2KGFA

N-terminal domain of capsid protein from the mason-pfizer monkey virus
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
140
structure length
140
Chain Sequence
PVTETVDGQGQAWRHHNGFDFAVIKELKTAASQYGATAPYTLAIVESVADNWLTPTDWNTLVRAVLSGGDHLLWKSEFFENCRDTAKRNQQAGNGWDFDMLTGSGNYSSTDAQMQYDPGLFAQIQAAATKAWRKLPVKGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p27
publication title NMR structure of the N-terminal domain of capsid protein from the mason-pfizer monkey virus
pubmed doi rcsb
source organism Mason-pfizer monkey virus
molecule tags Viral protein
total genus 46
structure length 140
sequence length 140
ec nomenclature
pdb deposition date 2009-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2kgfA00
1AFVA 2M8NA 4NX4C 1EM9A 1M9FC 4INBA 5HGOA 1QRJA 4XFZA 4U0FA 1M9YC 4B4NA 4U0CA 2M8LA 2X83A 2XGUA 4J93A 2WLVB 2WLVA 3H4EA 4U0EA 3BP9A 1U7KA 2PWMA 1G03A 4U0AA 1D1DA 2GOLB 5HGNA 1AK4C 2M8PA 3MGEA 1L6NA 4XROA 2PXRC 2LF4A 4QNBA 2KGFA 4XFYA 4U0DA 4DGAC 2GONA 1GWPA 4XRQA 4U0BA 2X82A 2Y4ZA 2EIAA 1M9CC 1E6JP 3P05A 4LQWC 5JPAA 1EIAA 5HGLA 2XGYA 4XFXA 1M9DC 1M9EC 2XGVA 4WYMA 4DGEC 2X2DD 3NTEA 2PWOA 4E91A 2JPRA 3H47A 4PH0A 4PH2A 4HTWA 4E92A 4PH3A 2XDEA 1M9XC 5HGKA 2V4XA 1P7NA 5HGMA
chains in the Genus database with same CATH superfamily
1AFVA 2M8NA 4NX4C 1EM9A 1M9FC 4INBA 5HGOA 1QRJA 4XFZA 4U0FA 1M9YC 4B4NA 4U0CA 2M8LA 2X83A 2XGUA 4J93A 2WLVB 2WLVA 3H4EA 4U0EA 3BP9A 1U7KA 2PWMA 1G03A 4U0AA 1D1DA 2GOLB 5HGNA 1AK4C 2M8PA 3MGEA 1L6NA 4XROA 2PXRC 2LF4A 4QNBA 2KGFA 4XFYA 4U0DA 4DGAC 2GONA 1GWPA 4XRQA 4U0BA 2X82A 2Y4ZA 2EIAA 1M9CC 1E6JP 3P05A 4LQWC 5JPAA 1EIAA 5HGLA 2XGYA 4XFXA 1M9DC 1M9EC 2XGVA 4WYMA 4DGEC 2X2DD 3NTEA 2PWOA 4E91A 2JPRA 3H47A 4PH0A 4PH2A 4HTWA 4E92A 4PH3A 2XDEA 1M9XC 5HGKA 2V4XA 1P7NA 5HGMA
chains in the Genus database with same CATH topology
1AFVA 2M8NA 4NX4C 1EM9A 1M9FC 4INBA 5HGOA 1QRJA 4XFZA 4U0FA 1M9YC 4B4NA 4U0CA 2M8LA 2X83A 2XGUA 4J93A 2WLVB 2WLVA 3H4EA 4U0EA 3BP9A 1U7KA 2PWMA 1G03A 4U0AA 1D1DA 2GOLB 5HGNA 1AK4C 2M8PA 3MGEA 1L6NA 4XROA 2PXRC 2LF4A 4QNBA 2KGFA 4XFYA 4U0DA 4DGAC 2GONA 1GWPA 4XRQA 4U0BA 2X82A 2Y4ZA 2EIAA 1M9CC 1E6JP 3P05A 4LQWC 5JPAA 1EIAA 5HGLA 2XGYA 4XFXA 1M9DC 1M9EC 2XGVA 4WYMA 4DGEC 2X2DD 3NTEA 2PWOA 4E91A 2JPRA 3H47A 4PH0A 4PH2A 4HTWA 4E92A 4PH3A 2XDEA 1M9XC 5HGKA 2V4XA 1P7NA 5HGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFV A;  2M8N A;  4NX4 C;  1EM9 A;  1M9F C;  4INB A;  5HGO A;  1QRJ A;  4XFZ A;  4U0F A;  1M9Y C;  4B4N A;  4U0C A;  2M8L A;  2X83 A;  2XGU A;  4J93 A;  2WLV B;  2WLV A;  3H4E A;  4U0E A;  3BP9 A;  1U7K A;  2PWM A;  1G03 A;  4U0A A;  1D1D A;  2GOL B;  5HGN A;  1AK4 C;  2M8P A;  3MGE A;  1L6N A;  4XRO A;  2PXR C;  2LF4 A;  4QNB A;  2KGF A;  4XFY A;  4U0D A;  4DGA C;  2GON A;  1GWP A;  4XRQ A;  4U0B A;  2X82 A;  2Y4Z A;  2EIA A;  1M9C C;  1E6J P;  3P05 A;  4LQW C;  5JPA A;  1EIA A;  5HGL A;  2XGY A;  4XFX A;  1M9D C;  1M9E C;  2XGV A;  4WYM A;  4DGE C;  2X2D D;  3NTE A;  2PWO A;  4E91 A;  2JPR A;  3H47 A;  4PH0 A;  4PH2 A;  4HTW A;  4E92 A;  4PH3 A;  2XDE A;  1M9X C;  5HGK A;  2V4X A;  1P7N A;  5HGM A; 
#chains in the Genus database with same CATH topology
 1AFV A;  2M8N A;  4NX4 C;  1EM9 A;  1M9F C;  4INB A;  5HGO A;  1QRJ A;  4XFZ A;  4U0F A;  1M9Y C;  4B4N A;  4U0C A;  2M8L A;  2X83 A;  2XGU A;  4J93 A;  2WLV B;  2WLV A;  3H4E A;  4U0E A;  3BP9 A;  1U7K A;  2PWM A;  1G03 A;  4U0A A;  1D1D A;  2GOL B;  5HGN A;  1AK4 C;  2M8P A;  3MGE A;  1L6N A;  4XRO A;  2PXR C;  2LF4 A;  4QNB A;  2KGF A;  4XFY A;  4U0D A;  4DGA C;  2GON A;  1GWP A;  4XRQ A;  4U0B A;  2X82 A;  2Y4Z A;  2EIA A;  1M9C C;  1E6J P;  3P05 A;  4LQW C;  5JPA A;  1EIA A;  5HGL A;  2XGY A;  4XFX A;  1M9D C;  1M9E C;  2XGV A;  4WYM A;  4DGE C;  2X2D D;  3NTE A;  2PWO A;  4E91 A;  2JPR A;  3H47 A;  4PH0 A;  4PH2 A;  4HTW A;  4E92 A;  4PH3 A;  2XDE A;  1M9X C;  5HGK A;  2V4X A;  1P7N A;  5HGM A; 
#chains in the Genus database with same CATH homology
 1AFV A;  2M8N A;  4NX4 C;  1EM9 A;  1M9F C;  4INB A;  5HGO A;  1QRJ A;  4XFZ A;  4U0F A;  1M9Y C;  4B4N A;  4U0C A;  2M8L A;  2X83 A;  2XGU A;  4J93 A;  2WLV B;  2WLV A;  3H4E A;  4U0E A;  3BP9 A;  1U7K A;  2PWM A;  1G03 A;  4U0A A;  1D1D A;  2GOL B;  5HGN A;  1AK4 C;  2M8P A;  3MGE A;  1L6N A;  4XRO A;  2PXR C;  2LF4 A;  4QNB A;  2KGF A;  4XFY A;  4U0D A;  4DGA C;  2GON A;  1GWP A;  4XRQ A;  4U0B A;  2X82 A;  2Y4Z A;  2EIA A;  1M9C C;  1E6J P;  3P05 A;  4LQW C;  5JPA A;  1EIA A;  5HGL A;  2XGY A;  4XFX A;  1M9D C;  1M9E C;  2XGV A;  4WYM A;  4DGE C;  2X2D D;  3NTE A;  2PWO A;  4E91 A;  2JPR A;  3H47 A;  4PH0 A;  4PH2 A;  4HTW A;  4E92 A;  4PH3 A;  2XDE A;  1M9X C;  5HGK A;  2V4X A;  1P7N A;  5HGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...