2LF4A

Structure of a monomeric mutant of the hiv-1 capsid protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
232
structure length
232
Chain Sequence
MPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Monomeric Mutant of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Protein transport
molecule keywords Gag polyprotein
total genus 49
structure length 232
sequence length 232
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2lf4A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2lf4A02
3BP9A 3DS1A 5HGKA 1A43A 2WLVB 4B4NA 4XFYA 5DCKA 1G03A 1EOQA 2PWMA 1L6NA 2XT1A 2LF4A 2JO0A 2PXRC 3DS5A 2KODA 4U0CA 2KGFA 5HGLA 5HGOA 4U0FA 4COCA 4E91A 2M8LA 1U7KA 3G26A 1EIAA 3MGEA 3NTEA 2XGVA 4U0BA 2EIAA 5JPAA 3G1IA 2L6EA 5HGNA 3DS2A 2M8NA 1P7NA 4U0EA 1QRJA 4XRQA 2GONA 4INBA 1M9YC 5HGMA 2X83A 2M8PA 1GWPA 3H47A 2X82A 4XFZA 2JYGA 4LQWC 2GOLB 1M9DC 3P05A 4U0AA 4E92A 1E6JP 2XGYA 3DS3A 2WLVA 3H4EA 3G1GA 4HTWA 2JPRA 4WYMA 4PH2A 4PH0A 3DS0A 4M0IA 5I4TG 1M9XC 4PH3A 4XFXA 2XDEA 4NX4C 3G29A 2XGUA 4J93A 1A8OA 4QNBA 4DGAC 3DPHA 3LRYA 1M9EC 2BUOA 3DTJA 1AUMA 1M9CC 4PH1A 4XROA 2JYLA 2X2DD 4DGEC 4IPYA 4COPA 1EM9A 4U0DA 1D1DA 3G28A 2XV6A 3G0VA 3G21A 1M9FC 2Y4ZA 1AFVA 3VRLC 2XXMA 3DS4A 1AK4C 2V4XA 1BAJA 2PWOA 2ONTA
chains in the Genus database with same CATH superfamily
3DS1A 3HYBA 4XFYA 1ZMBA 2PEMA 1K8AQ 1EOQA 2PWMA 2XT1A 2FQ1A 3OW2O 1RO0A 4BPHA 3M1MA 2KODA 1YJNP 2EFJA 2FVAA 4U0FA 2K92A 1HQBA 2OTLP 4U0BA 2VLQA 5JPAA 2JU2A 1KLPA 2PY8A 5F2OA 2LMLA 1QRJA 2GZIA 1NQ4A 3CE7A 3B4QA 1YHQP 2MR8A 2JGPA 2X82A 4XFZA 3GKLC 3CCEP 2JYGA 2N5IA 5KP6B 2GOLB 4E92A 1AF8A 2X2BA 2AFDA 1YIJP 1VQ9P 1DNYA 3G1GA 4H2XC 1DV5A 2XZ0D 5CZDB 1VQOP 1E0HA 5KP8B 2VLPA 4XFXA 1Z6MA 2XDEA 2L4BA 4J93A 1EMVA 5BS1A 2KOOA 2CGQA 2BHVA 4XROA 2KGAA 2K0YA 3CCMP 2JYLA 2X2DD 4COPA 3B5IA 2N6ZA 3G21A 1YJ9P 2XXMA 3DS4A 2V4XA 2OARA 1BAJA 2PWOA 2E1MA 2LTEA 2FQ0A 5HGKA 2WLVB 2JU1A 5DCKA 1G03A 1KQSO 2DGYA 1L6NA 3EJEA 1VQPP 3CD6P 1NJIQ 2PXRC 1X3OA 2GDXA 2OTJP 5HGLA 5HGOA 2LIUA 2FVFA 1VQLP 2M8LA 1U7KA 1RO2A 2JAZA 3NTEA 2KR5A 3I55P 2XGVA 2KW2A 2MD9A 3DS2A 4U0EA 3GJNA 1MZ8A 2ROQA 2CQ8A 5EW5E 3CC4P 1BXIA 2FACA 4UHPB 2K94A 5F2KA 4GR2A 1KC8Q 1T8KA 1JJ2O 3GZLA 1IMQA 2Z46A 4LQWC 2JBGA 3P05A 2DNWA 3I56P 2XGYA 2M5RA 1VQKP 2PEOA 2N98A 2Z44A 1CEIA 2JPRA 2KOSA 4PH2A 2AFEA 4M0IA 3H0DA 1K9MQ 2CG5B 2MVUA 2KGDA 2LKIA 1ACPA 1A8OA 4QNBA 1IUQA 2AVAA 3DPHA 3LRYA 3RG6C 4F37A 2K5XA 1VQ4P 2NO8A 1AUMA 1N8RQ 1YI2P 2QA4P 3CC2P 1K73Q 2QNWA 2FAEA 1D1DA 5KP7B 2XV6A 3G0VA 1YJWP 2VLNA 1VKUA 1W2BO 2Y4ZA 2FADA 1S72P 2N50A 1AK4C 3WBHA 2ONTA 1M90Q 2VSQA 4CA3A 1A43A 3CPWO 1GXHA 3LMOA 2LF4A 3CMAP 1KD1Q 4IZ6A 1F80D 1Q82Q 4COCA 1FR2A 2JQ4A 4H2WC 3G26A 1UNKA 4NEOA 1EIAA 1M1KQ 4BPGA 3CCSP 3EJBA 5HGNA 1P7NA 1VQNP 2JB0A 2PEIA 1ZNVA 2K0DX 5F2NA 4QKOA 3CXCO 4XRQA 2AF8A 3CC7P 2X83A 3CCQP 1GWPA 1GPJA 2GDYA 3CCRP 5HV8A 2PEKA 1UJZA 2MY5A 1QVGO 4H2YC 2KG6A 1M9DC 1M74A 3E2DA 3DS3A 3G71P 2MR7A 1VQMP 1M6EX 1Q86Q 2PEQA 3Q20A 2FQ2A 4HTWA 2LPKA 5I4TG 1M9XC 1VQ5P 2GZJA 4NX4C 3CCVP 4DGAC 3CCJP 1M9EC 2BUOA 3DTJA 2LL8A 2ERHA 2XZ1C 4PH1A 3CCUP 4DG9A 4DGEC 2KWLA 1EM9A 3G28A 2EG5A 1L0IA 2L0QA 2WPTA 3U43A 2KOPA 2PEJA 3NY7B 2EHSA 3HZQA 1RNIA 2K93A 2MVVA 1VQ6P 5BS2A 3BP9A 1K30A 4B4NA 1GXGA 2VLOA 3CMEP 3G4SP 2GYKA 2PNGA 3EJDA 3GZMA 2KG8A 3RG2A 2JO0A 2MF4A 3DS5A 2KG9A 1HY8A 4U0CA 2KGFA 4E91A 2KOQA 2LOLA 3MGEA 2EIAA 3G1IA 2L6EA 2CNRA 2GZEA 2M8NA 2N5HA 2P9XA 2K0XA 4PXHB 2FHSC 3G6EP 2K2QA 2GONA 4INBA 1M9YC 2FVEA 2KORA 1Q7YQ 5HGMA 2GZGA 2M8PA 1IMPA 3H47A 4MRTC 2CWOA 7CEIA 4U0AA 5HVCA 1E6JP 2WLVA 1QVFO 1OR5A 2PENA 3H4EA 2LIWA 2KGCA 4WYMA 1AYIA 2Z45A 2L9FA 4PH0A 1YITP 3DS0A 4BPFA 4PH3A 1Q81Q 4R0MA 4GR6A 3G29A 2KGEA 2XGUA 1VQ7P 2EHTA 1M9CC 1M6NA 2QEXP 4IPYA 4U0DA 2GZFA 4PWVB 1VQ8P 4HKGA 1M9FC 5EJDA 2L22A 1VHNA 2N6YA 1AFVA 3VRLC 2GDWA 3CCLP 1L0HA
chains in the Genus database with same CATH topology
3BP9A 3DS1A 3HYBA 1K30A 5HGKA 1A43A 2WLVB 3CPWO 4B4NA 4XFYA 5DCKA 1G03A 1ZMBA 2PEMA 1K8AQ 3CMEP 3G4SP 1EOQA 1KQSO 2PWMA 2DGYA 1L6NA 2XT1A 1VQPP 2LF4A 3CMAP 3CD6P 3OW2O 1KD1Q 1RO0A 1NJIQ 2JO0A 2PXRC 3DS5A 3M1MA 2KODA 4U0CA 1YJNP 2OTJP 2EFJA 2KGFA 5HGLA 5HGOA 1Q82Q 4U0FA 4COCA 4E91A 1VQLP 2M8LA 1U7KA 1RO2A 3G26A 1EIAA 3MGEA 3I55P 3NTEA 1M1KQ 2OTLP 2XGVA 4U0BA 2EIAA 5JPAA 3G1IA 2L6EA 3CCSP 5HGNA 3DS2A 2M8NA 1P7NA 1VQNP 2P9XA 2PY8A 4U0EA 2PEIA 5F2OA 3G6EP 5F2NA 1QRJA 3CXCO 4XRQA 2GONA 4INBA 1M9YC 3CC4P 1Q7YQ 3CC7P 5HGMA 2X83A 5F2KA 4GR2A 2M8PA 1GWPA 3CCQP 1YHQP 3CCRP 2PEKA 3H47A 1KC8Q 2X82A 4XFZA 1JJ2O 3CCEP 2JYGA 1QVGO 2Z46A 4LQWC 2CWOA 2GOLB 1M9DC 1M74A 3P05A 4U0AA 3E2DA 4E92A 3I56P 1E6JP 2XGYA 3DS3A 2WLVA 3G71P 1YIJP 1VQKP 1QVFO 2PEOA 1VQMP 2Z44A 1VQ9P 2PENA 1M6EX 3H4EA 1Q86Q 2PEQA 3G1GA 3Q20A 4HTWA 2JPRA 4WYMA 2Z45A 1VQOP 4PH2A 4PH0A 1YITP 3DS0A 4M0IA 3H0DA 1K9MQ 5I4TG 1M9XC 4PH3A 1VQ5P 1Q81Q 4XFXA 4GR6A 2XDEA 4NX4C 3G29A 2XGUA 4J93A 3CCVP 1A8OA 4QNBA 4DGAC 1IUQA 3DPHA 3LRYA 1M9EC 3RG6C 5BS1A 3CCJP 2BUOA 1VQ7P 3DTJA 1VQ4P 1AUMA 1N8RQ 1M9CC 1M6NA 2QEXP 2BHVA 3CCUP 1YI2P 4PH1A 4XROA 3CCMP 2QA4P 3CC2P 2JYLA 2X2DD 4DGEC 4IPYA 4COPA 1K73Q 1EM9A 4U0DA 1D1DA 3B5IA 3G28A 2EG5A 2XV6A 3G0VA 3G21A 1YJWP 1VQ8P 1M9FC 1W2BO 2Y4ZA 1AFVA 2PEJA 1YJ9P 3VRLC 1S72P 2XXMA 3HZQA 3DS4A 1AK4C 2V4XA 1RNIA 1BAJA 2OARA 2PWOA 3CCLP 3WBHA 2E1MA 2ONTA 1VQ6P 5BS2A 1M90Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP9 A;  3DS1 A;  5HGK A;  1A43 A;  2WLV B;  4B4N A;  4XFY A;  5DCK A;  1G03 A;  1EOQ A;  2PWM A;  1L6N A;  2XT1 A;  2LF4 A;  2JO0 A;  2PXR C;  3DS5 A;  2KOD A;  4U0C A;  2KGF A;  5HGL A;  5HGO A;  4U0F A;  4COC A;  4E91 A;  2M8L A;  1U7K A;  3G26 A;  1EIA A;  3MGE A;  3NTE A;  2XGV A;  4U0B A;  2EIA A;  5JPA A;  3G1I A;  2L6E A;  5HGN A;  3DS2 A;  2M8N A;  1P7N A;  4U0E A;  1QRJ A;  4XRQ A;  2GON A;  4INB A;  1M9Y C;  5HGM A;  2X83 A;  2M8P A;  1GWP A;  3H47 A;  2X82 A;  4XFZ A;  2JYG A;  4LQW C;  2GOL B;  1M9D C;  3P05 A;  4U0A A;  4E92 A;  1E6J P;  2XGY A;  3DS3 A;  2WLV A;  3H4E A;  3G1G A;  4HTW A;  2JPR A;  4WYM A;  4PH2 A;  4PH0 A;  3DS0 A;  4M0I A;  5I4T G;  1M9X C;  4PH3 A;  4XFX A;  2XDE A;  4NX4 C;  3G29 A;  2XGU A;  4J93 A;  1A8O A;  4QNB A;  4DGA C;  3DPH A;  3LRY A;  1M9E C;  2BUO A;  3DTJ A;  1AUM A;  1M9C C;  4PH1 A;  4XRO A;  2JYL A;  2X2D D;  4DGE C;  4IPY A;  4COP A;  1EM9 A;  4U0D A;  1D1D A;  3G28 A;  2XV6 A;  3G0V A;  3G21 A;  1M9F C;  2Y4Z A;  1AFV A;  3VRL C;  2XXM A;  3DS4 A;  1AK4 C;  2V4X A;  1BAJ A;  2PWO A;  2ONT A; 
#chains in the Genus database with same CATH topology
 3DS1 A;  3HYB A;  4XFY A;  1ZMB A;  2PEM A;  1K8A Q;  1EOQ A;  2PWM A;  2XT1 A;  2FQ1 A;  3OW2 O;  1RO0 A;  4BPH A;  3M1M A;  2KOD A;  1YJN P;  2EFJ A;  2FVA A;  4U0F A;  2K92 A;  1HQB A;  2OTL P;  4U0B A;  2VLQ A;  5JPA A;  2JU2 A;  1KLP A;  2PY8 A;  5F2O A;  2LML A;  1QRJ A;  2GZI A;  1NQ4 A;  3CE7 A;  3B4Q A;  1YHQ P;  2MR8 A;  2JGP A;  2X82 A;  4XFZ A;  3GKL C;  3CCE P;  2JYG A;  2N5I A;  5KP6 B;  2GOL B;  4E92 A;  1AF8 A;  2X2B A;  2AFD A;  1YIJ P;  1VQ9 P;  1DNY A;  3G1G A;  4H2X C;  1DV5 A;  2XZ0 D;  5CZD B;  1VQO P;  1E0H A;  5KP8 B;  2VLP A;  4XFX A;  1Z6M A;  2XDE A;  2L4B A;  4J93 A;  1EMV A;  5BS1 A;  2KOO A;  2CGQ A;  2BHV A;  4XRO A;  2KGA A;  2K0Y A;  3CCM P;  2JYL A;  2X2D D;  4COP A;  3B5I A;  2N6Z A;  3G21 A;  1YJ9 P;  2XXM A;  3DS4 A;  2V4X A;  2OAR A;  1BAJ A;  2PWO A;  2E1M A;  2LTE A;  2FQ0 A;  5HGK A;  2WLV B;  2JU1 A;  5DCK A;  1G03 A;  1KQS O;  2DGY A;  1L6N A;  3EJE A;  1VQP P;  3CD6 P;  1NJI Q;  2PXR C;  1X3O A;  2GDX A;  2OTJ P;  5HGL A;  5HGO A;  2LIU A;  2FVF A;  1VQL P;  2M8L A;  1U7K A;  1RO2 A;  2JAZ A;  3NTE A;  2KR5 A;  3I55 P;  2XGV A;  2KW2 A;  2MD9 A;  3DS2 A;  4U0E A;  3GJN A;  1MZ8 A;  2ROQ A;  2CQ8 A;  5EW5 E;  3CC4 P;  1BXI A;  2FAC A;  4UHP B;  2K94 A;  5F2K A;  4GR2 A;  1KC8 Q;  1T8K A;  1JJ2 O;  3GZL A;  1IMQ A;  2Z46 A;  4LQW C;  2JBG A;  3P05 A;  2DNW A;  3I56 P;  2XGY A;  2M5R A;  1VQK P;  2PEO A;  2N98 A;  2Z44 A;  1CEI A;  2JPR A;  2KOS A;  4PH2 A;  2AFE A;  4M0I A;  3H0D A;  1K9M Q;  2CG5 B;  2MVU A;  2KGD A;  2LKI A;  1ACP A;  1A8O A;  4QNB A;  1IUQ A;  2AVA A;  3DPH A;  3LRY A;  3RG6 C;  4F37 A;  2K5X A;  1VQ4 P;  2NO8 A;  1AUM A;  1N8R Q;  1YI2 P;  2QA4 P;  3CC2 P;  1K73 Q;  2QNW A;  2FAE A;  1D1D A;  5KP7 B;  2XV6 A;  3G0V A;  1YJW P;  2VLN A;  1VKU A;  1W2B O;  2Y4Z A;  2FAD A;  1S72 P;  2N50 A;  1AK4 C;  3WBH A;  2ONT A;  1M90 Q;  2VSQ A;  4CA3 A;  1A43 A;  3CPW O;  1GXH A;  3LMO A;  2LF4 A;  3CMA P;  1KD1 Q;  4IZ6 A;  1F80 D;  1Q82 Q;  4COC A;  1FR2 A;  2JQ4 A;  4H2W C;  3G26 A;  1UNK A;  4NEO A;  1EIA A;  1M1K Q;  4BPG A;  3CCS P;  3EJB A;  5HGN A;  1P7N A;  1VQN P;  2JB0 A;  2PEI A;  1ZNV A;  2K0D X;  5F2N A;  4QKO A;  3CXC O;  4XRQ A;  2AF8 A;  3CC7 P;  2X83 A;  3CCQ P;  1GWP A;  1GPJ A;  2GDY A;  3CCR P;  5HV8 A;  2PEK A;  1UJZ A;  2MY5 A;  1QVG O;  4H2Y C;  2KG6 A;  1M9D C;  1M74 A;  3E2D A;  3DS3 A;  3G71 P;  2MR7 A;  1VQM P;  1M6E X;  1Q86 Q;  2PEQ A;  3Q20 A;  2FQ2 A;  4HTW A;  2LPK A;  5I4T G;  1M9X C;  1VQ5 P;  2GZJ A;  4NX4 C;  3CCV P;  4DGA C;  3CCJ P;  1M9E C;  2BUO A;  3DTJ A;  2LL8 A;  2ERH A;  2XZ1 C;  4PH1 A;  3CCU P;  4DG9 A;  4DGE C;  2KWL A;  1EM9 A;  3G28 A;  2EG5 A;  1L0I A;  2L0Q A;  2WPT A;  3U43 A;  2KOP A;  2PEJ A;  3NY7 B;  2EHS A;  3HZQ A;  1RNI A;  2K93 A;  2MVV A;  1VQ6 P;  5BS2 A;  3BP9 A;  1K30 A;  4B4N A;  1GXG A;  2VLO A;  3CME P;  3G4S P;  2GYK A;  2PNG A;  3EJD A;  3GZM A;  2KG8 A;  3RG2 A;  2JO0 A;  2MF4 A;  3DS5 A;  2KG9 A;  1HY8 A;  4U0C A;  2KGF A;  4E91 A;  2KOQ A;  2LOL A;  3MGE A;  2EIA A;  3G1I A;  2L6E A;  2CNR A;  2GZE A;  2M8N A;  2N5H A;  2P9X A;  2K0X A;  4PXH B;  2FHS C;  3G6E P;  2K2Q A;  2GON A;  4INB A;  1M9Y C;  2FVE A;  2KOR A;  1Q7Y Q;  5HGM A;  2GZG A;  2M8P A;  1IMP A;  3H47 A;  4MRT C;  2CWO A;  7CEI A;  4U0A A;  5HVC A;  1E6J P;  2WLV A;  1QVF O;  1OR5 A;  2PEN A;  3H4E A;  2LIW A;  2KGC A;  4WYM A;  1AYI A;  2Z45 A;  2L9F A;  4PH0 A;  1YIT P;  3DS0 A;  4BPF A;  4PH3 A;  1Q81 Q;  4R0M A;  4GR6 A;  3G29 A;  2KGE A;  2XGU A;  1VQ7 P;  2EHT A;  1M9C C;  1M6N A;  2QEX P;  4IPY A;  4U0D A;  2GZF A;  4PWV B;  1VQ8 P;  4HKG A;  1M9F C;  5EJD A;  2L22 A;  1VHN A;  2N6Y A;  1AFV A;  3VRL C;  2GDW A;  3CCL P;  1L0H A; 
#chains in the Genus database with same CATH homology
 3BP9 A;  3DS1 A;  3HYB A;  1K30 A;  5HGK A;  1A43 A;  2WLV B;  3CPW O;  4B4N A;  4XFY A;  5DCK A;  1G03 A;  1ZMB A;  2PEM A;  1K8A Q;  3CME P;  3G4S P;  1EOQ A;  1KQS O;  2PWM A;  2DGY A;  1L6N A;  2XT1 A;  1VQP P;  2LF4 A;  3CMA P;  3CD6 P;  3OW2 O;  1KD1 Q;  1RO0 A;  1NJI Q;  2JO0 A;  2PXR C;  3DS5 A;  3M1M A;  2KOD A;  4U0C A;  1YJN P;  2OTJ P;  2EFJ A;  2KGF A;  5HGL A;  5HGO A;  1Q82 Q;  4U0F A;  4COC A;  4E91 A;  1VQL P;  2M8L A;  1U7K A;  1RO2 A;  3G26 A;  1EIA A;  3MGE A;  3I55 P;  3NTE A;  1M1K Q;  2OTL P;  2XGV A;  4U0B A;  2EIA A;  5JPA A;  3G1I A;  2L6E A;  3CCS P;  5HGN A;  3DS2 A;  2M8N A;  1P7N A;  1VQN P;  2P9X A;  2PY8 A;  4U0E A;  2PEI A;  5F2O A;  3G6E P;  5F2N A;  1QRJ A;  3CXC O;  4XRQ A;  2GON A;  4INB A;  1M9Y C;  3CC4 P;  1Q7Y Q;  3CC7 P;  5HGM A;  2X83 A;  5F2K A;  4GR2 A;  2M8P A;  1GWP A;  3CCQ P;  1YHQ P;  3CCR P;  2PEK A;  3H47 A;  1KC8 Q;  2X82 A;  4XFZ A;  1JJ2 O;  3CCE P;  2JYG A;  1QVG O;  2Z46 A;  4LQW C;  2CWO A;  2GOL B;  1M9D C;  1M74 A;  3P05 A;  4U0A A;  3E2D A;  4E92 A;  3I56 P;  1E6J P;  2XGY A;  3DS3 A;  2WLV A;  3G71 P;  1YIJ P;  1VQK P;  1QVF O;  2PEO A;  1VQM P;  2Z44 A;  1VQ9 P;  2PEN A;  1M6E X;  3H4E A;  1Q86 Q;  2PEQ A;  3G1G A;  3Q20 A;  4HTW A;  2JPR A;  4WYM A;  2Z45 A;  1VQO P;  4PH2 A;  4PH0 A;  1YIT P;  3DS0 A;  4M0I A;  3H0D A;  1K9M Q;  5I4T G;  1M9X C;  4PH3 A;  1VQ5 P;  1Q81 Q;  4XFX A;  4GR6 A;  2XDE A;  4NX4 C;  3G29 A;  2XGU A;  4J93 A;  3CCV P;  1A8O A;  4QNB A;  4DGA C;  1IUQ A;  3DPH A;  3LRY A;  1M9E C;  3RG6 C;  5BS1 A;  3CCJ P;  2BUO A;  1VQ7 P;  3DTJ A;  1VQ4 P;  1AUM A;  1N8R Q;  1M9C C;  1M6N A;  2QEX P;  2BHV A;  3CCU P;  1YI2 P;  4PH1 A;  4XRO A;  3CCM P;  2QA4 P;  3CC2 P;  2JYL A;  2X2D D;  4DGE C;  4IPY A;  4COP A;  1K73 Q;  1EM9 A;  4U0D A;  1D1D A;  3B5I A;  3G28 A;  2EG5 A;  2XV6 A;  3G0V A;  3G21 A;  1YJW P;  1VQ8 P;  1M9F C;  1W2B O;  2Y4Z A;  1AFV A;  2PEJ A;  1YJ9 P;  3VRL C;  1S72 P;  2XXM A;  3HZQ A;  3DS4 A;  1AK4 C;  2V4X A;  1RNI A;  1BAJ A;  2OAR A;  2PWO A;  3CCL P;  3WBH A;  2E1M A;  2ONT A;  1VQ6 P;  5BS2 A;  1M90 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...