1OR5 A;  1Q86 Q;  2CQ8 A;  2AFD A;  4MRT C;  2VLQ A;  1JJ2 O;  2FAC A;  3LRY A;  4QKO A;  1ZNV A;  4DGA C;  3B4Q A;  3P05 A;  2MF4 A;  2M5R A;  2PEN A;  5KP6 B;  2LIW A;  4H2W C;  1RNI A;  2M8P A;  4U0D A;  3CME P;  3G28 A;  3HZQ A;  1NJI Q;  4B4N A;  3CD6 P;  4BPG A;  1K8A Q;  3CMA P;  1ZMB A;  2JU1 A;  1E0H A;  2FHS C;  2MVV A;  2V4X A;  3G26 A;  1RO2 A;  3CCE P;  4H2Y C;  2JBG A;  1HQB A;  2FQ1 A;  3EJD A;  3RG2 A;  4WYM A;  3G29 A;  4XFY A;  2AVA A;  2FAE A;  2QEX P;  2ERH A;  2PXR C;  2JU2 A;  1QVF O;  2Z45 A;  2EHT A;  2L22 A;  2L6E A;  1YJW P;  4INB A;  1A8O A;  3CCM P;  2JPR A;  2VLN A;  3CC7 P;  5HGK A;  3DTJ A;  4GR2 A;  2PEQ A;  5KP7 B;  2PEI A;  3H0D A;  1U7K A;  2CGQ A;  1HY8 A;  1N8R Q;  2CG5 B;  3H47 A;  1M9X C;  2JO0 A;  1BAJ A;  2GZI A;  4LQW C;  4J93 A;  1KQS O;  1YI2 P;  2PWM A;  3HYB A;  2QA4 P;  3Q20 A;  4U0E A;  4H2X C;  2XZ1 C;  3VRL C;  1W2B O;  4QNB A;  2MY5 A;  1VQ4 P;  3CCJ P;  3GZM A;  2LTE A;  2VLP A;  2LML A;  3G71 P;  1VHN A;  1Z6M A;  2EG5 A;  1M9C C;  1EMV A;  2M8L A;  3GJN A;  3G0V A;  2K92 A;  5BS1 A;  1L0H A;  2KW2 A;  2WLV A;  2XGY A;  2JQ4 A;  4XFZ A;  2KGC A;  1Q82 Q;  3EJB A;  2Y4Z A;  1M6E X;  4PH3 A;  3RG6 C;  2GZE A;  1AF8 A;  4E91 A;  2GDX A;  2XGV A;  1GWP A;  1X3O A;  2GOL B;  2FVF A;  2X2D D;  1GXH A;  3U43 A;  5EW5 E;  3G1G A;  3G4S P;  4R0M A;  1AFV A;  1VQO P;  2GYK A;  2JGP A;  3LMO A;  3DS2 A;  4COP A;  4U0B A;  2WLV B;  2N6Z A;  2N50 A;  4UHP B;  3CPW O;  2BHV A;  2MR8 A;  4U0A A;  2OTL P;  3G21 A;  5EJD A;  4PH1 A;  2X2B A;  2XDE A;  4CA3 A;  4NEO A;  5HGO A;  3GKL C;  1K73 Q;  3CE7 A;  1P7N A;  2MVU A;  2K0Y A;  3E2D A;  2FAD A;  1VQP P;  2KGE A;  3DS5 A;  5HGM A; 
#chains in the Genus database with same CATH homology
 5HGN A;  3M1M A;  2PEJ A;  1AK4 C;  3CCU P;  1YJN P;  1YHQ P;  1D1D A;  1E6J P;  2ONT A;  3H4E A;  3G71 P;  1Q86 Q;  2EG5 A;  1YIT P;  3G6E P;  1M9C C;  3OW2 O;  2M8L A;  1VQL P;  4IPY A;  3CC2 P;  3G0V A;  1EOQ A;  5BS1 A;  1JJ2 O;  1L6N A;  3G1I A;  3LRY A;  4NX4 C;  1Q7Y Q;  4COC A;  4DGA C;  2WLV A;  3P05 A;  2PY8 A;  2XGY A;  4XRO A;  4XFZ A;  1M1K Q;  1Q82 Q;  2PEN A;  3B5I A;  2Y4Z A;  1M6E X;  2LF4 A;  3CCR P;  1IUQ A;  3CC4 P;  2KGF A;  1RNI A;  1K30 A;  2M8P A;  3DS3 A;  3DS0 A;  4U0D A;  1Q81 Q;  1VQM P;  1QVG O;  2X83 A;  4PH3 A;  3CME P;  2OTJ P;  2EFJ A;  3RG6 C;  4PH0 A;  1M9E C;  4U0F A;  3G28 A;  3HZQ A;  1NJI Q;  4B4N A;  3CD6 P;  1VQ6 P;  4E91 A;  3DPH A;  1K8A Q;  1VQ7 P;  2KOD A;  2OAR A;  3CMA P;  1AUM A;  1ZMB A;  2XGV A;  5HGL A;  1GWP A;  1VQ9 P;  5I4T G;  2X82 A;  2V4X A;  3G26 A;  2GOL B;  1RO2 A;  4GR6 A;  3CCE P;  4XFX A;  2X2D D;  5F2K A;  3CCV P;  2BUO A;  4E92 A;  2PEK A;  3G1G A;  3G4S P;  1A43 A;  3CCS P;  2JYG A;  4WYM A;  2XXM A;  3G29 A;  3CXC O;  4XFY A;  1AFV A;  2QEX P;  1VQO P;  2EIA A;  3I55 P;  2PXR C;  1QRJ A;  2CWO A;  1K9M Q;  1M9D C;  1QVF O;  2Z45 A;  2Z46 A;  2PEM A;  2GON A;  1M6N A;  5F2O A;  1YJ9 P;  2L6E A;  3DS2 A;  1KC8 Q;  1YJW P;  4COP A;  1VQK P;  1EM9 A;  3BP9 A;  3MGE A;  4INB A;  4U0B A;  2E1M A;  2XV6 A;  1A8O A;  3CCM P;  2JPR A;  3CCQ P;  2WLV B;  3CC7 P;  1KD1 Q;  5HGK A;  3DTJ A;  1VQN P;  4GR2 A;  5DCK A;  2PEQ A;  2BHV A;  2XT1 A;  3I56 P;  2JYL A;  2PEI A;  3CPW O;  3H0D A;  1VQ8 P;  1U7K A;  4U0A A;  1M74 A;  2Z44 A;  4XRQ A;  3G21 A;  2OTL P;  4HTW A;  1N8R Q;  3DS4 A;  4PH1 A;  3DS1 A;  1G03 A;  1M9X C;  3H47 A;  1EIA A;  4PH2 A;  4DGE C;  1BAJ A;  2JO0 A;  2PEO A;  5BS2 A;  4LQW C;  1S72 P;  2XDE A;  1VQ5 P;  4U0C A;  4J93 A;  2M8N A;  1KQS O;  2XGU A;  1M9F C;  5JPA A;  5HGO A;  1K73 Q;  1YI2 P;  2PWM A;  1YIJ P;  3HYB A;  1P7N A;  3NTE A;  2QA4 P;  2PWO A;  3Q20 A;  4U0E A;  4M0I A;  5F2N A;  1M9Y C;  3CCL P;  3E2D A;  3VRL C;  1VQP P;  3WBH A;  1W2B O;  1RO0 A;  3DS5 A;  4QNB A;  5HGM A;  1VQ4 P;  3CCJ P;  2P9X A;  1M90 Q;  2DGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...