1E6JP

Crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
VHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN
publication title Mutual Conformational Adaptations in Antigen and Antibody Upon Complex Formation between an Fab and HIV-1 Capsid Protein P24
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Viral protein
total genus 66
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1e6jP01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1e6jP02
1M9FC 2V4XA 1G03A 2JPRA 5I4TG 2PWMA 2XV6A 3P05A 5DCKA 4B4NA 4IPYA 2XDEA 4M0IA 4COCA 2XGYA 1M9CC 1A8OA 5HGOA 5HGKA 5HGMA 2PXRC 4E91A 2WLVA 2PWOA 4XROA 1D1DA 2XGVA 4HTWA 4NX4C 2BUOA 4J93A 1EOQA 2X83A 3G26A 5JPAA 1M9EC 2JYGA 3G29A 4E92A 2GONA 1BAJA 1QRJA 1AK4C 2KGFA 3G1IA 4DGEC 1P7NA 2WLVB 1L6NA 3LRYA 3DS4A 1EM9A 4COPA 2M8NA 2LF4A 1AUMA 1A43A 4QNBA 2JYLA 3G21A 3MGEA 3H47A 3NTEA 3H4EA 2EIAA 3VRLC 4PH3A 2X82A 4INBA 2XXMA 4PH0A 1GWPA 3DS5A 4U0DA 4XFXA 3DS1A 2XGUA 4U0CA 2L6EA 4XFYA 4U0BA 4XFZA 1M9DC 1U7KA 5HGNA 3DS3A 2X2DD 3DTJA 2KODA 2XT1A 3G28A 3BP9A 3G1GA 1M9XC 2GOLB 4WYMA 4XRQA 3DPHA 1M9YC 4U0AA 2ONTA 3DS0A 2M8LA 1AFVA 3G0VA 4U0FA 4PH2A 1E6JP 5HGLA 2JO0A 2M8PA 4DGAC 3DS2A 4PH1A 4LQWC 1EIAA 2Y4ZA 4U0EA
chains in the Genus database with same CATH superfamily
1OR5A 2WPTA 1G03A 1VQPP 2GZEA 1ZNVA 2K0YA 4COCA 1M9CC 3WBHA 2JU1A 3CCMP 2CQ8A 5HGKA 5HGMA 4E91A 2WLVA 2NO8A 2GDYA 2PWOA 4XROA 2PEMA 1GXHA 2BUOA 4J93A 2KGAA 2X2BA 3CCQP 1Q7YQ 2AVAA 2JYGA 2DNWA 2LTEA 1BAJA 1QRJA 2KORA 3OW2O 3G1IA 2DGYA 4DGEC 2LOLA 1QVGO 2Z46A 1DNYA 2LIWA 2CGQA 2GDWA 3DS4A 2LL8A 1EM9A 4COPA 4QKOA 2FADA 2L22A 1Q81Q 2FQ0A 5KP6B 2K0XA 1VQMP 1YITP 2VSQA 1A43A 2VLOA 1RO2A 5CZDB 1VQ9P 3H4EA 2EIAA 4INBA 4U0DA 1K8AQ 2FVAA 4U0CA 3CPWO 2BHVA 1YIJP 1M9DC 2PEKA 1U7KA 2X2DD 2XZ0D 2FHSC 3G28A 1AF8A 2LMLA 1HQBA 3DPHA 1M9YC 4U0AA 2ONTA 4PWVB 5HVCA 1YJ9P 2L0QA 2KGCA 3G0VA 2FAEA 4IZ6A 5HGLA 1UJZA 2JO0A 1Q86Q 1VQLP 3EJBA 1UNKA 4DGAC 3EJEA 2EHTA 2MF4A 2Y4ZA 3CCSP 4U0EA 3CD6P 3CC7P 1M9FC 2N6ZA 1AYIA 1KLPA 1E0HA 2JPRA 2KOQA 7CEIA 1VQ6P 1Z6MA 3RG6C 5F2NA 2JQ4A 4B4NA 2L9FA 3HYBA 2XGYA 1K9MQ 5HGOA 2N50A 2PNGA 4F37A 4BPFA 1CEIA 2PXRC 4BPHA 3CE7A 4HTWA 2L4BA 3G26A 1KC8Q 5JPAA 2GZFA 2N5HA 2K94A 3GJNA 3NY7B 4PXHB 2Z44A 1VQOP 2GZGA 2K92A 1AK4C 2JB0A 1S72P 1EMVA 5HV8A 1L0HA 2GYKA 2E1MA 2KR5A 2KG9A 2KOSA 1NQ4A 2M5RA 3CMEP 2EHSA 3I55P 2GZIA 3CXCO 2GZJA 4CA3A 3CCRP 1KQSO 5F2OA 4QNBA 1F80D 2GDXA 4PH3A 2AFEA 2VLPA 4PH0A 3G6EP 2QA4P 1X3OA 4XFXA 3DS1A 1YJNP 3RG2A 4XFYA 4R0MA 2MY5A 4XFZA 5HGNA 2PEQA 3B4QA 1L0IA 2KOPA 2KODA 2FVFA 2K5XA 1M9XC 2ROQA 2KOOA 2GOLB 2KGEA 1IMPA 2M8LA 1N8RQ 3GZMA 1M1KQ 2PY8A 3H0DA 1ACPA 1M74A 2M8PA 2FACA 3DS2A 4LQWC 1EIAA 3DS3A 2N98A 1IUQA 3G4SP 4HKGA 4GR6A 1VQ7P 3GKLC 3Q20A 5DCKA 4IPYA 4M0IA 1A8OA 2N5IA 2CG5B 4NX4C 2AFDA 1EOQA 2X83A 1VQ5P 3I56P 2PEJA 1M9EC 5BS2A 3CCLP 2VLNA 2LIUA 2ERHA 2GONA 4H2YC 1VQKP 5KP7B 2KG8A 1VQNP 1GXGA 2OARA 1RNIA 2CNRA 3CCVP 4GR2A 1YHQP 1HY8A 2M8NA 2MR8A 2LF4A 1JJ2O 2JYLA 3MGEA 3H47A 2PENA 1ZMBA 2MVUA 1GWPA 2MR7A 2KGDA 3B5IA 2VLQA 3CCJP 2XGUA 1W2BO 2EFJA 2XZ1C 3LMOA 2JU2A 3BP9A 3G1GA 3HZQA 1RO0A 3DS0A 2FVEA 1AFVA 4H2WC 2N6YA 2QNWA 5EW5E 1E6JP 1GPJA 1MZ8A 2JAZA 1VQ4P 2CWOA 2Z45A 3G71P 4H2XC 2V4XA 2QEXP 5I4TG 1YI2P 3EJDA 2PWMA 1K73Q 2XV6A 3P05A 3CCUP 2XDEA 3E2DA 1IMQA 1Q82Q 1BXIA 1NJIQ 2FQ1A 1D1DA 2XGVA 1M90Q 1VKUA 3U43A 2AF8A 2KW2A 1M6NA 2K2QA 4BPGA 2LPKA 3G29A 1DV5A 4E92A 1YJWP 2KGFA 1FR2A 2OTJP 1P7NA 2WLVB 1L6NA 3LRYA 2EG5A 2K0DX 2K93A 4MRTC 4DG9A 2JBGA 5BS1A 2KWLA 2LKIA 3GZLA 1AUMA 3G21A 3NTEA 3VRLC 3M1MA 2PEIA 5F2KA 2X82A 2XXMA 2MVVA 1M6EX 3DS5A 2PEOA 4UHPB 2L6EA 4U0BA 2P9XA 2OTLP 3CCEP 3DTJA 2XT1A 1KD1Q 1QVFO 4WYMA 5EJDA 2KG6A 4XRQA 3CC2P 3CMAP 5KP8B 2FQ2A 1VHNA 4NEOA 4U0FA 4PH2A 1VQ8P 2MD9A 1T8KA 2JGPA 4PH1A 1K30A 3CC4P
chains in the Genus database with same CATH topology
1M9FC 1IUQA 3G4SP 2V4XA 1G03A 2QEXP 4GR6A 1VQ7P 2JPRA 5I4TG 1VQPP 1YI2P 1K73Q 2PWMA 1VQ6P 2XV6A 3RG6C 3P05A 3Q20A 5F2NA 5DCKA 4B4NA 4IPYA 3CCUP 2XDEA 3E2DA 4M0IA 4COCA 3HYBA 2XGYA 1M9CC 1A8OA 3WBHA 1Q82Q 1K9MQ 5HGOA 3CCMP 1NJIQ 5HGKA 5HGMA 2PXRC 4E91A 2WLVA 2PWOA 4XROA 1D1DA 2XGVA 4HTWA 2PEMA 1M90Q 4NX4C 2BUOA 4J93A 3CCQP 1EOQA 2X83A 1VQ5P 1Q7YQ 3G26A 3I56P 1KC8Q 2PEJA 5JPAA 1M9EC 2JYGA 1M6NA 5BS2A 3CCLP 3G29A 4E92A 2Z44A 1VQOP 2GONA 1BAJA 1QRJA 1YJWP 1AK4C 3OW2O 1VQKP 2KGFA 3G1IA 2DGYA 1S72P 4DGEC 1VQNP 1QVGO 2Z46A 2OTJP 2OARA 1RNIA 1P7NA 2WLVB 1L6NA 3LRYA 2EG5A 2E1MA 3DS4A 1EM9A 3CCVP 4GR2A 1YHQP 4COPA 3CCSP 2M8NA 5BS1A 3CMEP 2LF4A 3I55P 1Q81Q 3CXCO 1JJ2O 1AUMA 1VQMP 1YITP 3CCRP 1KQSO 5F2OA 1A43A 4QNBA 2JYLA 3G21A 1RO2A 3MGEA 3H47A 3NTEA 2PENA 1VQ9P 3H4EA 2EIAA 3VRLC 1ZMBA 3M1MA 4PH3A 2PEIA 5F2KA 2X82A 4INBA 2XXMA 4PH0A 1M6EX 3G6EP 1GWPA 2QA4P 3DS5A 2PEOA 3B5IA 4U0DA 4XFXA 3CCJP 3DS1A 1YJNP 2XGUA 1K8AQ 4U0CA 2L6EA 4XFYA 4U0BA 3CPWO 1W2BO 4XFZA 2BHVA 1YIJP 3CD6P 1M9DC 2PEKA 2EFJA 2P9XA 1U7KA 5HGNA 3CC7P 3DS3A 2X2DD 2PEQA 3DTJA 3CCEP 2OTLP 2KODA 2XT1A 1KD1Q 1QVFO 3G28A 3BP9A 3G1GA 3HZQA 1M9XC 2GOLB 4WYMA 1RO0A 3CC2P 4XRQA 3CMAP 3DPHA 1M9YC 4U0AA 2ONTA 3DS0A 1YJ9P 2M8LA 1AFVA 3G0VA 4U0FA 4PH2A 1VQ8P 1E6JP 5HGLA 1N8RQ 2JO0A 1Q86Q 1M1KQ 2PY8A 1VQLP 3H0DA 1M74A 2M8PA 4DGAC 3DS2A 1VQ4P 2CWOA 4PH1A 4LQWC 1EIAA 2Y4ZA 4U0EA 1K30A 2Z45A 3CC4P 3G71P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9F C;  2V4X A;  1G03 A;  2JPR A;  5I4T G;  2PWM A;  2XV6 A;  3P05 A;  5DCK A;  4B4N A;  4IPY A;  2XDE A;  4M0I A;  4COC A;  2XGY A;  1M9C C;  1A8O A;  5HGO A;  5HGK A;  5HGM A;  2PXR C;  4E91 A;  2WLV A;  2PWO A;  4XRO A;  1D1D A;  2XGV A;  4HTW A;  4NX4 C;  2BUO A;  4J93 A;  1EOQ A;  2X83 A;  3G26 A;  5JPA A;  1M9E C;  2JYG A;  3G29 A;  4E92 A;  2GON A;  1BAJ A;  1QRJ A;  1AK4 C;  2KGF A;  3G1I A;  4DGE C;  1P7N A;  2WLV B;  1L6N A;  3LRY A;  3DS4 A;  1EM9 A;  4COP A;  2M8N A;  2LF4 A;  1AUM A;  1A43 A;  4QNB A;  2JYL A;  3G21 A;  3MGE A;  3H47 A;  3NTE A;  3H4E A;  2EIA A;  3VRL C;  4PH3 A;  2X82 A;  4INB A;  2XXM A;  4PH0 A;  1GWP A;  3DS5 A;  4U0D A;  4XFX A;  3DS1 A;  2XGU A;  4U0C A;  2L6E A;  4XFY A;  4U0B A;  4XFZ A;  1M9D C;  1U7K A;  5HGN A;  3DS3 A;  2X2D D;  3DTJ A;  2KOD A;  2XT1 A;  3G28 A;  3BP9 A;  3G1G A;  1M9X C;  2GOL B;  4WYM A;  4XRQ A;  3DPH A;  1M9Y C;  4U0A A;  2ONT A;  3DS0 A;  2M8L A;  1AFV A;  3G0V A;  4U0F A;  4PH2 A;  1E6J P;  5HGL A;  2JO0 A;  2M8P A;  4DGA C;  3DS2 A;  4PH1 A;  4LQW C;  1EIA A;  2Y4Z A;  4U0E A; 
#chains in the Genus database with same CATH topology
 1OR5 A;  2WPT A;  1G03 A;  1VQP P;  2GZE A;  1ZNV A;  2K0Y A;  4COC A;  1M9C C;  3WBH A;  2JU1 A;  3CCM P;  2CQ8 A;  5HGK A;  5HGM A;  4E91 A;  2WLV A;  2NO8 A;  2GDY A;  2PWO A;  4XRO A;  2PEM A;  1GXH A;  2BUO A;  4J93 A;  2KGA A;  2X2B A;  3CCQ P;  1Q7Y Q;  2AVA A;  2JYG A;  2DNW A;  2LTE A;  1BAJ A;  1QRJ A;  2KOR A;  3OW2 O;  3G1I A;  2DGY A;  4DGE C;  2LOL A;  1QVG O;  2Z46 A;  1DNY A;  2LIW A;  2CGQ A;  2GDW A;  3DS4 A;  2LL8 A;  1EM9 A;  4COP A;  4QKO A;  2FAD A;  2L22 A;  1Q81 Q;  2FQ0 A;  5KP6 B;  2K0X A;  1VQM P;  1YIT P;  2VSQ A;  1A43 A;  2VLO A;  1RO2 A;  5CZD B;  1VQ9 P;  3H4E A;  2EIA A;  4INB A;  4U0D A;  1K8A Q;  2FVA A;  4U0C A;  3CPW O;  2BHV A;  1YIJ P;  1M9D C;  2PEK A;  1U7K A;  2X2D D;  2XZ0 D;  2FHS C;  3G28 A;  1AF8 A;  2LML A;  1HQB A;  3DPH A;  1M9Y C;  4U0A A;  2ONT A;  4PWV B;  5HVC A;  1YJ9 P;  2L0Q A;  2KGC A;  3G0V A;  2FAE A;  4IZ6 A;  5HGL A;  1UJZ A;  2JO0 A;  1Q86 Q;  1VQL P;  3EJB A;  1UNK A;  4DGA C;  3EJE A;  2EHT A;  2MF4 A;  2Y4Z A;  3CCS P;  4U0E A;  3CD6 P;  3CC7 P;  1M9F C;  2N6Z A;  1AYI A;  1KLP A;  1E0H A;  2JPR A;  2KOQ A;  7CEI A;  1VQ6 P;  1Z6M A;  3RG6 C;  5F2N A;  2JQ4 A;  4B4N A;  2L9F A;  3HYB A;  2XGY A;  1K9M Q;  5HGO A;  2N50 A;  2PNG A;  4F37 A;  4BPF A;  1CEI A;  2PXR C;  4BPH A;  3CE7 A;  4HTW A;  2L4B A;  3G26 A;  1KC8 Q;  5JPA A;  2GZF A;  2N5H A;  2K94 A;  3GJN A;  3NY7 B;  4PXH B;  2Z44 A;  1VQO P;  2GZG A;  2K92 A;  1AK4 C;  2JB0 A;  1S72 P;  1EMV A;  5HV8 A;  1L0H A;  2GYK A;  2E1M A;  2KR5 A;  2KG9 A;  2KOS A;  1NQ4 A;  2M5R A;  3CME P;  2EHS A;  3I55 P;  2GZI A;  3CXC O;  2GZJ A;  4CA3 A;  3CCR P;  1KQS O;  5F2O A;  4QNB A;  1F80 D;  2GDX A;  4PH3 A;  2AFE A;  2VLP A;  4PH0 A;  3G6E P;  2QA4 P;  1X3O A;  4XFX A;  3DS1 A;  1YJN P;  3RG2 A;  4XFY A;  4R0M A;  2MY5 A;  4XFZ A;  5HGN A;  2PEQ A;  3B4Q A;  1L0I A;  2KOP A;  2KOD A;  2FVF A;  2K5X A;  1M9X C;  2ROQ A;  2KOO A;  2GOL B;  2KGE A;  1IMP A;  2M8L A;  1N8R Q;  3GZM A;  1M1K Q;  2PY8 A;  3H0D A;  1ACP A;  1M74 A;  2M8P A;  2FAC A;  3DS2 A;  4LQW C;  1EIA A;  3DS3 A;  2N98 A;  1IUQ A;  3G4S P;  4HKG A;  4GR6 A;  1VQ7 P;  3GKL C;  3Q20 A;  5DCK A;  4IPY A;  4M0I A;  1A8O A;  2N5I A;  2CG5 B;  4NX4 C;  2AFD A;  1EOQ A;  2X83 A;  1VQ5 P;  3I56 P;  2PEJ A;  1M9E C;  5BS2 A;  3CCL P;  2VLN A;  2LIU A;  2ERH A;  2GON A;  4H2Y C;  1VQK P;  5KP7 B;  2KG8 A;  1VQN P;  1GXG A;  2OAR A;  1RNI A;  2CNR A;  3CCV P;  4GR2 A;  1YHQ P;  1HY8 A;  2M8N A;  2MR8 A;  2LF4 A;  1JJ2 O;  2JYL A;  3MGE A;  3H47 A;  2PEN A;  1ZMB A;  2MVU A;  1GWP A;  2MR7 A;  2KGD A;  3B5I A;  2VLQ A;  3CCJ P;  2XGU A;  1W2B O;  2EFJ A;  2XZ1 C;  3LMO A;  2JU2 A;  3BP9 A;  3G1G A;  3HZQ A;  1RO0 A;  3DS0 A;  2FVE A;  1AFV A;  4H2W C;  2N6Y A;  2QNW A;  5EW5 E;  1E6J P;  1GPJ A;  1MZ8 A;  2JAZ A;  1VQ4 P;  2CWO A;  2Z45 A;  3G71 P;  4H2X C;  2V4X A;  2QEX P;  5I4T G;  1YI2 P;  3EJD A;  2PWM A;  1K73 Q;  2XV6 A;  3P05 A;  3CCU P;  2XDE A;  3E2D A;  1IMQ A;  1Q82 Q;  1BXI A;  1NJI Q;  2FQ1 A;  1D1D A;  2XGV A;  1M90 Q;  1VKU A;  3U43 A;  2AF8 A;  2KW2 A;  1M6N A;  2K2Q A;  4BPG A;  2LPK A;  3G29 A;  1DV5 A;  4E92 A;  1YJW P;  2KGF A;  1FR2 A;  2OTJ P;  1P7N A;  2WLV B;  1L6N A;  3LRY A;  2EG5 A;  2K0D X;  2K93 A;  4MRT C;  4DG9 A;  2JBG A;  5BS1 A;  2KWL A;  2LKI A;  3GZL A;  1AUM A;  3G21 A;  3NTE A;  3VRL C;  3M1M A;  2PEI A;  5F2K A;  2X82 A;  2XXM A;  2MVV A;  1M6E X;  3DS5 A;  2PEO A;  4UHP B;  2L6E A;  4U0B A;  2P9X A;  2OTL P;  3CCE P;  3DTJ A;  2XT1 A;  1KD1 Q;  1QVF O;  4WYM A;  5EJD A;  2KG6 A;  4XRQ A;  3CC2 P;  3CMA P;  5KP8 B;  2FQ2 A;  1VHN A;  4NEO A;  4U0F A;  4PH2 A;  1VQ8 P;  2MD9 A;  1T8K A;  2JGP A;  4PH1 A;  1K30 A;  3CC4 P; 
#chains in the Genus database with same CATH homology
 1M9F C;  1IUQ A;  3G4S P;  2V4X A;  1G03 A;  2QEX P;  4GR6 A;  1VQ7 P;  2JPR A;  5I4T G;  1VQP P;  1YI2 P;  1K73 Q;  2PWM A;  1VQ6 P;  2XV6 A;  3RG6 C;  3P05 A;  3Q20 A;  5F2N A;  5DCK A;  4B4N A;  4IPY A;  3CCU P;  2XDE A;  3E2D A;  4M0I A;  4COC A;  3HYB A;  2XGY A;  1M9C C;  1A8O A;  3WBH A;  1Q82 Q;  1K9M Q;  5HGO A;  3CCM P;  1NJI Q;  5HGK A;  5HGM A;  2PXR C;  4E91 A;  2WLV A;  2PWO A;  4XRO A;  1D1D A;  2XGV A;  4HTW A;  2PEM A;  1M90 Q;  4NX4 C;  2BUO A;  4J93 A;  3CCQ P;  1EOQ A;  2X83 A;  1VQ5 P;  1Q7Y Q;  3G26 A;  3I56 P;  1KC8 Q;  2PEJ A;  5JPA A;  1M9E C;  2JYG A;  1M6N A;  5BS2 A;  3CCL P;  3G29 A;  4E92 A;  2Z44 A;  1VQO P;  2GON A;  1BAJ A;  1QRJ A;  1YJW P;  1AK4 C;  3OW2 O;  1VQK P;  2KGF A;  3G1I A;  2DGY A;  1S72 P;  4DGE C;  1VQN P;  1QVG O;  2Z46 A;  2OTJ P;  2OAR A;  1RNI A;  1P7N A;  2WLV B;  1L6N A;  3LRY A;  2EG5 A;  2E1M A;  3DS4 A;  1EM9 A;  3CCV P;  4GR2 A;  1YHQ P;  4COP A;  3CCS P;  2M8N A;  5BS1 A;  3CME P;  2LF4 A;  3I55 P;  1Q81 Q;  3CXC O;  1JJ2 O;  1AUM A;  1VQM P;  1YIT P;  3CCR P;  1KQS O;  5F2O A;  1A43 A;  4QNB A;  2JYL A;  3G21 A;  1RO2 A;  3MGE A;  3H47 A;  3NTE A;  2PEN A;  1VQ9 P;  3H4E A;  2EIA A;  3VRL C;  1ZMB A;  3M1M A;  4PH3 A;  2PEI A;  5F2K A;  2X82 A;  4INB A;  2XXM A;  4PH0 A;  1M6E X;  3G6E P;  1GWP A;  2QA4 P;  3DS5 A;  2PEO A;  3B5I A;  4U0D A;  4XFX A;  3CCJ P;  3DS1 A;  1YJN P;  2XGU A;  1K8A Q;  4U0C A;  2L6E A;  4XFY A;  4U0B A;  3CPW O;  1W2B O;  4XFZ A;  2BHV A;  1YIJ P;  3CD6 P;  1M9D C;  2PEK A;  2EFJ A;  2P9X A;  1U7K A;  5HGN A;  3CC7 P;  3DS3 A;  2X2D D;  2PEQ A;  3DTJ A;  3CCE P;  2OTL P;  2KOD A;  2XT1 A;  1KD1 Q;  1QVF O;  3G28 A;  3BP9 A;  3G1G A;  3HZQ A;  1M9X C;  2GOL B;  4WYM A;  1RO0 A;  3CC2 P;  4XRQ A;  3CMA P;  3DPH A;  1M9Y C;  4U0A A;  2ONT A;  3DS0 A;  1YJ9 P;  2M8L A;  1AFV A;  3G0V A;  4U0F A;  4PH2 A;  1VQ8 P;  1E6J P;  5HGL A;  1N8R Q;  2JO0 A;  1Q86 Q;  1M1K Q;  2PY8 A;  1VQL P;  3H0D A;  1M74 A;  2M8P A;  4DGA C;  3DS2 A;  1VQ4 P;  2CWO A;  4PH1 A;  4LQW C;  1EIA A;  2Y4Z A;  4U0E A;  1K30 A;  2Z45 A;  3CC4 P;  3G71 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...