2KGFA

N-terminal domain of capsid protein from the mason-pfizer monkey virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
140
structure length
140
Chain Sequence
PVTETVDGQGQAWRHHNGFDFAVIKELKTAASQYGATAPYTLAIVESVADNWLTPTDWNTLVRAVLSGGDHLLWKSEFFENCRDTAKRNQQAGNGWDFDMLTGSGNYSSTDAQMQYDPGLFAQIQAAATKAWRKLPVKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein p27
publication title NMR structure of the N-terminal domain of capsid protein from the mason-pfizer monkey virus
pubmed doi rcsb
source organism Mason-pfizer monkey virus
total genus 46
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2009-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2kgfA00
2WLVB 4U0BA 1EM9A 3MGEA 1AFVA 5HGMA 4U0FA 4U0EA 1M9DC 1M9XC 2V4XA 2PWOA 3H47A 1G03A 5JPAA 1P7NA 4LQWC 2X83A 4XFXA 2PWMA 4E91A 2GONA 2XGVA 3NTEA 2XDEA 4QNBA 4U0DA 4E92A 4XROA 5HGNA 1M9CC 1QRJA 4XFZA 2EIAA 4DGAC 5HGLA 1EIAA 2WLVA 1E6JP 2M8LA 4XFYA 1GWPA 2GOLB 2LF4A 4U0CA 3H4EA 2PXRC 1M9FC 4HTWA 1M9EC 4B4NA 5HGOA 1D1DA 2M8NA 1L6NA 1M9YC 4XRQA 1U7KA 2X2DD 4WYMA 2XGUA 4PH2A 4PH0A 4NX4C 5HGKA 2KGFA 2X82A 4U0AA 1AK4C 3BP9A 2XGYA 2JPRA 2Y4ZA 4INBA 3P05A 4PH3A 4DGEC 4J93A 2M8PA
chains in the Genus database with same CATH superfamily
2WLVB 4U0BA 1EM9A 3MGEA 1AFVA 5HGMA 4U0FA 4U0EA 1M9DC 1M9XC 2V4XA 2PWOA 3H47A 1G03A 5JPAA 1P7NA 4LQWC 2X83A 4XFXA 2PWMA 4E91A 2GONA 2XGVA 3NTEA 2XDEA 4QNBA 4U0DA 4E92A 4XROA 5HGNA 1M9CC 1QRJA 4XFZA 2EIAA 4DGAC 5HGLA 1EIAA 2WLVA 1E6JP 2M8LA 4XFYA 1GWPA 2GOLB 2LF4A 4U0CA 3H4EA 2PXRC 1M9FC 4HTWA 1M9EC 4B4NA 5HGOA 1D1DA 2M8NA 1L6NA 1M9YC 4XRQA 1U7KA 2X2DD 4WYMA 2XGUA 4PH2A 4PH0A 4NX4C 5HGKA 2KGFA 2X82A 4U0AA 1AK4C 3BP9A 2XGYA 2JPRA 2Y4ZA 4INBA 3P05A 4PH3A 4DGEC 4J93A 2M8PA
chains in the Genus database with same CATH topology
2WLVB 4U0BA 1EM9A 3MGEA 1AFVA 5HGMA 4U0FA 4U0EA 1M9DC 1M9XC 2V4XA 2PWOA 3H47A 1G03A 5JPAA 1P7NA 4LQWC 2X83A 4XFXA 2PWMA 4E91A 2GONA 2XGVA 3NTEA 2XDEA 4QNBA 4U0DA 4E92A 4XROA 5HGNA 1M9CC 1QRJA 4XFZA 2EIAA 4DGAC 5HGLA 1EIAA 2WLVA 1E6JP 2M8LA 4XFYA 1GWPA 2GOLB 2LF4A 4U0CA 3H4EA 2PXRC 1M9FC 4HTWA 1M9EC 4B4NA 5HGOA 1D1DA 2M8NA 1L6NA 1M9YC 4XRQA 1U7KA 2X2DD 4WYMA 2XGUA 4PH2A 4PH0A 4NX4C 5HGKA 2KGFA 2X82A 4U0AA 1AK4C 3BP9A 2XGYA 2JPRA 2Y4ZA 4INBA 3P05A 4PH3A 4DGEC 4J93A 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLV B;  4U0B A;  1EM9 A;  3MGE A;  1AFV A;  5HGM A;  4U0F A;  4U0E A;  1M9D C;  1M9X C;  2V4X A;  2PWO A;  3H47 A;  1G03 A;  5JPA A;  1P7N A;  4LQW C;  2X83 A;  4XFX A;  2PWM A;  4E91 A;  2GON A;  2XGV A;  3NTE A;  2XDE A;  4QNB A;  4U0D A;  4E92 A;  4XRO A;  5HGN A;  1M9C C;  1QRJ A;  4XFZ A;  2EIA A;  4DGA C;  5HGL A;  1EIA A;  2WLV A;  1E6J P;  2M8L A;  4XFY A;  1GWP A;  2GOL B;  2LF4 A;  4U0C A;  3H4E A;  2PXR C;  1M9F C;  4HTW A;  1M9E C;  4B4N A;  5HGO A;  1D1D A;  2M8N A;  1L6N A;  1M9Y C;  4XRQ A;  1U7K A;  2X2D D;  4WYM A;  2XGU A;  4PH2 A;  4PH0 A;  4NX4 C;  5HGK A;  2KGF A;  2X82 A;  4U0A A;  1AK4 C;  3BP9 A;  2XGY A;  2JPR A;  2Y4Z A;  4INB A;  3P05 A;  4PH3 A;  4DGE C;  4J93 A;  2M8P A; 
#chains in the Genus database with same CATH topology
 2WLV B;  4U0B A;  1EM9 A;  3MGE A;  1AFV A;  5HGM A;  4U0F A;  4U0E A;  1M9D C;  1M9X C;  2V4X A;  2PWO A;  3H47 A;  1G03 A;  5JPA A;  1P7N A;  4LQW C;  2X83 A;  4XFX A;  2PWM A;  4E91 A;  2GON A;  2XGV A;  3NTE A;  2XDE A;  4QNB A;  4U0D A;  4E92 A;  4XRO A;  5HGN A;  1M9C C;  1QRJ A;  4XFZ A;  2EIA A;  4DGA C;  5HGL A;  1EIA A;  2WLV A;  1E6J P;  2M8L A;  4XFY A;  1GWP A;  2GOL B;  2LF4 A;  4U0C A;  3H4E A;  2PXR C;  1M9F C;  4HTW A;  1M9E C;  4B4N A;  5HGO A;  1D1D A;  2M8N A;  1L6N A;  1M9Y C;  4XRQ A;  1U7K A;  2X2D D;  4WYM A;  2XGU A;  4PH2 A;  4PH0 A;  4NX4 C;  5HGK A;  2KGF A;  2X82 A;  4U0A A;  1AK4 C;  3BP9 A;  2XGY A;  2JPR A;  2Y4Z A;  4INB A;  3P05 A;  4PH3 A;  4DGE C;  4J93 A;  2M8P A; 
#chains in the Genus database with same CATH homology
 2WLV B;  4U0B A;  1EM9 A;  3MGE A;  1AFV A;  5HGM A;  4U0F A;  4U0E A;  1M9D C;  1M9X C;  2V4X A;  2PWO A;  3H47 A;  1G03 A;  5JPA A;  1P7N A;  4LQW C;  2X83 A;  4XFX A;  2PWM A;  4E91 A;  2GON A;  2XGV A;  3NTE A;  2XDE A;  4QNB A;  4U0D A;  4E92 A;  4XRO A;  5HGN A;  1M9C C;  1QRJ A;  4XFZ A;  2EIA A;  4DGA C;  5HGL A;  1EIA A;  2WLV A;  1E6J P;  2M8L A;  4XFY A;  1GWP A;  2GOL B;  2LF4 A;  4U0C A;  3H4E A;  2PXR C;  1M9F C;  4HTW A;  1M9E C;  4B4N A;  5HGO A;  1D1D A;  2M8N A;  1L6N A;  1M9Y C;  4XRQ A;  1U7K A;  2X2D D;  4WYM A;  2XGU A;  4PH2 A;  4PH0 A;  4NX4 C;  5HGK A;  2KGF A;  2X82 A;  4U0A A;  1AK4 C;  3BP9 A;  2XGY A;  2JPR A;  2Y4Z A;  4INB A;  3P05 A;  4PH3 A;  4DGE C;  4J93 A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...