1E6JP

Crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
VHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords IMMUNOGLOBULIN
publication title Mutual Conformational Adaptations in Antigen and Antibody Upon Complex Formation between an Fab and HIV-1 Capsid Protein P24
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
total genus 66
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1e6jP01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1e6jP02
2XDEA 2XV6A 2M8LA 4XFYA 2XGVA 3DS5A 2GONA 4PH3A 2PXRC 5HGMA 1QRJA 2PWOA 4PH1A 2KGFA 1P7NA 2LF4A 2GOLB 5HGOA 2KODA 3DS4A 2L6EA 1M9EC 2X2DD 1A8OA 4COPA 1M9YC 4QNBA 2ONTA 4WYMA 2V4XA 4B4NA 3DS2A 1D1DA 2JYLA 1M9DC 3NTEA 3G28A 4XROA 4NX4C 1AFVA 1M9CC 3DTJA 3H4EA 3P05A 3H47A 3VRLC 4DGEC 1A43A 1AUMA 4XRQA 1E6JP 1AK4C 2JPRA 4M0IA 3BP9A 2XT1A 4E92A 4XFZA 3DS0A 2M8NA 1EIAA 2PWMA 4U0FA 1G03A 5JPAA 4XFXA 5HGNA 3DS3A 3G1IA 3G26A 4U0DA 1BAJA 4COCA 4LQWC 2X82A 1EM9A 3DPHA 2JO0A 4U0BA 3DS1A 4PH0A 1L6NA 2Y4ZA 2EIAA 2WLVA 3LRYA 4PH2A 4J93A 2JYGA 2XGUA 4U0CA 4INBA 1GWPA 2XXMA 2M8PA 2WLVB 2BUOA 1EOQA 5I4TG 2X83A 5DCKA 1U7KA 5HGKA 4IPYA 1M9FC 4DGAC 3G29A 5HGLA 3G0VA 3G1GA 4E91A 1M9XC 3MGEA 4U0AA 4HTWA 2XGYA 4U0EA 3G21A
chains in the Genus database with same CATH superfamily
2XDEA 2XV6A 3CE7A 1VQ7P 4PH3A 3EJEA 2FAEA 2VLPA 2Z46A 1W2BO 4PH1A 2MR7A 1VQ8P 3I56P 2JB0A 1M90Q 2KG6A 3HZQA 1GPJA 2GOLB 4MRTC 1M9EC 2EHSA 1KC8Q 2LIUA 2N50A 3GZLA 4BPFA 4QNBA 3H0DA 2EFJA 1RO2A 3RG6C 2KGCA 2OARA 3H4EA 2FQ1A 1VQMP 3CCUP 1A43A 5KP8B 2N6YA 2JPRA 3BP9A 4E92A 1DV5A 2PWMA 1L0IA 4IZ6A 2K94A 4XFXA 4U0DA 2PENA 4COCA 2OTLP 4LQWC 1VQ9P 1GXGA 3CC7P 1K9MQ 1EM9A 1OR5A 1KLPA 2LTEA 1L6NA 1K8AQ 1YI2P 2KR5A 2MVVA 2K92A 3NY7B 4H2WC 2EHTA 2GZFA 5HVCA 2JYGA 5KP6B 4U0CA 2JU1A 2X83A 3CCLP 1JJ2O 2VLNA 2GZEA 2PEIA 1YJ9P 4U0AA 5F2NA 2KG9A 2XGVA 4H2XC 2ERHA 1YHQP 2GYKA 1Z6MA 2PNGA 3CCVP 4CA3A 2KGFA 2PY8A 1VHNA 3CMAP 2LPKA 1VQ4P 2KODA 3I55P 1YITP 1RNIA 2KORA 4NEOA 4WYMA 2CQ8A 2V4XA 4B4NA 2MR8A 3DS2A 3G28A 1E0HA 3DTJA 1NJIQ 3U43A 2KWLA 1ACPA 3VRLC 4DGEC 2JBGA 2MVUA 4F37A 1VQNP 4XRQA 4R0MA 1UNKA 2XT1A 5HV8A 4XFZA 4BPHA 1HQBA 2JU2A 1EIAA 1VQOP 4U0FA 5JPAA 1YJNP 3DS3A 3G1IA 2FVFA 3CXCO 5BS2A 1BAJA 2X82A 2DGYA 1VKUA 4U0BA 2K0YA 3DS1A 4DG9A 3WBHA 1VQLP 2L22A 4PWVB 3RG2A 1DNYA 3LRYA 1ZMBA 4PH2A 3HYBA 1VQ6P 2XGUA 3CCEP 2KOPA 2FQ2A 1VQKP 4GR6A 2XXMA 1EOQA 2K0DX 2KOSA 5DCKA 1Q86Q 3CD6P 3M1MA 1M9FC 1F80D 1AF8A 5BS1A 1M1KQ 1EMVA 2X2BA 3CC2P 1L0HA 4HTWA 3EJBA 2LMLA 4U0EA 3G21A 4XFYA 2AFDA 3DS5A 4PXHB 3G6EP 2PWOA 1YIJP 2EG5A 2BHVA 1M6NA 1X3OA 2KGDA 2PEJA 2N5IA 1MZ8A 3E2DA 2LF4A 5HGOA 2L6EA 2X2DD 2GZIA 1A8OA 1M6EX 4COPA 2FVEA 1M9YC 1UJZA 2CG5B 1VQ5P 2ONTA 1IMPA 1K73Q 2ROQA 2MD9A 4NX4C 1AFVA 2AF8A 2FACA 1M9CC 5CZDB 1YJWP 2CNRA 3P05A 1IUQA 1HY8A 4GR2A 2JAZA 5F2OA 1E6JP 1N8RQ 2MF4A 2WPTA 3DS0A 2PEMA 2NO8A 4HKGA 2XZ0D 2XZ1C 5HGNA 2GZGA 3CCJP 2FHSC 2MY5A 1VQPP 3LMOA 1QVGO 1QVFO 1K30A 2KGEA 5EJDA 4PH0A 3OW2O 2WLVA 2PEOA 2VLQA 2GDYA 2QA4P 2GDWA 2DNWA 3B4QA 4INBA 4QKOA 1GWPA 2E1MA 1Q81Q 2GZJA 2KG8A 4UHPB 3G29A 5HGLA 3CCRP 2KW2A 3MGEA 1IMQA 2QEXP 3CCSP 3CMEP 7CEIA 2XGYA 2K0XA 3EJDA 2M8LA 1KQSO 2K5XA 2GONA 3GJNA 3GKLC 2PXRC 5HGMA 1QRJA 2CWOA 2QNWA 1BXIA 3CPWO 2VSQA 1P7NA 2JGPA 3DS4A 2N98A 2Z45A 2AFEA 2L9FA 3G4SP 1D1DA 2JYLA 2N6ZA 1M9DC 1M74A 3NTEA 5EW5E 4XROA 2FADA 1T8KA 2LIWA 5F2KA 3H47A 2Z44A 1NQ4A 1AUMA 1Q7YQ 1CEIA 3CCMP 1AK4C 2LKIA 4M0IA 1ZNVA 1RO0A 2M8NA 1G03A 2CGQA 3B5IA 1Q82Q 2PEKA 3G26A 1KD1Q 2K2QA 2N5HA 2LOLA 2VLOA 3DPHA 2JO0A 2JQ4A 2KGAA 1GXHA 2OTJP 2KOOA 2LL8A 1AYIA 2PEQA 2FVAA 2Y4ZA 2EIAA 2M5RA 4J93A 2L4BA 2K93A 1FR2A 3CC4P 4H2YC 2M8PA 2WLVB 2BUOA 2GDXA 3Q20A 5I4TG 1S72P 5KP7B 3G71P 1U7KA 5HGKA 4IPYA 2L0QA 2KOQA 2FQ0A 4DGAC 3G0VA 3G1GA 4E91A 1M9XC 2AVAA 2P9XA 3GZMA 4BPGA 3CCQP
chains in the Genus database with same CATH topology
2XDEA 2XV6A 2M8LA 1KQSO 4XFYA 2XGVA 3DS5A 2GONA 1VQ7P 4PH3A 2PXRC 5HGMA 1YHQP 1QRJA 3CCVP 2Z46A 3G6EP 1W2BO 2PWOA 4PH1A 1YIJP 2KGFA 2EG5A 2PY8A 2BHVA 2CWOA 3CMAP 1M6NA 1VQ8P 3CPWO 1VQ4P 3I56P 1P7NA 2PEJA 1M90Q 3E2DA 2LF4A 2GOLB 3HZQA 5HGOA 2KODA 3DS4A 2L6EA 1M9EC 2X2DD 2Z45A 1A8OA 3I55P 1M6EX 4COPA 1KC8Q 1YITP 1RNIA 1M9YC 4QNBA 3H0DA 1VQ5P 2ONTA 4WYMA 2EFJA 2V4XA 4B4NA 3DS2A 3G4SP 1D1DA 1K73Q 2JYLA 1RO2A 1M9DC 1M74A 3NTEA 3G28A 4XROA 4NX4C 1AFVA 1M9CC 1YJWP 3DTJA 3RG6C 1NJIQ 5F2KA 2OARA 3H4EA 3P05A 1IUQA 3H47A 2Z44A 3VRLC 4DGEC 4GR2A 1VQMP 3CCUP 1A43A 1AUMA 4XRQA 1VQNP 1Q7YQ 3CCMP 5F2OA 1E6JP 1AK4C 2JPRA 4M0IA 3BP9A 2XT1A 4E92A 4XFZA 1N8RQ 2PEMA 3DS0A 1RO0A 2M8NA 1EIAA 1VQOP 2PWMA 4U0FA 1G03A 5JPAA 3B5IA 1YJNP 4XFXA 5HGNA 1Q82Q 2PEKA 3DS3A 3G1IA 3G26A 3CXCO 5BS2A 4U0DA 1BAJA 2PENA 4COCA 3CCJP 2OTLP 4LQWC 1VQ9P 1KD1Q 3CC7P 1VQPP 2X82A 1K9MQ 1EM9A 2DGYA 1QVGO 1QVFO 3DPHA 2JO0A 4U0BA 3DS1A 2OTJP 3WBHA 1K30A 1VQLP 4PH0A 1L6NA 2PEQA 2Y4ZA 1YI2P 1K8AQ 3OW2O 2EIAA 2WLVA 1ZMBA 2PEOA 3LRYA 4PH2A 4J93A 3HYBA 2QA4P 2JYGA 1VQ6P 2XGUA 3CCEP 4U0CA 1VQKP 3CC4P 4INBA 1GWPA 4GR6A 2XXMA 2M8PA 2WLVB 2BUOA 1EOQA 3Q20A 5I4TG 1S72P 2X83A 3G71P 2E1MA 1Q81Q 5DCKA 1U7KA 5HGKA 4IPYA 1Q86Q 3CD6P 3M1MA 1M9FC 4DGAC 3G29A 5HGLA 3G0VA 3CCLP 3G1GA 4E91A 5BS1A 1M9XC 3CCRP 1JJ2O 1M1KQ 3MGEA 2QEXP 3CCSP 2P9XA 2PEIA 3CC2P 3CMEP 1YJ9P 4U0AA 5F2NA 4HTWA 3CCQP 2XGYA 4U0EA 3G21A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDE A;  2XV6 A;  2M8L A;  4XFY A;  2XGV A;  3DS5 A;  2GON A;  4PH3 A;  2PXR C;  5HGM A;  1QRJ A;  2PWO A;  4PH1 A;  2KGF A;  1P7N A;  2LF4 A;  2GOL B;  5HGO A;  2KOD A;  3DS4 A;  2L6E A;  1M9E C;  2X2D D;  1A8O A;  4COP A;  1M9Y C;  4QNB A;  2ONT A;  4WYM A;  2V4X A;  4B4N A;  3DS2 A;  1D1D A;  2JYL A;  1M9D C;  3NTE A;  3G28 A;  4XRO A;  4NX4 C;  1AFV A;  1M9C C;  3DTJ A;  3H4E A;  3P05 A;  3H47 A;  3VRL C;  4DGE C;  1A43 A;  1AUM A;  4XRQ A;  1E6J P;  1AK4 C;  2JPR A;  4M0I A;  3BP9 A;  2XT1 A;  4E92 A;  4XFZ A;  3DS0 A;  2M8N A;  1EIA A;  2PWM A;  4U0F A;  1G03 A;  5JPA A;  4XFX A;  5HGN A;  3DS3 A;  3G1I A;  3G26 A;  4U0D A;  1BAJ A;  4COC A;  4LQW C;  2X82 A;  1EM9 A;  3DPH A;  2JO0 A;  4U0B A;  3DS1 A;  4PH0 A;  1L6N A;  2Y4Z A;  2EIA A;  2WLV A;  3LRY A;  4PH2 A;  4J93 A;  2JYG A;  2XGU A;  4U0C A;  4INB A;  1GWP A;  2XXM A;  2M8P A;  2WLV B;  2BUO A;  1EOQ A;  5I4T G;  2X83 A;  5DCK A;  1U7K A;  5HGK A;  4IPY A;  1M9F C;  4DGA C;  3G29 A;  5HGL A;  3G0V A;  3G1G A;  4E91 A;  1M9X C;  3MGE A;  4U0A A;  4HTW A;  2XGY A;  4U0E A;  3G21 A; 
#chains in the Genus database with same CATH topology
 2XDE A;  2XV6 A;  3CE7 A;  1VQ7 P;  4PH3 A;  3EJE A;  2FAE A;  2VLP A;  2Z46 A;  1W2B O;  4PH1 A;  2MR7 A;  1VQ8 P;  3I56 P;  2JB0 A;  1M90 Q;  2KG6 A;  3HZQ A;  1GPJ A;  2GOL B;  4MRT C;  1M9E C;  2EHS A;  1KC8 Q;  2LIU A;  2N50 A;  3GZL A;  4BPF A;  4QNB A;  3H0D A;  2EFJ A;  1RO2 A;  3RG6 C;  2KGC A;  2OAR A;  3H4E A;  2FQ1 A;  1VQM P;  3CCU P;  1A43 A;  5KP8 B;  2N6Y A;  2JPR A;  3BP9 A;  4E92 A;  1DV5 A;  2PWM A;  1L0I A;  4IZ6 A;  2K94 A;  4XFX A;  4U0D A;  2PEN A;  4COC A;  2OTL P;  4LQW C;  1VQ9 P;  1GXG A;  3CC7 P;  1K9M Q;  1EM9 A;  1OR5 A;  1KLP A;  2LTE A;  1L6N A;  1K8A Q;  1YI2 P;  2KR5 A;  2MVV A;  2K92 A;  3NY7 B;  4H2W C;  2EHT A;  2GZF A;  5HVC A;  2JYG A;  5KP6 B;  4U0C A;  2JU1 A;  2X83 A;  3CCL P;  1JJ2 O;  2VLN A;  2GZE A;  2PEI A;  1YJ9 P;  4U0A A;  5F2N A;  2KG9 A;  2XGV A;  4H2X C;  2ERH A;  1YHQ P;  2GYK A;  1Z6M A;  2PNG A;  3CCV P;  4CA3 A;  2KGF A;  2PY8 A;  1VHN A;  3CMA P;  2LPK A;  1VQ4 P;  2KOD A;  3I55 P;  1YIT P;  1RNI A;  2KOR A;  4NEO A;  4WYM A;  2CQ8 A;  2V4X A;  4B4N A;  2MR8 A;  3DS2 A;  3G28 A;  1E0H A;  3DTJ A;  1NJI Q;  3U43 A;  2KWL A;  1ACP A;  3VRL C;  4DGE C;  2JBG A;  2MVU A;  4F37 A;  1VQN P;  4XRQ A;  4R0M A;  1UNK A;  2XT1 A;  5HV8 A;  4XFZ A;  4BPH A;  1HQB A;  2JU2 A;  1EIA A;  1VQO P;  4U0F A;  5JPA A;  1YJN P;  3DS3 A;  3G1I A;  2FVF A;  3CXC O;  5BS2 A;  1BAJ A;  2X82 A;  2DGY A;  1VKU A;  4U0B A;  2K0Y A;  3DS1 A;  4DG9 A;  3WBH A;  1VQL P;  2L22 A;  4PWV B;  3RG2 A;  1DNY A;  3LRY A;  1ZMB A;  4PH2 A;  3HYB A;  1VQ6 P;  2XGU A;  3CCE P;  2KOP A;  2FQ2 A;  1VQK P;  4GR6 A;  2XXM A;  1EOQ A;  2K0D X;  2KOS A;  5DCK A;  1Q86 Q;  3CD6 P;  3M1M A;  1M9F C;  1F80 D;  1AF8 A;  5BS1 A;  1M1K Q;  1EMV A;  2X2B A;  3CC2 P;  1L0H A;  4HTW A;  3EJB A;  2LML A;  4U0E A;  3G21 A;  4XFY A;  2AFD A;  3DS5 A;  4PXH B;  3G6E P;  2PWO A;  1YIJ P;  2EG5 A;  2BHV A;  1M6N A;  1X3O A;  2KGD A;  2PEJ A;  2N5I A;  1MZ8 A;  3E2D A;  2LF4 A;  5HGO A;  2L6E A;  2X2D D;  2GZI A;  1A8O A;  1M6E X;  4COP A;  2FVE A;  1M9Y C;  1UJZ A;  2CG5 B;  1VQ5 P;  2ONT A;  1IMP A;  1K73 Q;  2ROQ A;  2MD9 A;  4NX4 C;  1AFV A;  2AF8 A;  2FAC A;  1M9C C;  5CZD B;  1YJW P;  2CNR A;  3P05 A;  1IUQ A;  1HY8 A;  4GR2 A;  2JAZ A;  5F2O A;  1E6J P;  1N8R Q;  2MF4 A;  2WPT A;  3DS0 A;  2PEM A;  2NO8 A;  4HKG A;  2XZ0 D;  2XZ1 C;  5HGN A;  2GZG A;  3CCJ P;  2FHS C;  2MY5 A;  1VQP P;  3LMO A;  1QVG O;  1QVF O;  1K30 A;  2KGE A;  5EJD A;  4PH0 A;  3OW2 O;  2WLV A;  2PEO A;  2VLQ A;  2GDY A;  2QA4 P;  2GDW A;  2DNW A;  3B4Q A;  4INB A;  4QKO A;  1GWP A;  2E1M A;  1Q81 Q;  2GZJ A;  2KG8 A;  4UHP B;  3G29 A;  5HGL A;  3CCR P;  2KW2 A;  3MGE A;  1IMQ A;  2QEX P;  3CCS P;  3CME P;  7CEI A;  2XGY A;  2K0X A;  3EJD A;  2M8L A;  1KQS O;  2K5X A;  2GON A;  3GJN A;  3GKL C;  2PXR C;  5HGM A;  1QRJ A;  2CWO A;  2QNW A;  1BXI A;  3CPW O;  2VSQ A;  1P7N A;  2JGP A;  3DS4 A;  2N98 A;  2Z45 A;  2AFE A;  2L9F A;  3G4S P;  1D1D A;  2JYL A;  2N6Z A;  1M9D C;  1M74 A;  3NTE A;  5EW5 E;  4XRO A;  2FAD A;  1T8K A;  2LIW A;  5F2K A;  3H47 A;  2Z44 A;  1NQ4 A;  1AUM A;  1Q7Y Q;  1CEI A;  3CCM P;  1AK4 C;  2LKI A;  4M0I A;  1ZNV A;  1RO0 A;  2M8N A;  1G03 A;  2CGQ A;  3B5I A;  1Q82 Q;  2PEK A;  3G26 A;  1KD1 Q;  2K2Q A;  2N5H A;  2LOL A;  2VLO A;  3DPH A;  2JO0 A;  2JQ4 A;  2KGA A;  1GXH A;  2OTJ P;  2KOO A;  2LL8 A;  1AYI A;  2PEQ A;  2FVA A;  2Y4Z A;  2EIA A;  2M5R A;  4J93 A;  2L4B A;  2K93 A;  1FR2 A;  3CC4 P;  4H2Y C;  2M8P A;  2WLV B;  2BUO A;  2GDX A;  3Q20 A;  5I4T G;  1S72 P;  5KP7 B;  3G71 P;  1U7K A;  5HGK A;  4IPY A;  2L0Q A;  2KOQ A;  2FQ0 A;  4DGA C;  3G0V A;  3G1G A;  4E91 A;  1M9X C;  2AVA A;  2P9X A;  3GZM A;  4BPG A;  3CCQ P; 
#chains in the Genus database with same CATH homology
 2XDE A;  2XV6 A;  2M8L A;  1KQS O;  4XFY A;  2XGV A;  3DS5 A;  2GON A;  1VQ7 P;  4PH3 A;  2PXR C;  5HGM A;  1YHQ P;  1QRJ A;  3CCV P;  2Z46 A;  3G6E P;  1W2B O;  2PWO A;  4PH1 A;  1YIJ P;  2KGF A;  2EG5 A;  2PY8 A;  2BHV A;  2CWO A;  3CMA P;  1M6N A;  1VQ8 P;  3CPW O;  1VQ4 P;  3I56 P;  1P7N A;  2PEJ A;  1M90 Q;  3E2D A;  2LF4 A;  2GOL B;  3HZQ A;  5HGO A;  2KOD A;  3DS4 A;  2L6E A;  1M9E C;  2X2D D;  2Z45 A;  1A8O A;  3I55 P;  1M6E X;  4COP A;  1KC8 Q;  1YIT P;  1RNI A;  1M9Y C;  4QNB A;  3H0D A;  1VQ5 P;  2ONT A;  4WYM A;  2EFJ A;  2V4X A;  4B4N A;  3DS2 A;  3G4S P;  1D1D A;  1K73 Q;  2JYL A;  1RO2 A;  1M9D C;  1M74 A;  3NTE A;  3G28 A;  4XRO A;  4NX4 C;  1AFV A;  1M9C C;  1YJW P;  3DTJ A;  3RG6 C;  1NJI Q;  5F2K A;  2OAR A;  3H4E A;  3P05 A;  1IUQ A;  3H47 A;  2Z44 A;  3VRL C;  4DGE C;  4GR2 A;  1VQM P;  3CCU P;  1A43 A;  1AUM A;  4XRQ A;  1VQN P;  1Q7Y Q;  3CCM P;  5F2O A;  1E6J P;  1AK4 C;  2JPR A;  4M0I A;  3BP9 A;  2XT1 A;  4E92 A;  4XFZ A;  1N8R Q;  2PEM A;  3DS0 A;  1RO0 A;  2M8N A;  1EIA A;  1VQO P;  2PWM A;  4U0F A;  1G03 A;  5JPA A;  3B5I A;  1YJN P;  4XFX A;  5HGN A;  1Q82 Q;  2PEK A;  3DS3 A;  3G1I A;  3G26 A;  3CXC O;  5BS2 A;  4U0D A;  1BAJ A;  2PEN A;  4COC A;  3CCJ P;  2OTL P;  4LQW C;  1VQ9 P;  1KD1 Q;  3CC7 P;  1VQP P;  2X82 A;  1K9M Q;  1EM9 A;  2DGY A;  1QVG O;  1QVF O;  3DPH A;  2JO0 A;  4U0B A;  3DS1 A;  2OTJ P;  3WBH A;  1K30 A;  1VQL P;  4PH0 A;  1L6N A;  2PEQ A;  2Y4Z A;  1YI2 P;  1K8A Q;  3OW2 O;  2EIA A;  2WLV A;  1ZMB A;  2PEO A;  3LRY A;  4PH2 A;  4J93 A;  3HYB A;  2QA4 P;  2JYG A;  1VQ6 P;  2XGU A;  3CCE P;  4U0C A;  1VQK P;  3CC4 P;  4INB A;  1GWP A;  4GR6 A;  2XXM A;  2M8P A;  2WLV B;  2BUO A;  1EOQ A;  3Q20 A;  5I4T G;  1S72 P;  2X83 A;  3G71 P;  2E1M A;  1Q81 Q;  5DCK A;  1U7K A;  5HGK A;  4IPY A;  1Q86 Q;  3CD6 P;  3M1M A;  1M9F C;  4DGA C;  3G29 A;  5HGL A;  3G0V A;  3CCL P;  3G1G A;  4E91 A;  5BS1 A;  1M9X C;  3CCR P;  1JJ2 O;  1M1K Q;  3MGE A;  2QEX P;  3CCS P;  2P9X A;  2PEI A;  3CC2 P;  3CME P;  1YJ9 P;  4U0A A;  5F2N A;  4HTW A;  3CCQ P;  2XGY A;  4U0E A;  3G21 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...