2LF4A

Structure of a monomeric mutant of the hiv-1 capsid protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
232
structure length
232
Chain Sequence
MPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Gag polyprotein
publication title Structure of a Monomeric Mutant of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 49
structure length 232
sequence length 232
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2lf4A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2lf4A02
1M9FC 1P7NA 3P05A 2PWMA 3G21A 4COPA 4PH1A 2GONA 3BP9A 2GOLB 1G03A 2WLVA 2XXMA 4E91A 5HGNA 4U0FA 4HTWA 3DS2A 4U0EA 4PH2A 3H47A 4INBA 3DPHA 4U0BA 4M0IA 2BUOA 5JPAA 4U0AA 4U0CA 1M9CC 3VRLC 2XV6A 4COCA 3LRYA 4NX4C 1AK4C 4DGEC 5HGMA 4LQWC 1D1DA 3NTEA 1AFVA 2JYGA 1M9YC 1BAJA 2PXRC 1EIAA 2V4XA 2X82A 3G28A 3H4EA 1QRJA 5HGLA 5HGKA 3G0VA 3G29A 4XFZA 4XFXA 4E92A 3MGEA 2PWOA 2M8PA 1GWPA 3DS5A 4IPYA 3DS0A 4DGAC 4XFYA 4XRQA 2JYLA 1L6NA 3DS1A 2ONTA 3DS4A 5DCKA 5HGOA 1EOQA 2WLVB 1M9EC 2XGYA 4PH3A 2EIAA 2X2DD 3G1IA 1A43A 2XT1A 2XDEA 4B4NA 4QNBA 4XROA 2X83A 4J93A 1EM9A 4WYMA 3DTJA 3G26A 1AUMA 1M9XC 2KGFA 1E6JP 2JPRA 5I4TG 2Y4ZA 2XGVA 3DS3A 4PH0A 2M8LA 1U7KA 2LF4A 2L6EA 2M8NA 2XGUA 1A8OA 3G1GA 4U0DA 2JO0A 2KODA 1M9DC
chains in the Genus database with same CATH superfamily
3CCQP 1P7NA 3P05A 2KOSA 2PWMA 2WPTA 1DNYA 1MZ8A 1VQ9P 2KG6A 1F80D 4U0FA 1M1KQ 3CPWO 4U0EA 2EHSA 2GDYA 3Q20A 4PH2A 1UNKA 2CNRA 1AYIA 5JPAA 2M5RA 4U0AA 1YJ9P 2MR7A 2GZIA 4MRTC 1AK4C 1VQMP 1KLPA 2KOPA 2L22A 4H2XC 1BAJA 3B5IA 2PXRC 1EIAA 3CD6P 2V4XA 5HGLA 1E0HA 3NY7B 3G29A 3WBHA 2N6YA 4XFXA 2FVFA 3MGEA 2PWOA 2M8PA 1GWPA 1NJIQ 1L0IA 2JAZA 1L6NA 2GZEA 5EW5E 3DS1A 4CA3A 5F2NA 1UJZA 2FVEA 5F2KA 2KGEA 1YJNP 4PH3A 2EIAA 1M90Q 2L4BA 1VQ6P 3G1IA 2XT1A 2XDEA 2FQ2A 2ERHA 2PEIA 3OW2O 4J93A 4BPHA 1EM9A 2KG9A 2LMLA 1YI2P 4F37A 1VQNP 2KOOA 4H2WC 2N6ZA 2N50A 3CCJP 5I4TG 3CCVP 1RO0A 1VHNA 2M8LA 2L6EA 1FR2A 1NQ4A 1A8OA 2JB0A 1VQPP 3G1GA 4U0DA 2QNWA 2VLPA 2JO0A 2PEMA 2K0YA 3CCUP 2LIUA 4COPA 2N98A 2Z45A 2GONA 3BP9A 1IMPA 1X3OA 2GOLB 2PNGA 7CEIA 2CWOA 1G03A 2K94A 2VLOA 2WLVA 2XXMA 2K0XA 1VQKP 3DS2A 1BXIA 5BS2A 2FQ1A 4INBA 4IZ6A 4U0BA 3U43A 1VQ7P 2K5XA 4PXHB 5HV8A 3VRLC 1M6EX 2KR5A 3GZMA 2Z44A 2CG5B 3GKLC 1RO2A 2FAEA 1KD1Q 4DGEC 5BS1A 1K8AQ 3G71P 1D1DA 3NTEA 2OTLP 1KC8Q 3G28A 2EG5A 2K92A 3I55P 3H4EA 1QRJA 2GDWA 2CGQA 3E2DA 4XFZA 4BPFA 2BHVA 2EFJA 2MVVA 1VQOP 2FQ0A 4IPYA 2DGYA 3RG2A 1S72P 2VSQA 2XZ0D 2N5IA 3DS4A 5DCKA 1VKUA 1EOQA 2WLVB 2LPKA 1M9EC 1AF8A 2XGYA 2X2DD 1A43A 4B4NA 1W2BO 2X83A 2AFDA 1Q82Q 2AVAA 2LTEA 1M9XC 2MD9A 3CC7P 2KGFA 2P9XA 1Q81Q 1E6JP 2JPRA 2Y4ZA 2XGVA 2KW2A 2JQ4A 3DS3A 4GR2A 3CMEP 4R0MA 1L0HA 2M8NA 1HQBA 1IMQA 2KGDA 2KG8A 1ACPA 2AFEA 3LMOA 2XZ1C 2GZJA 5HGNA 2GYKA 3CCEP 4BPGA 4UHPB 2DNWA 3DPHA 2QA4P 1JJ2O 2FACA 4DG9A 2L9FA 1YITP 1M9CC 3H0DA 2JGPA 4COCA 3LRYA 4NX4C 1K9MQ 1M74A 5KP7B 1ZNVA 2MY5A 3B4QA 3HZQA 5HGMA 1Z6MA 4LQWC 1T8KA 1M9YC 2X82A 2PENA 1OR5A 1YHQP 2PEJA 5KP8B 3CXCO 4E92A 4H2YC 1CEIA 2GZFA 1GXHA 3DS5A 3DS0A 1KQSO 2JYLA 3RG6C 1QVFO 2E1MA 4QKOA 3GZLA 1YIJP 2ONTA 2MF4A 3EJEA 3CCRP 4PWVB 2OARA 1M6NA 2VLQA 3G4SP 2CQ8A 2QEXP 4WYMA 2JU1A 3G26A 3G6EP 2K93A 5F2OA 3CCLP 3GJNA 1HY8A 5CZDB 2KGAA 2VLNA 2MVUA 2L0QA 3CMAP 2K2QA 4PH0A 3HYBA 1U7KA 2XGUA 1VQ8P 2KODA 2PEOA 2JU2A 3M1MA 2X2BA 1M9FC 2KGCA 3G21A 1Q86Q 4PH1A 2PEKA 1N8RQ 3CC4P 1ZMBA 2ROQA 4E91A 1VQ4P 4HTWA 3H47A 3EJBA 2JBGA 4M0IA 2BUOA 1YJWP 1DV5A 1IUQA 4U0CA 2XV6A 3CCSP 2FVAA 5EJDA 1AFVA 2GDXA 2JYGA 2KOQA 2N5HA 5HGKA 3G0VA 1K30A 1K73Q 4NEOA 2KWLA 2PEQA 2LL8A 2FHSC 1GPJA 2EHTA 3EJDA 4DGAC 4XFYA 4XRQA 3CE7A 2KORA 3CCMP 1EMVA 1GXGA 2AF8A 3I56P 3CC2P 5KP6B 5HGOA 2LKIA 1QVGO 5HVCA 4GR6A 4XROA 4QNBA 2K0DX 2LIWA 3DTJA 2OTJP 1AUMA 1Q7YQ 2FADA 2LOLA 1VQ5P 1RNIA 2GZGA 2MR8A 2PY8A 2NO8A 2LF4A 1VQLP 4HKGA 2Z46A 1M9DC
chains in the Genus database with same CATH topology
3CCQP 3M1MA 3CCUP 1M9FC 1P7NA 3P05A 2PWMA 3G21A 4COPA 1Q86Q 2Z45A 4PH1A 2PEKA 1N8RQ 2GONA 3BP9A 2GOLB 2CWOA 1G03A 1VQ9P 3CC4P 1ZMBA 2WLVA 2XXMA 4E91A 5HGNA 4U0FA 1VQ4P 1M1KQ 4HTWA 3DS2A 1VQKP 3CPWO 3CCEP 4U0EA 5BS2A 3Q20A 4PH2A 3H47A 4INBA 3DPHA 2QA4P 1JJ2O 4U0BA 1VQ7P 4M0IA 2BUOA 1YJWP 5JPAA 4U0AA 1YJ9P 1IUQA 1YITP 4U0CA 1M9CC 3VRLC 3H0DA 2XV6A 3CCSP 1M6EX 4COCA 3LRYA 2Z44A 4NX4C 1K9MQ 1M74A 1RO2A 1AK4C 1KD1Q 1VQMP 4DGEC 5BS1A 3HZQA 5HGMA 1K8AQ 3G71P 4LQWC 1D1DA 3NTEA 1AFVA 2JYGA 2OTLP 1M9YC 1BAJA 2PXRC 1EIAA 3B5IA 1KC8Q 2V4XA 2X82A 2EG5A 2PENA 3G28A 3H4EA 3I55P 1YHQP 1QRJA 5HGLA 5HGKA 2PEJA 3E2DA 3CXCO 3G0VA 1K30A 1K73Q 3G29A 3WBHA 4XFZA 4XFXA 4E92A 3MGEA 2PWOA 2BHVA 2PEQA 2M8PA 2EFJA 1GWPA 2PEOA 1NJIQ 3DS5A 2Z46A 1VQOP 4IPYA 2DGYA 3DS0A 4DGAC 1S72P 4XFYA 4XRQA 2JYLA 1KQSO 3RG6C 1L6NA 3CCMP 1QVFO 3DS1A 2E1MA 5F2NA 3I56P 1YIJP 2ONTA 3CC2P 3DS4A 5DCKA 5F2KA 5HGOA 1EOQA 2WLVB 1M9EC 2XGYA 3CCRP 4PH3A 2EIAA 1YJNP 1M90Q 1QVGO 2X2DD 1VQ6P 3G1IA 1A43A 2XT1A 2XDEA 2OARA 4GR6A 4B4NA 4QNBA 4XROA 1M6NA 1W2BO 2X83A 3G4SP 2PEIA 3OW2O 4J93A 1EM9A 4WYMA 3DTJA 2QEXP 1Q82Q 2OTJP 1YI2P 3G26A 1AUMA 1M9XC 3G6EP 3CC7P 2KGFA 2P9XA 1VQNP 5F2OA 1Q7YQ 1Q81Q 3CCJP 3CCLP 1VQ5P 1E6JP 2JPRA 1RNIA 5I4TG 2Y4ZA 2XGVA 3CCVP 3CMAP 3DS3A 1RO0A 4GR2A 2PY8A 4PH0A 2M8LA 3HYBA 3CMEP 1U7KA 2LF4A 2L6EA 2M8NA 2XGUA 1VQLP 1A8OA 1VQPP 3CD6P 3G1GA 4U0DA 1VQ8P 2JO0A 2PEMA 2KODA 1M9DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9F C;  1P7N A;  3P05 A;  2PWM A;  3G21 A;  4COP A;  4PH1 A;  2GON A;  3BP9 A;  2GOL B;  1G03 A;  2WLV A;  2XXM A;  4E91 A;  5HGN A;  4U0F A;  4HTW A;  3DS2 A;  4U0E A;  4PH2 A;  3H47 A;  4INB A;  3DPH A;  4U0B A;  4M0I A;  2BUO A;  5JPA A;  4U0A A;  4U0C A;  1M9C C;  3VRL C;  2XV6 A;  4COC A;  3LRY A;  4NX4 C;  1AK4 C;  4DGE C;  5HGM A;  4LQW C;  1D1D A;  3NTE A;  1AFV A;  2JYG A;  1M9Y C;  1BAJ A;  2PXR C;  1EIA A;  2V4X A;  2X82 A;  3G28 A;  3H4E A;  1QRJ A;  5HGL A;  5HGK A;  3G0V A;  3G29 A;  4XFZ A;  4XFX A;  4E92 A;  3MGE A;  2PWO A;  2M8P A;  1GWP A;  3DS5 A;  4IPY A;  3DS0 A;  4DGA C;  4XFY A;  4XRQ A;  2JYL A;  1L6N A;  3DS1 A;  2ONT A;  3DS4 A;  5DCK A;  5HGO A;  1EOQ A;  2WLV B;  1M9E C;  2XGY A;  4PH3 A;  2EIA A;  2X2D D;  3G1I A;  1A43 A;  2XT1 A;  2XDE A;  4B4N A;  4QNB A;  4XRO A;  2X83 A;  4J93 A;  1EM9 A;  4WYM A;  3DTJ A;  3G26 A;  1AUM A;  1M9X C;  2KGF A;  1E6J P;  2JPR A;  5I4T G;  2Y4Z A;  2XGV A;  3DS3 A;  4PH0 A;  2M8L A;  1U7K A;  2LF4 A;  2L6E A;  2M8N A;  2XGU A;  1A8O A;  3G1G A;  4U0D A;  2JO0 A;  2KOD A;  1M9D C; 
#chains in the Genus database with same CATH topology
 3CCQ P;  1P7N A;  3P05 A;  2KOS A;  2PWM A;  2WPT A;  1DNY A;  1MZ8 A;  1VQ9 P;  2KG6 A;  1F80 D;  4U0F A;  1M1K Q;  3CPW O;  4U0E A;  2EHS A;  2GDY A;  3Q20 A;  4PH2 A;  1UNK A;  2CNR A;  1AYI A;  5JPA A;  2M5R A;  4U0A A;  1YJ9 P;  2MR7 A;  2GZI A;  4MRT C;  1AK4 C;  1VQM P;  1KLP A;  2KOP A;  2L22 A;  4H2X C;  1BAJ A;  3B5I A;  2PXR C;  1EIA A;  3CD6 P;  2V4X A;  5HGL A;  1E0H A;  3NY7 B;  3G29 A;  3WBH A;  2N6Y A;  4XFX A;  2FVF A;  3MGE A;  2PWO A;  2M8P A;  1GWP A;  1NJI Q;  1L0I A;  2JAZ A;  1L6N A;  2GZE A;  5EW5 E;  3DS1 A;  4CA3 A;  5F2N A;  1UJZ A;  2FVE A;  5F2K A;  2KGE A;  1YJN P;  4PH3 A;  2EIA A;  1M90 Q;  2L4B A;  1VQ6 P;  3G1I A;  2XT1 A;  2XDE A;  2FQ2 A;  2ERH A;  2PEI A;  3OW2 O;  4J93 A;  4BPH A;  1EM9 A;  2KG9 A;  2LML A;  1YI2 P;  4F37 A;  1VQN P;  2KOO A;  4H2W C;  2N6Z A;  2N50 A;  3CCJ P;  5I4T G;  3CCV P;  1RO0 A;  1VHN A;  2M8L A;  2L6E A;  1FR2 A;  1NQ4 A;  1A8O A;  2JB0 A;  1VQP P;  3G1G A;  4U0D A;  2QNW A;  2VLP A;  2JO0 A;  2PEM A;  2K0Y A;  3CCU P;  2LIU A;  4COP A;  2N98 A;  2Z45 A;  2GON A;  3BP9 A;  1IMP A;  1X3O A;  2GOL B;  2PNG A;  7CEI A;  2CWO A;  1G03 A;  2K94 A;  2VLO A;  2WLV A;  2XXM A;  2K0X A;  1VQK P;  3DS2 A;  1BXI A;  5BS2 A;  2FQ1 A;  4INB A;  4IZ6 A;  4U0B A;  3U43 A;  1VQ7 P;  2K5X A;  4PXH B;  5HV8 A;  3VRL C;  1M6E X;  2KR5 A;  3GZM A;  2Z44 A;  2CG5 B;  3GKL C;  1RO2 A;  2FAE A;  1KD1 Q;  4DGE C;  5BS1 A;  1K8A Q;  3G71 P;  1D1D A;  3NTE A;  2OTL P;  1KC8 Q;  3G28 A;  2EG5 A;  2K92 A;  3I55 P;  3H4E A;  1QRJ A;  2GDW A;  2CGQ A;  3E2D A;  4XFZ A;  4BPF A;  2BHV A;  2EFJ A;  2MVV A;  1VQO P;  2FQ0 A;  4IPY A;  2DGY A;  3RG2 A;  1S72 P;  2VSQ A;  2XZ0 D;  2N5I A;  3DS4 A;  5DCK A;  1VKU A;  1EOQ A;  2WLV B;  2LPK A;  1M9E C;  1AF8 A;  2XGY A;  2X2D D;  1A43 A;  4B4N A;  1W2B O;  2X83 A;  2AFD A;  1Q82 Q;  2AVA A;  2LTE A;  1M9X C;  2MD9 A;  3CC7 P;  2KGF A;  2P9X A;  1Q81 Q;  1E6J P;  2JPR A;  2Y4Z A;  2XGV A;  2KW2 A;  2JQ4 A;  3DS3 A;  4GR2 A;  3CME P;  4R0M A;  1L0H A;  2M8N A;  1HQB A;  1IMQ A;  2KGD A;  2KG8 A;  1ACP A;  2AFE A;  3LMO A;  2XZ1 C;  2GZJ A;  5HGN A;  2GYK A;  3CCE P;  4BPG A;  4UHP B;  2DNW A;  3DPH A;  2QA4 P;  1JJ2 O;  2FAC A;  4DG9 A;  2L9F A;  1YIT P;  1M9C C;  3H0D A;  2JGP A;  4COC A;  3LRY A;  4NX4 C;  1K9M Q;  1M74 A;  5KP7 B;  1ZNV A;  2MY5 A;  3B4Q A;  3HZQ A;  5HGM A;  1Z6M A;  4LQW C;  1T8K A;  1M9Y C;  2X82 A;  2PEN A;  1OR5 A;  1YHQ P;  2PEJ A;  5KP8 B;  3CXC O;  4E92 A;  4H2Y C;  1CEI A;  2GZF A;  1GXH A;  3DS5 A;  3DS0 A;  1KQS O;  2JYL A;  3RG6 C;  1QVF O;  2E1M A;  4QKO A;  3GZL A;  1YIJ P;  2ONT A;  2MF4 A;  3EJE A;  3CCR P;  4PWV B;  2OAR A;  1M6N A;  2VLQ A;  3G4S P;  2CQ8 A;  2QEX P;  4WYM A;  2JU1 A;  3G26 A;  3G6E P;  2K93 A;  5F2O A;  3CCL P;  3GJN A;  1HY8 A;  5CZD B;  2KGA A;  2VLN A;  2MVU A;  2L0Q A;  3CMA P;  2K2Q A;  4PH0 A;  3HYB A;  1U7K A;  2XGU A;  1VQ8 P;  2KOD A;  2PEO A;  2JU2 A;  3M1M A;  2X2B A;  1M9F C;  2KGC A;  3G21 A;  1Q86 Q;  4PH1 A;  2PEK A;  1N8R Q;  3CC4 P;  1ZMB A;  2ROQ A;  4E91 A;  1VQ4 P;  4HTW A;  3H47 A;  3EJB A;  2JBG A;  4M0I A;  2BUO A;  1YJW P;  1DV5 A;  1IUQ A;  4U0C A;  2XV6 A;  3CCS P;  2FVA A;  5EJD A;  1AFV A;  2GDX A;  2JYG A;  2KOQ A;  2N5H A;  5HGK A;  3G0V A;  1K30 A;  1K73 Q;  4NEO A;  2KWL A;  2PEQ A;  2LL8 A;  2FHS C;  1GPJ A;  2EHT A;  3EJD A;  4DGA C;  4XFY A;  4XRQ A;  3CE7 A;  2KOR A;  3CCM P;  1EMV A;  1GXG A;  2AF8 A;  3I56 P;  3CC2 P;  5KP6 B;  5HGO A;  2LKI A;  1QVG O;  5HVC A;  4GR6 A;  4XRO A;  4QNB A;  2K0D X;  2LIW A;  3DTJ A;  2OTJ P;  1AUM A;  1Q7Y Q;  2FAD A;  2LOL A;  1VQ5 P;  1RNI A;  2GZG A;  2MR8 A;  2PY8 A;  2NO8 A;  2LF4 A;  1VQL P;  4HKG A;  2Z46 A;  1M9D C; 
#chains in the Genus database with same CATH homology
 3CCQ P;  3M1M A;  3CCU P;  1M9F C;  1P7N A;  3P05 A;  2PWM A;  3G21 A;  4COP A;  1Q86 Q;  2Z45 A;  4PH1 A;  2PEK A;  1N8R Q;  2GON A;  3BP9 A;  2GOL B;  2CWO A;  1G03 A;  1VQ9 P;  3CC4 P;  1ZMB A;  2WLV A;  2XXM A;  4E91 A;  5HGN A;  4U0F A;  1VQ4 P;  1M1K Q;  4HTW A;  3DS2 A;  1VQK P;  3CPW O;  3CCE P;  4U0E A;  5BS2 A;  3Q20 A;  4PH2 A;  3H47 A;  4INB A;  3DPH A;  2QA4 P;  1JJ2 O;  4U0B A;  1VQ7 P;  4M0I A;  2BUO A;  1YJW P;  5JPA A;  4U0A A;  1YJ9 P;  1IUQ A;  1YIT P;  4U0C A;  1M9C C;  3VRL C;  3H0D A;  2XV6 A;  3CCS P;  1M6E X;  4COC A;  3LRY A;  2Z44 A;  4NX4 C;  1K9M Q;  1M74 A;  1RO2 A;  1AK4 C;  1KD1 Q;  1VQM P;  4DGE C;  5BS1 A;  3HZQ A;  5HGM A;  1K8A Q;  3G71 P;  4LQW C;  1D1D A;  3NTE A;  1AFV A;  2JYG A;  2OTL P;  1M9Y C;  1BAJ A;  2PXR C;  1EIA A;  3B5I A;  1KC8 Q;  2V4X A;  2X82 A;  2EG5 A;  2PEN A;  3G28 A;  3H4E A;  3I55 P;  1YHQ P;  1QRJ A;  5HGL A;  5HGK A;  2PEJ A;  3E2D A;  3CXC O;  3G0V A;  1K30 A;  1K73 Q;  3G29 A;  3WBH A;  4XFZ A;  4XFX A;  4E92 A;  3MGE A;  2PWO A;  2BHV A;  2PEQ A;  2M8P A;  2EFJ A;  1GWP A;  2PEO A;  1NJI Q;  3DS5 A;  2Z46 A;  1VQO P;  4IPY A;  2DGY A;  3DS0 A;  4DGA C;  1S72 P;  4XFY A;  4XRQ A;  2JYL A;  1KQS O;  3RG6 C;  1L6N A;  3CCM P;  1QVF O;  3DS1 A;  2E1M A;  5F2N A;  3I56 P;  1YIJ P;  2ONT A;  3CC2 P;  3DS4 A;  5DCK A;  5F2K A;  5HGO A;  1EOQ A;  2WLV B;  1M9E C;  2XGY A;  3CCR P;  4PH3 A;  2EIA A;  1YJN P;  1M90 Q;  1QVG O;  2X2D D;  1VQ6 P;  3G1I A;  1A43 A;  2XT1 A;  2XDE A;  2OAR A;  4GR6 A;  4B4N A;  4QNB A;  4XRO A;  1M6N A;  1W2B O;  2X83 A;  3G4S P;  2PEI A;  3OW2 O;  4J93 A;  1EM9 A;  4WYM A;  3DTJ A;  2QEX P;  1Q82 Q;  2OTJ P;  1YI2 P;  3G26 A;  1AUM A;  1M9X C;  3G6E P;  3CC7 P;  2KGF A;  2P9X A;  1VQN P;  5F2O A;  1Q7Y Q;  1Q81 Q;  3CCJ P;  3CCL P;  1VQ5 P;  1E6J P;  2JPR A;  1RNI A;  5I4T G;  2Y4Z A;  2XGV A;  3CCV P;  3CMA P;  3DS3 A;  1RO0 A;  4GR2 A;  2PY8 A;  4PH0 A;  2M8L A;  3HYB A;  3CME P;  1U7K A;  2LF4 A;  2L6E A;  2M8N A;  2XGU A;  1VQL P;  1A8O A;  1VQP P;  3CD6 P;  3G1G A;  4U0D A;  1VQ8 P;  2JO0 A;  2PEM A;  2KOD A;  1M9D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...