1E6JP

Crystal structure of hiv-1 capsid protein (p24) in complex with fab13b5
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
210
structure length
210
Chain Sequence
VHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN
publication title Mutual Conformational Adaptations in Antigen and Antibody Upon Complex Formation between an Fab and HIV-1 Capsid Protein P24
pubmed doi rcsb
source organism Hiv-1 m\:b_hxb2r
molecule tags Viral protein
total genus 66
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2000-08-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1e6jP01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1e6jP02
2L6EA 4NX4C 1P7NA 3G0VA 2X2DD 3G21A 1AUMA 1D1DA 4U0CA 1BAJA 2XV6A 1E6JP 2XGUA 2M8PA 5I4TG 2JO0A 2XGYA 4U0FA 4LQWC 2WLVB 4COCA 3DS0A 3P05A 2GONA 4PH3A 2JYLA 4B4NA 5HGMA 4U0EA 4U0BA 4WYMA 5HGKA 1A8OA 1U7KA 4XFXA 4M0IA 2M8NA 2JYGA 2M8LA 4U0DA 1M9CC 4INBA 3LRYA 1M9EC 2LF4A 2PWMA 3H47A 2GOLB 4PH2A 2XGVA 2JPRA 4XRQA 5HGLA 2Y4ZA 4XROA 2V4XA 3DS1A 1AK4C 4DGEC 2KODA 1EM9A 1M9DC 4QNBA 2X82A 2ONTA 2XT1A 1GWPA 2XXMA 3G1IA 4XFZA 2PXRC 1G03A 4IPYA 4COPA 1QRJA 3DS3A 4HTWA 2KGFA 2PWOA 3DS2A 3DPHA 5DCKA 1M9YC 3MGEA 3G26A 3BP9A 2XDEA 5HGNA 1EOQA 3VRLC 2WLVA 1L6NA 2BUOA 3G28A 4J93A 3DS4A 5JPAA 3DTJA 1M9XC 4DGAC 5HGOA 2X83A 4PH1A 3G29A 1EIAA 2EIAA 1AFVA 4E91A 1A43A 3NTEA 3DS5A 4PH0A 3G1GA 1M9FC 4E92A 4U0AA 4XFYA 3H4EA
chains in the Genus database with same CATH superfamily
1P7NA 5F2OA 1BAJA 1BXIA 2JO0A 2PEOA 1QVFO 2XGYA 3CC4P 4U0FA 1MZ8A 2N98A 2WLVB 2QEXP 2K2QA 3P05A 2GONA 3CE7A 4U0EA 2DNWA 2FVEA 1M1KQ 4WYMA 1IMPA 2GZJA 1VQ4P 4M0IA 2JYGA 4U0DA 1M9CC 4INBA 2QA4P 4BPHA 2MR7A 3Q20A 5KP7B 2GZFA 2OTJP 4PH2A 2JPRA 1Q86Q 2WPTA 2MF4A 1AK4C 2VLNA 1NQ4A 2AFEA 2L0QA 1YI2P 3EJDA 2GDXA 1YJ9P 4DG9A 3G4SP 1M9DC 4QNBA 2XT1A 2K92A 2CNRA 2XXMA 1VQ6P 1L0HA 1Q81Q 3GZMA 1VQ8P 2KGFA 2PY8A 2KGEA 1M9YC 2GZEA 5HGNA 2FVAA 3GZLA 3VRLC 2WLVA 1RO2A 4J93A 3DS4A 3G71P 3DTJA 1K8AQ 2X83A 2M5RA 3G29A 1AFVA 2K0YA 3NTEA 2LIUA 1RO0A 3B5IA 2PEQA 1M9FC 4NX4C 1Q82Q 7CEIA 1M6NA 2X2DD 3G21A 2K94A 3CCSP 3CCVP 2K0DX 1YITP 1D1DA 2GZGA 4U0CA 2KG8A 2XV6A 4IZ6A 2LPKA 5KP6B 1VQMP 2PENA 5I4TG 1VQ9P 4LQWC 4COCA 1HY8A 1GPJA 2KG9A 2EG5A 1UNKA 4NEOA 2JYLA 1W2BO 1KLPA 2Z46A 3LMOA 3G6EP 4BPFA 3CCQP 3CCMP 2M8NA 2GDWA 4QKOA 2N50A 3CPWO 1YIJP 1M9EC 2LF4A 3H47A 5BS2A 1YHQP 2PEKA 1KC8Q 2LL8A 2KORA 2L4BA 5HGLA 2JU2A 2KODA 3B4QA 2LTEA 1AF8A 3CCUP 2FQ2A 2OTLP 4XFZA 4H2YC 4COPA 1CEIA 2EHTA 1QRJA 3DS3A 1Z6MA 4HTWA 1VQ5P 3DS2A 3H0DA 1S72P 2KG6A 5DCKA 2JBGA 1RNIA 1QVGO 2VLPA 3G26A 1F80D 4PWVB 1L6NA 2BUOA 3G28A 2QNWA 1ZMBA 1L0IA 1T8KA 2Z44A 1VQKP 4UHPB 4DGAC 5HGOA 1EIAA 2EIAA 1A43A 4H2XC 4XFYA 2GZIA 2L6EA 3G0VA 3H4EA 4MRTC 5F2KA 3E2DA 2K0XA 2KOSA 2CQ8A 2KOOA 2JAZA 1FR2A 2VLOA 1KQSO 1K73Q 4H2WC 2CG5B 2CGQA 1M90Q 1Q7YQ 1VQNP 4B4NA 2FAEA 3CCRP 2N6YA 2KGAA 3OW2O 4R0MA 2ROQA 2AVAA 2NO8A 1DNYA 3CC2P 2X2BA 2CWOA 4PXHB 2DGYA 1KD1Q 2L9FA 2MY5A 2GOLB 2XZ1C 2FQ1A 3U43A 2XGVA 2AF8A 5BS1A 1JJ2O 2Y4ZA 2MR8A 4XROA 2V4XA 4DGEC 1EM9A 1K9MQ 4BPGA 2X82A 1OR5A 1GWPA 4F37A 3NY7B 2PXRC 3CMEP 2KW2A 2FHSC 2L22A 3M1MA 1UJZA 2PWOA 2JGPA 2LOLA 3BP9A 2XDEA 3GJNA 1EOQA 2LIWA 2OARA 2KOPA 1VQOP 2LMLA 2N6ZA 1IUQA 2N5HA 5JPAA 2JQ4A 1AYIA 2K5XA 3WBHA 4PH1A 4E91A 1VQ7P 3DS5A 1VQPP 4PH0A 3G1GA 4E92A 1ACPA 2GDYA 2N5IA 3EJEA 1AUMA 1VQLP 2KGCA 1E6JP 2XGUA 2M8PA 5HVCA 5KP8B 2BHVA 4HKGA 5F2NA 1YJWP 3CCLP 3GKLC 3HZQA 2EHSA 2VLQA 3DS0A 2KOQA 4PH3A 3HYBA 5HGMA 5HV8A 3CCJP 4U0BA 5HGKA 1A8OA 2JB0A 3CXCO 4CA3A 1U7KA 4XFXA 1DV5A 4GR6A 2M8LA 1E0HA 1GXHA 2MD9A 2FACA 3LRYA 2MVUA 3CD6P 1N8RQ 2PWMA 1M6EX 2E1MA 2FQ0A 3EJBA 1YJNP 1X3OA 5EJDA 3CC7P 4XRQA 2KGDA 3DS1A 1HQBA 1IMQA 3I56P 4GR2A 1K30A 2KWLA 2PEIA 2EFJA 2LKIA 3RG6C 2PNGA 2ONTA 3G1IA 3I55P 2MVVA 2XZ0D 1G03A 2VSQA 4IPYA 2ERHA 1NJIQ 3DPHA 3MGEA 2FADA 1M74A 2K93A 1VHNA 2Z45A 2FVFA 1ZNVA 5CZDB 3CMAP 2AFDA 1M9XC 1EMVA 3CCEP 2JU1A 1VKUA 2KR5A 2P9XA 3RG2A 5EW5E 1GXGA 2PEMA 4U0AA 2GYKA 2PEJA
chains in the Genus database with same CATH topology
2L6EA 4NX4C 1P7NA 3G0VA 1Q82Q 1M6NA 2X2DD 3G21A 5F2KA 5F2OA 3E2DA 3CCSP 1AUMA 3CCVP 1VQLP 1YITP 1D1DA 4U0CA 1BAJA 2XV6A 1E6JP 2XGUA 1VQMP 2M8PA 2BHVA 2PENA 5I4TG 2JO0A 2PEOA 1VQ9P 5F2NA 1YJWP 2XGYA 1QVFO 3CC4P 4U0FA 3CCLP 4LQWC 2WLVB 4COCA 2QEXP 3HZQA 1KQSO 1K73Q 2EG5A 3DS0A 1M90Q 3P05A 2GONA 4PH3A 2JYLA 3HYBA 1W2BO 1Q7YQ 1VQNP 2Z46A 4B4NA 5HGMA 3CCRP 3CCJP 4U0EA 4U0BA 1M1KQ 4WYMA 3OW2O 5HGKA 3G6EP 1A8OA 3CXCO 3CCQP 1U7KA 3CCMP 4XFXA 1VQ4P 4GR6A 4M0IA 2M8NA 2JYGA 3CC2P 2M8LA 2CWOA 4U0DA 1M9CC 4INBA 3LRYA 3CPWO 2QA4P 1YIJP 1M9EC 2LF4A 2DGYA 3Q20A 3CD6P 1N8RQ 2PWMA 1M6EX 1KD1Q 3H47A 2E1MA 5BS2A 1YHQP 2GOLB 2PEKA 1KC8Q 2OTJP 4PH2A 1YJNP 2XGVA 2JPRA 1Q86Q 3CC7P 5BS1A 4XRQA 1JJ2O 5HGLA 2Y4ZA 4XROA 2V4XA 3DS1A 1AK4C 4DGEC 2KODA 1YI2P 3I56P 1EM9A 1YJ9P 4GR2A 1K9MQ 1K30A 3G4SP 1M9DC 2PEIA 3CCUP 2EFJA 3RG6C 4QNBA 2X82A 2ONTA 2XT1A 1GWPA 2XXMA 3G1IA 3I55P 2OTLP 4XFZA 2PXRC 1G03A 4IPYA 4COPA 1VQ6P 1QRJA 3CMEP 3DS3A 1Q81Q 4HTWA 3M1MA 1VQ5P 1NJIQ 1VQ8P 2KGFA 2PWOA 2PY8A 3DS2A 3H0DA 1S72P 3DPHA 5DCKA 1RNIA 1M9YC 1QVGO 3MGEA 3G26A 3BP9A 1M74A 2XDEA 5HGNA 1EOQA 3VRLC 2OARA 2WLVA 1VQOP 1RO2A 1L6NA 2BUOA 3G28A 1IUQA 2Z45A 4J93A 1ZMBA 2Z44A 3DS4A 3G71P 5JPAA 3DTJA 3CMAP 1VQKP 3WBHA 1K8AQ 1M9XC 4DGAC 5HGOA 2X83A 4PH1A 3G29A 1EIAA 2EIAA 1AFVA 4E91A 1A43A 3CCEP 2P9XA 3NTEA 3DS5A 1VQPP 1VQ7P 1RO0A 3B5IA 4PH0A 2PEMA 2PEQA 3G1GA 1M9FC 4E92A 4U0AA 4XFYA 2PEJA 3H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6E A;  4NX4 C;  1P7N A;  3G0V A;  2X2D D;  3G21 A;  1AUM A;  1D1D A;  4U0C A;  1BAJ A;  2XV6 A;  1E6J P;  2XGU A;  2M8P A;  5I4T G;  2JO0 A;  2XGY A;  4U0F A;  4LQW C;  2WLV B;  4COC A;  3DS0 A;  3P05 A;  2GON A;  4PH3 A;  2JYL A;  4B4N A;  5HGM A;  4U0E A;  4U0B A;  4WYM A;  5HGK A;  1A8O A;  1U7K A;  4XFX A;  4M0I A;  2M8N A;  2JYG A;  2M8L A;  4U0D A;  1M9C C;  4INB A;  3LRY A;  1M9E C;  2LF4 A;  2PWM A;  3H47 A;  2GOL B;  4PH2 A;  2XGV A;  2JPR A;  4XRQ A;  5HGL A;  2Y4Z A;  4XRO A;  2V4X A;  3DS1 A;  1AK4 C;  4DGE C;  2KOD A;  1EM9 A;  1M9D C;  4QNB A;  2X82 A;  2ONT A;  2XT1 A;  1GWP A;  2XXM A;  3G1I A;  4XFZ A;  2PXR C;  1G03 A;  4IPY A;  4COP A;  1QRJ A;  3DS3 A;  4HTW A;  2KGF A;  2PWO A;  3DS2 A;  3DPH A;  5DCK A;  1M9Y C;  3MGE A;  3G26 A;  3BP9 A;  2XDE A;  5HGN A;  1EOQ A;  3VRL C;  2WLV A;  1L6N A;  2BUO A;  3G28 A;  4J93 A;  3DS4 A;  5JPA A;  3DTJ A;  1M9X C;  4DGA C;  5HGO A;  2X83 A;  4PH1 A;  3G29 A;  1EIA A;  2EIA A;  1AFV A;  4E91 A;  1A43 A;  3NTE A;  3DS5 A;  4PH0 A;  3G1G A;  1M9F C;  4E92 A;  4U0A A;  4XFY A;  3H4E A; 
#chains in the Genus database with same CATH topology
 1P7N A;  5F2O A;  1BAJ A;  1BXI A;  2JO0 A;  2PEO A;  1QVF O;  2XGY A;  3CC4 P;  4U0F A;  1MZ8 A;  2N98 A;  2WLV B;  2QEX P;  2K2Q A;  3P05 A;  2GON A;  3CE7 A;  4U0E A;  2DNW A;  2FVE A;  1M1K Q;  4WYM A;  1IMP A;  2GZJ A;  1VQ4 P;  4M0I A;  2JYG A;  4U0D A;  1M9C C;  4INB A;  2QA4 P;  4BPH A;  2MR7 A;  3Q20 A;  5KP7 B;  2GZF A;  2OTJ P;  4PH2 A;  2JPR A;  1Q86 Q;  2WPT A;  2MF4 A;  1AK4 C;  2VLN A;  1NQ4 A;  2AFE A;  2L0Q A;  1YI2 P;  3EJD A;  2GDX A;  1YJ9 P;  4DG9 A;  3G4S P;  1M9D C;  4QNB A;  2XT1 A;  2K92 A;  2CNR A;  2XXM A;  1VQ6 P;  1L0H A;  1Q81 Q;  3GZM A;  1VQ8 P;  2KGF A;  2PY8 A;  2KGE A;  1M9Y C;  2GZE A;  5HGN A;  2FVA A;  3GZL A;  3VRL C;  2WLV A;  1RO2 A;  4J93 A;  3DS4 A;  3G71 P;  3DTJ A;  1K8A Q;  2X83 A;  2M5R A;  3G29 A;  1AFV A;  2K0Y A;  3NTE A;  2LIU A;  1RO0 A;  3B5I A;  2PEQ A;  1M9F C;  4NX4 C;  1Q82 Q;  7CEI A;  1M6N A;  2X2D D;  3G21 A;  2K94 A;  3CCS P;  3CCV P;  2K0D X;  1YIT P;  1D1D A;  2GZG A;  4U0C A;  2KG8 A;  2XV6 A;  4IZ6 A;  2LPK A;  5KP6 B;  1VQM P;  2PEN A;  5I4T G;  1VQ9 P;  4LQW C;  4COC A;  1HY8 A;  1GPJ A;  2KG9 A;  2EG5 A;  1UNK A;  4NEO A;  2JYL A;  1W2B O;  1KLP A;  2Z46 A;  3LMO A;  3G6E P;  4BPF A;  3CCQ P;  3CCM P;  2M8N A;  2GDW A;  4QKO A;  2N50 A;  3CPW O;  1YIJ P;  1M9E C;  2LF4 A;  3H47 A;  5BS2 A;  1YHQ P;  2PEK A;  1KC8 Q;  2LL8 A;  2KOR A;  2L4B A;  5HGL A;  2JU2 A;  2KOD A;  3B4Q A;  2LTE A;  1AF8 A;  3CCU P;  2FQ2 A;  2OTL P;  4XFZ A;  4H2Y C;  4COP A;  1CEI A;  2EHT A;  1QRJ A;  3DS3 A;  1Z6M A;  4HTW A;  1VQ5 P;  3DS2 A;  3H0D A;  1S72 P;  2KG6 A;  5DCK A;  2JBG A;  1RNI A;  1QVG O;  2VLP A;  3G26 A;  1F80 D;  4PWV B;  1L6N A;  2BUO A;  3G28 A;  2QNW A;  1ZMB A;  1L0I A;  1T8K A;  2Z44 A;  1VQK P;  4UHP B;  4DGA C;  5HGO A;  1EIA A;  2EIA A;  1A43 A;  4H2X C;  4XFY A;  2GZI A;  2L6E A;  3G0V A;  3H4E A;  4MRT C;  5F2K A;  3E2D A;  2K0X A;  2KOS A;  2CQ8 A;  2KOO A;  2JAZ A;  1FR2 A;  2VLO A;  1KQS O;  1K73 Q;  4H2W C;  2CG5 B;  2CGQ A;  1M90 Q;  1Q7Y Q;  1VQN P;  4B4N A;  2FAE A;  3CCR P;  2N6Y A;  2KGA A;  3OW2 O;  4R0M A;  2ROQ A;  2AVA A;  2NO8 A;  1DNY A;  3CC2 P;  2X2B A;  2CWO A;  4PXH B;  2DGY A;  1KD1 Q;  2L9F A;  2MY5 A;  2GOL B;  2XZ1 C;  2FQ1 A;  3U43 A;  2XGV A;  2AF8 A;  5BS1 A;  1JJ2 O;  2Y4Z A;  2MR8 A;  4XRO A;  2V4X A;  4DGE C;  1EM9 A;  1K9M Q;  4BPG A;  2X82 A;  1OR5 A;  1GWP A;  4F37 A;  3NY7 B;  2PXR C;  3CME P;  2KW2 A;  2FHS C;  2L22 A;  3M1M A;  1UJZ A;  2PWO A;  2JGP A;  2LOL A;  3BP9 A;  2XDE A;  3GJN A;  1EOQ A;  2LIW A;  2OAR A;  2KOP A;  1VQO P;  2LML A;  2N6Z A;  1IUQ A;  2N5H A;  5JPA A;  2JQ4 A;  1AYI A;  2K5X A;  3WBH A;  4PH1 A;  4E91 A;  1VQ7 P;  3DS5 A;  1VQP P;  4PH0 A;  3G1G A;  4E92 A;  1ACP A;  2GDY A;  2N5I A;  3EJE A;  1AUM A;  1VQL P;  2KGC A;  1E6J P;  2XGU A;  2M8P A;  5HVC A;  5KP8 B;  2BHV A;  4HKG A;  5F2N A;  1YJW P;  3CCL P;  3GKL C;  3HZQ A;  2EHS A;  2VLQ A;  3DS0 A;  2KOQ A;  4PH3 A;  3HYB A;  5HGM A;  5HV8 A;  3CCJ P;  4U0B A;  5HGK A;  1A8O A;  2JB0 A;  3CXC O;  4CA3 A;  1U7K A;  4XFX A;  1DV5 A;  4GR6 A;  2M8L A;  1E0H A;  1GXH A;  2MD9 A;  2FAC A;  3LRY A;  2MVU A;  3CD6 P;  1N8R Q;  2PWM A;  1M6E X;  2E1M A;  2FQ0 A;  3EJB A;  1YJN P;  1X3O A;  5EJD A;  3CC7 P;  4XRQ A;  2KGD A;  3DS1 A;  1HQB A;  1IMQ A;  3I56 P;  4GR2 A;  1K30 A;  2KWL A;  2PEI A;  2EFJ A;  2LKI A;  3RG6 C;  2PNG A;  2ONT A;  3G1I A;  3I55 P;  2MVV A;  2XZ0 D;  1G03 A;  2VSQ A;  4IPY A;  2ERH A;  1NJI Q;  3DPH A;  3MGE A;  2FAD A;  1M74 A;  2K93 A;  1VHN A;  2Z45 A;  2FVF A;  1ZNV A;  5CZD B;  3CMA P;  2AFD A;  1M9X C;  1EMV A;  3CCE P;  2JU1 A;  1VKU A;  2KR5 A;  2P9X A;  3RG2 A;  5EW5 E;  1GXG A;  2PEM A;  4U0A A;  2GYK A;  2PEJ A; 
#chains in the Genus database with same CATH homology
 2L6E A;  4NX4 C;  1P7N A;  3G0V A;  1Q82 Q;  1M6N A;  2X2D D;  3G21 A;  5F2K A;  5F2O A;  3E2D A;  3CCS P;  1AUM A;  3CCV P;  1VQL P;  1YIT P;  1D1D A;  4U0C A;  1BAJ A;  2XV6 A;  1E6J P;  2XGU A;  1VQM P;  2M8P A;  2BHV A;  2PEN A;  5I4T G;  2JO0 A;  2PEO A;  1VQ9 P;  5F2N A;  1YJW P;  2XGY A;  1QVF O;  3CC4 P;  4U0F A;  3CCL P;  4LQW C;  2WLV B;  4COC A;  2QEX P;  3HZQ A;  1KQS O;  1K73 Q;  2EG5 A;  3DS0 A;  1M90 Q;  3P05 A;  2GON A;  4PH3 A;  2JYL A;  3HYB A;  1W2B O;  1Q7Y Q;  1VQN P;  2Z46 A;  4B4N A;  5HGM A;  3CCR P;  3CCJ P;  4U0E A;  4U0B A;  1M1K Q;  4WYM A;  3OW2 O;  5HGK A;  3G6E P;  1A8O A;  3CXC O;  3CCQ P;  1U7K A;  3CCM P;  4XFX A;  1VQ4 P;  4GR6 A;  4M0I A;  2M8N A;  2JYG A;  3CC2 P;  2M8L A;  2CWO A;  4U0D A;  1M9C C;  4INB A;  3LRY A;  3CPW O;  2QA4 P;  1YIJ P;  1M9E C;  2LF4 A;  2DGY A;  3Q20 A;  3CD6 P;  1N8R Q;  2PWM A;  1M6E X;  1KD1 Q;  3H47 A;  2E1M A;  5BS2 A;  1YHQ P;  2GOL B;  2PEK A;  1KC8 Q;  2OTJ P;  4PH2 A;  1YJN P;  2XGV A;  2JPR A;  1Q86 Q;  3CC7 P;  5BS1 A;  4XRQ A;  1JJ2 O;  5HGL A;  2Y4Z A;  4XRO A;  2V4X A;  3DS1 A;  1AK4 C;  4DGE C;  2KOD A;  1YI2 P;  3I56 P;  1EM9 A;  1YJ9 P;  4GR2 A;  1K9M Q;  1K30 A;  3G4S P;  1M9D C;  2PEI A;  3CCU P;  2EFJ A;  3RG6 C;  4QNB A;  2X82 A;  2ONT A;  2XT1 A;  1GWP A;  2XXM A;  3G1I A;  3I55 P;  2OTL P;  4XFZ A;  2PXR C;  1G03 A;  4IPY A;  4COP A;  1VQ6 P;  1QRJ A;  3CME P;  3DS3 A;  1Q81 Q;  4HTW A;  3M1M A;  1VQ5 P;  1NJI Q;  1VQ8 P;  2KGF A;  2PWO A;  2PY8 A;  3DS2 A;  3H0D A;  1S72 P;  3DPH A;  5DCK A;  1RNI A;  1M9Y C;  1QVG O;  3MGE A;  3G26 A;  3BP9 A;  1M74 A;  2XDE A;  5HGN A;  1EOQ A;  3VRL C;  2OAR A;  2WLV A;  1VQO P;  1RO2 A;  1L6N A;  2BUO A;  3G28 A;  1IUQ A;  2Z45 A;  4J93 A;  1ZMB A;  2Z44 A;  3DS4 A;  3G71 P;  5JPA A;  3DTJ A;  3CMA P;  1VQK P;  3WBH A;  1K8A Q;  1M9X C;  4DGA C;  5HGO A;  2X83 A;  4PH1 A;  3G29 A;  1EIA A;  2EIA A;  1AFV A;  4E91 A;  1A43 A;  3CCE P;  2P9X A;  3NTE A;  3DS5 A;  1VQP P;  1VQ7 P;  1RO0 A;  3B5I A;  4PH0 A;  2PEM A;  2PEQ A;  3G1G A;  1M9F C;  4E92 A;  4U0A A;  4XFY A;  2PEJ A;  3H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...