2PXRC

Crystal structure of hiv-1 ca146 in the presence of cap-1
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
145
structure length
145
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gag-Pol polyprotein (Pr160Gag-Pol)
publication title Structure of the Antiviral Assembly Inhibitor CAP-1 Complex with the HIV-1 CA Protein.
pubmed doi rcsb
total genus 50
structure length 145
sequence length 145
ec nomenclature
pdb deposition date 2007-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2pxrC00
1E6JP 2KGFA 1M9XC 3BP9A 1M9DC 2LF4A 1M9EC 4INBA 4XROA 4XFYA 4U0FA 4WYMA 1GWPA 3H4EA 5HGKA 4XFZA 4J93A 2X82A 4U0BA 2XGUA 2X83A 4HTWA 4E91A 2WLVA 2M8LA 2XDEA 2PWMA 1P7NA 5HGNA 2XGYA 4U0EA 2M8PA 4LQWC 1G03A 2V4XA 2PWOA 4DGAC 4PH3A 2X2DD 4DGEC 4XFXA 1EIAA 1M9CC 3P05A 4XRQA 4U0CA 2GONA 2JPRA 2XGVA 1AFVA 1U7KA 5HGMA 4B4NA 4PH0A 5HGLA 1M9FC 1EM9A 1QRJA 2M8NA 4QNBA 2PXRC 5JPAA 1AK4C 2Y4ZA 4NX4C 3NTEA 1M9YC 3MGEA 3H47A 4U0AA 5HGOA 1D1DA 2WLVB 2GOLB 4E92A 4PH2A 4U0DA 2EIAA 1L6NA
chains in the Genus database with same CATH superfamily
1E6JP 2KGFA 1M9XC 3BP9A 1M9DC 2LF4A 1M9EC 4INBA 4XROA 4XFYA 4U0FA 4WYMA 1GWPA 3H4EA 5HGKA 4XFZA 4J93A 2X82A 4U0BA 2XGUA 2X83A 4HTWA 4E91A 2WLVA 2M8LA 2XDEA 2PWMA 1P7NA 5HGNA 2XGYA 4U0EA 2M8PA 4LQWC 1G03A 2V4XA 2PWOA 4DGAC 4PH3A 2X2DD 4DGEC 4XFXA 1EIAA 1M9CC 3P05A 4XRQA 4U0CA 2GONA 2JPRA 2XGVA 1AFVA 1U7KA 5HGMA 4B4NA 4PH0A 5HGLA 1M9FC 1EM9A 1QRJA 2M8NA 4QNBA 2PXRC 5JPAA 1AK4C 2Y4ZA 4NX4C 3NTEA 1M9YC 3MGEA 3H47A 4U0AA 5HGOA 1D1DA 2WLVB 2GOLB 4E92A 4PH2A 4U0DA 2EIAA 1L6NA
chains in the Genus database with same CATH topology
1E6JP 2KGFA 1M9XC 3BP9A 1M9DC 2LF4A 1M9EC 4INBA 4XROA 4XFYA 4U0FA 4WYMA 1GWPA 3H4EA 5HGKA 4XFZA 4J93A 2X82A 4U0BA 2XGUA 2X83A 4HTWA 4E91A 2WLVA 2M8LA 2XDEA 2PWMA 1P7NA 5HGNA 2XGYA 4U0EA 2M8PA 4LQWC 1G03A 2V4XA 2PWOA 4DGAC 4PH3A 2X2DD 4DGEC 4XFXA 1EIAA 1M9CC 3P05A 4XRQA 4U0CA 2GONA 2JPRA 2XGVA 1AFVA 1U7KA 5HGMA 4B4NA 4PH0A 5HGLA 1M9FC 1EM9A 1QRJA 2M8NA 4QNBA 2PXRC 5JPAA 1AK4C 2Y4ZA 4NX4C 3NTEA 1M9YC 3MGEA 3H47A 4U0AA 5HGOA 1D1DA 2WLVB 2GOLB 4E92A 4PH2A 4U0DA 2EIAA 1L6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6J P;  2KGF A;  1M9X C;  3BP9 A;  1M9D C;  2LF4 A;  1M9E C;  4INB A;  4XRO A;  4XFY A;  4U0F A;  4WYM A;  1GWP A;  3H4E A;  5HGK A;  4XFZ A;  4J93 A;  2X82 A;  4U0B A;  2XGU A;  2X83 A;  4HTW A;  4E91 A;  2WLV A;  2M8L A;  2XDE A;  2PWM A;  1P7N A;  5HGN A;  2XGY A;  4U0E A;  2M8P A;  4LQW C;  1G03 A;  2V4X A;  2PWO A;  4DGA C;  4PH3 A;  2X2D D;  4DGE C;  4XFX A;  1EIA A;  1M9C C;  3P05 A;  4XRQ A;  4U0C A;  2GON A;  2JPR A;  2XGV A;  1AFV A;  1U7K A;  5HGM A;  4B4N A;  4PH0 A;  5HGL A;  1M9F C;  1EM9 A;  1QRJ A;  2M8N A;  4QNB A;  2PXR C;  5JPA A;  1AK4 C;  2Y4Z A;  4NX4 C;  3NTE A;  1M9Y C;  3MGE A;  3H47 A;  4U0A A;  5HGO A;  1D1D A;  2WLV B;  2GOL B;  4E92 A;  4PH2 A;  4U0D A;  2EIA A;  1L6N A; 
#chains in the Genus database with same CATH topology
 1E6J P;  2KGF A;  1M9X C;  3BP9 A;  1M9D C;  2LF4 A;  1M9E C;  4INB A;  4XRO A;  4XFY A;  4U0F A;  4WYM A;  1GWP A;  3H4E A;  5HGK A;  4XFZ A;  4J93 A;  2X82 A;  4U0B A;  2XGU A;  2X83 A;  4HTW A;  4E91 A;  2WLV A;  2M8L A;  2XDE A;  2PWM A;  1P7N A;  5HGN A;  2XGY A;  4U0E A;  2M8P A;  4LQW C;  1G03 A;  2V4X A;  2PWO A;  4DGA C;  4PH3 A;  2X2D D;  4DGE C;  4XFX A;  1EIA A;  1M9C C;  3P05 A;  4XRQ A;  4U0C A;  2GON A;  2JPR A;  2XGV A;  1AFV A;  1U7K A;  5HGM A;  4B4N A;  4PH0 A;  5HGL A;  1M9F C;  1EM9 A;  1QRJ A;  2M8N A;  4QNB A;  2PXR C;  5JPA A;  1AK4 C;  2Y4Z A;  4NX4 C;  3NTE A;  1M9Y C;  3MGE A;  3H47 A;  4U0A A;  5HGO A;  1D1D A;  2WLV B;  2GOL B;  4E92 A;  4PH2 A;  4U0D A;  2EIA A;  1L6N A; 
#chains in the Genus database with same CATH homology
 1E6J P;  2KGF A;  1M9X C;  3BP9 A;  1M9D C;  2LF4 A;  1M9E C;  4INB A;  4XRO A;  4XFY A;  4U0F A;  4WYM A;  1GWP A;  3H4E A;  5HGK A;  4XFZ A;  4J93 A;  2X82 A;  4U0B A;  2XGU A;  2X83 A;  4HTW A;  4E91 A;  2WLV A;  2M8L A;  2XDE A;  2PWM A;  1P7N A;  5HGN A;  2XGY A;  4U0E A;  2M8P A;  4LQW C;  1G03 A;  2V4X A;  2PWO A;  4DGA C;  4PH3 A;  2X2D D;  4DGE C;  4XFX A;  1EIA A;  1M9C C;  3P05 A;  4XRQ A;  4U0C A;  2GON A;  2JPR A;  2XGV A;  1AFV A;  1U7K A;  5HGM A;  4B4N A;  4PH0 A;  5HGL A;  1M9F C;  1EM9 A;  1QRJ A;  2M8N A;  4QNB A;  2PXR C;  5JPA A;  1AK4 C;  2Y4Z A;  4NX4 C;  3NTE A;  1M9Y C;  3MGE A;  3H47 A;  4U0A A;  5HGO A;  1D1D A;  2WLV B;  2GOL B;  4E92 A;  4PH2 A;  4U0D A;  2EIA A;  1L6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...