2LF4A

Structure of a monomeric mutant of the hiv-1 capsid protein
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
232
structure length
232
Chain Sequence
MPIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNAATETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a Monomeric Mutant of the HIV-1 Capsid Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Protein transport
molecule keywords Gag polyprotein
total genus 49
structure length 232
sequence length 232
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2011-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2lf4A01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2lf4A02
2XGUA 4XROA 1M9EC 1L6NA 4PH0A 4M0IA 4E91A 2XGVA 4NX4C 4INBA 4XRQA 4XFXA 4LQWC 4PH2A 4QNBA 2GONA 3DPHA 3DS0A 1M9YC 3P05A 2Y4ZA 5I4TG 4J93A 1A8OA 4WYMA 4U0EA 2X83A 5HGLA 4PH3A 2X2DD 2BUOA 5HGKA 1BAJA 4IPYA 4B4NA 4E92A 1D1DA 3G0VA 4COCA 3G29A 1M9CC 2XXMA 2JYGA 2GOLB 2XT1A 4PH1A 3G1IA 2XDEA 4U0BA 2PWMA 5DCKA 2M8LA 2JYLA 2LF4A 4XFYA 2EIAA 3DS3A 1A43A 2M8NA 3DS5A 3DS1A 2WLVB 2JPRA 1U7KA 2L6EA 3H4EA 1EM9A 1EOQA 5HGOA 5JPAA 2KGFA 2XGYA 1AK4C 4HTWA 3BP9A 2JO0A 1G03A 3NTEA 1P7NA 4U0CA 2ONTA 2XV6A 2KODA 1GWPA 3VRLC 1AUMA 4U0AA 4U0FA 2WLVA 1M9DC 2PXRC 2PWOA 2X82A 3G1GA 1AFVA 1E6JP 3DS2A 3G26A 3G21A 3G28A 5HGNA 2V4XA 1M9XC 3MGEA 4DGAC 3DS4A 4DGEC 3DTJA 3H47A 3LRYA 1QRJA 1EIAA 5HGMA 4XFZA 1M9FC 4COPA 2M8PA 4U0DA
chains in the Genus database with same CATH superfamily
2XGUA 4XROA 3CCSP 4M0IA 4NX4C 1M6EX 2DNWA 1QVGO 2K5XA 3CXCO 3CCQP 2DGYA 1FR2A 4R0MA 3CCLP 1DV5A 1KLPA 2GONA 2K0XA 2GDWA 2BUOA 2PEQA 2N5IA 3GKLC 4NEOA 3G0VA 4COCA 3EJEA 1M9CC 2XXMA 1UJZA 1IUQA 4U0BA 4GR6A 2FHSC 2JYLA 4IZ6A 3B4QA 5EJDA 3DS3A 2N5HA 2BHVA 3EJDA 2WLVB 2L6EA 1EOQA 2KGFA 1YI2P 5EW5E 2Z44A 2PY8A 2KWLA 2KOPA 2FQ2A 1VQ5P 3U43A 4U0AA 2MVVA 2GDXA 4F37A 1Q86Q 4BPGA 5KP7B 2FVAA 3MGEA 4DGEC 2FAEA 1YJ9P 2P9XA 3LRYA 3H0DA 5HGMA 2GZIA 2JAZA 2GDYA 1VQKP 2M8PA 2Z46A 1RO2A 1M9EC 1M6NA 2EHTA 2OARA 4INBA 3CD6P 1VQ6P 2FVEA 1L0HA 3DS0A 1K30A 1M9YC 2JU2A 3P05A 3GZMA 1A8OA 1GXGA 3Q20A 5KP8B 2X83A 1RO0A 2K94A 1L0IA 2CQ8A 2X2DD 2FADA 1BAJA 1F80D 1YJWP 1IMPA 4B4NA 4E92A 1D1DA 2K2QA 1OR5A 2L22A 2GOLB 2JB0A 3CCRP 3CPWO 3EJBA 5DCKA 2M8LA 1K9MQ 5F2NA 1T8KA 2AFDA 1YJNP 1GPJA 2QEXP 2KGAA 3DS1A 1CEIA 1DNYA 1HQBA 1EM9A 2FQ0A 1BXIA 3GZLA 3CCMP 1Q7YQ 2KGDA 4H2XC 2L4BA 3I56P 2ONTA 3G6EP 1VQ8P 2LIWA 2JGPA 3WBHA 2AF8A 2WPTA 2E1MA 2LPKA 2WLVA 1M9DC 2PXRC 2PWOA 2X82A 1AF8A 2NO8A 1E6JP 2K0YA 5HGNA 4DGAC 1HY8A 3DS4A 1YITP 2PEKA 3H47A 2XZ0D 3CC4P 1EIAA 2MF4A 4XFZA 2KOSA 2GZJA 2PEJA 2EFJA 7CEIA 2CGQA 1MZ8A 1L6NA 4E91A 3G71P 4XRQA 1K73Q 4XFXA 3CC7P 2LL8A 3RG6C 3CCUP 4PH2A 3B5IA 3NY7B 4QNBA 2GYKA 2MY5A 2ERHA 2Y4ZA 5I4TG 4J93A 1YIJP 4WYMA 2KG6A 4GR2A 2GZFA 1KQSO 4PXHB 5HGKA 2KORA 3CC2P 3HYBA 3GJNA 1NJIQ 1Q82Q 1NQ4A 2JYGA 4PH1A 1VQNP 2X2BA 4UHPB 2XDEA 2QNWA 2N6YA 2PEMA 5F2OA 2PEIA 2Z45A 2CG5B 2EIAA 1S72P 2M8NA 1Q81Q 5BS2A 1QVFO 2JPRA 1U7KA 2JBGA 2FVFA 3H4EA 5HGOA 5JPAA 4CA3A 1VQLP 1IMQA 4HTWA 2N50A 4PWVB 4QKOA 2MD9A 5CZDB 2ROQA 2QA4P 1G03A 3CMEP 1P7NA 4U0CA 4BPFA 1VHNA 1N8RQ 2KG8A 3VRLC 2M5RA 1AUMA 1YHQP 4U0FA 4MRTC 2VLNA 1ZNVA 3G1GA 1ACPA 2K0DX 4BPHA 3DS2A 2JU1A 3G21A 2K92A 3G28A 2V4XA 1M9XC 1W2BO 2LKIA 3DTJA 2VLOA 1E0HA 5F2KA 2CWOA 1ZMBA 1GXHA 1VQ7P 3CMAP 2L9FA 1KC8Q 1JJ2O 2LTEA 4COPA 1X3OA 1UNKA 1VKUA 4PH0A 1VQ9P 2XGVA 2PENA 1M74A 2MVUA 4LQWC 2KGEA 2K93A 3DPHA 2FQ1A 2LMLA 3CCEP 3I55P 4U0EA 2CNRA 2KG9A 5HGLA 5BS1A 3OW2O 1M1KQ 4PH3A 5HV8A 2VSQA 1VQMP 4IPYA 2EG5A 3G29A 2KW2A 2XT1A 3CCVP 3G1IA 1M90Q 1RNIA 2AFEA 2PWMA 4DG9A 2VLQA 2PEOA 2LF4A 4XFYA 2L0QA 1A43A 2JQ4A 3CCJP 3DS5A 4HKGA 1EMVA 2N6ZA 2XZ1C 2N98A 3HZQA 3LMOA 2XGYA 1AK4C 4H2WC 2EHSA 2GZGA 3BP9A 2KGCA 2OTLP 2JO0A 2KOOA 3NTEA 2XV6A 2KODA 2LIUA 1GWPA 1AYIA 2PNGA 3RG2A 2MR7A 2KR5A 1AFVA 2AVAA 5HVCA 1VQOP 3G26A 1Z6MA 2GZEA 1VQ4P 1K8AQ 3M1MA 1QRJA 5KP6B 1KD1Q 3CE7A 3E2DA 2LOLA 2FACA 3G4SP 1VQPP 2MR8A 4H2YC 2KOQA 1M9FC 2VLPA 2OTJP 4U0DA
chains in the Genus database with same CATH topology
2XGUA 4XROA 3CCSP 1M9EC 1L6NA 4PH0A 4M0IA 4E91A 1VQ9P 2XGVA 4NX4C 1M6EX 1M6NA 2OARA 1QVGO 4INBA 3CXCO 2PENA 3G71P 1M74A 4XRQA 3CCQP 1K73Q 4XFXA 2DGYA 3CD6P 3CC7P 4LQWC 3RG6C 3CCUP 3CCLP 1VQ6P 4PH2A 3B5IA 4QNBA 2GONA 3DPHA 1K30A 1M9YC 3DS0A 3P05A 2Y4ZA 5I4TG 4J93A 1A8OA 1YIJP 4WYMA 3Q20A 4GR2A 3CCEP 3I55P 4U0EA 2X83A 1RO0A 5HGLA 5BS1A 1KQSO 3OW2O 1M1KQ 4PH3A 2X2DD 5HGKA 2BUOA 1BAJA 3CC2P 1VQMP 1YJWP 3HYBA 4IPYA 2EG5A 2PEQA 4B4NA 1NJIQ 4E92A 1D1DA 3G0VA 4COCA 1Q82Q 3G29A 1M9CC 2XXMA 2JYGA 2GOLB 2XT1A 4PH1A 3CCVP 3G1IA 1VQNP 1M90Q 1RNIA 2XDEA 1IUQA 4U0BA 3CCRP 4GR6A 3CPWO 2PWMA 2PEMA 5DCKA 5F2OA 2M8LA 1K9MQ 5F2NA 2PEOA 1YJNP 2PEIA 2JYLA 2Z45A 2LF4A 4XFYA 2EIAA 3DS3A 1A43A 2QEXP 1S72P 2M8NA 3CCJP 1Q81Q 3DS5A 2BHVA 3DS1A 2WLVB 5BS2A 1QVFO 2JPRA 1U7KA 2L6EA 3H4EA 1EM9A 1EOQA 5HGOA 5JPAA 2KGFA 3CCMP 1YI2P 1Q7YQ 3HZQA 2Z44A 2PY8A 2XGYA 1AK4C 1VQLP 4HTWA 2OTLP 3BP9A 3CMEP 2JO0A 2QA4P 3I56P 1G03A 3NTEA 1P7NA 4U0CA 2ONTA 2XV6A 2KODA 3G6EP 1VQ8P 1GWPA 1VQ5P 3WBHA 1N8RQ 3VRLC 1AUMA 4U0AA 2E1MA 1YHQP 4U0FA 2WLVA 1M9DC 2PXRC 2PWOA 2X82A 3G1GA 1Q86Q 1AFVA 1E6JP 3DS2A 3G26A 1VQOP 3G21A 3G28A 5HGNA 2V4XA 1M9XC 3MGEA 4DGAC 3DS4A 1VQ4P 4DGEC 1YITP 1K8AQ 2PEKA 1W2BO 3DTJA 3H47A 1YJ9P 2P9XA 3LRYA 3M1MA 5F2KA 2CWOA 1QRJA 3CC4P 1ZMBA 1EIAA 1KD1Q 3CMAP 1VQ7P 3H0DA 3E2DA 5HGMA 4XFZA 1KC8Q 1JJ2O 2PEJA 2EFJA 3G4SP 1VQPP 1M9FC 4COPA 1VQKP 2M8PA 2Z46A 1RO2A 2OTJP 4U0DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGU A;  4XRO A;  1M9E C;  1L6N A;  4PH0 A;  4M0I A;  4E91 A;  2XGV A;  4NX4 C;  4INB A;  4XRQ A;  4XFX A;  4LQW C;  4PH2 A;  4QNB A;  2GON A;  3DPH A;  3DS0 A;  1M9Y C;  3P05 A;  2Y4Z A;  5I4T G;  4J93 A;  1A8O A;  4WYM A;  4U0E A;  2X83 A;  5HGL A;  4PH3 A;  2X2D D;  2BUO A;  5HGK A;  1BAJ A;  4IPY A;  4B4N A;  4E92 A;  1D1D A;  3G0V A;  4COC A;  3G29 A;  1M9C C;  2XXM A;  2JYG A;  2GOL B;  2XT1 A;  4PH1 A;  3G1I A;  2XDE A;  4U0B A;  2PWM A;  5DCK A;  2M8L A;  2JYL A;  2LF4 A;  4XFY A;  2EIA A;  3DS3 A;  1A43 A;  2M8N A;  3DS5 A;  3DS1 A;  2WLV B;  2JPR A;  1U7K A;  2L6E A;  3H4E A;  1EM9 A;  1EOQ A;  5HGO A;  5JPA A;  2KGF A;  2XGY A;  1AK4 C;  4HTW A;  3BP9 A;  2JO0 A;  1G03 A;  3NTE A;  1P7N A;  4U0C A;  2ONT A;  2XV6 A;  2KOD A;  1GWP A;  3VRL C;  1AUM A;  4U0A A;  4U0F A;  2WLV A;  1M9D C;  2PXR C;  2PWO A;  2X82 A;  3G1G A;  1AFV A;  1E6J P;  3DS2 A;  3G26 A;  3G21 A;  3G28 A;  5HGN A;  2V4X A;  1M9X C;  3MGE A;  4DGA C;  3DS4 A;  4DGE C;  3DTJ A;  3H47 A;  3LRY A;  1QRJ A;  1EIA A;  5HGM A;  4XFZ A;  1M9F C;  4COP A;  2M8P A;  4U0D A; 
#chains in the Genus database with same CATH topology
 2XGU A;  4XRO A;  3CCS P;  4M0I A;  4NX4 C;  1M6E X;  2DNW A;  1QVG O;  2K5X A;  3CXC O;  3CCQ P;  2DGY A;  1FR2 A;  4R0M A;  3CCL P;  1DV5 A;  1KLP A;  2GON A;  2K0X A;  2GDW A;  2BUO A;  2PEQ A;  2N5I A;  3GKL C;  4NEO A;  3G0V A;  4COC A;  3EJE A;  1M9C C;  2XXM A;  1UJZ A;  1IUQ A;  4U0B A;  4GR6 A;  2FHS C;  2JYL A;  4IZ6 A;  3B4Q A;  5EJD A;  3DS3 A;  2N5H A;  2BHV A;  3EJD A;  2WLV B;  2L6E A;  1EOQ A;  2KGF A;  1YI2 P;  5EW5 E;  2Z44 A;  2PY8 A;  2KWL A;  2KOP A;  2FQ2 A;  1VQ5 P;  3U43 A;  4U0A A;  2MVV A;  2GDX A;  4F37 A;  1Q86 Q;  4BPG A;  5KP7 B;  2FVA A;  3MGE A;  4DGE C;  2FAE A;  1YJ9 P;  2P9X A;  3LRY A;  3H0D A;  5HGM A;  2GZI A;  2JAZ A;  2GDY A;  1VQK P;  2M8P A;  2Z46 A;  1RO2 A;  1M9E C;  1M6N A;  2EHT A;  2OAR A;  4INB A;  3CD6 P;  1VQ6 P;  2FVE A;  1L0H A;  3DS0 A;  1K30 A;  1M9Y C;  2JU2 A;  3P05 A;  3GZM A;  1A8O A;  1GXG A;  3Q20 A;  5KP8 B;  2X83 A;  1RO0 A;  2K94 A;  1L0I A;  2CQ8 A;  2X2D D;  2FAD A;  1BAJ A;  1F80 D;  1YJW P;  1IMP A;  4B4N A;  4E92 A;  1D1D A;  2K2Q A;  1OR5 A;  2L22 A;  2GOL B;  2JB0 A;  3CCR P;  3CPW O;  3EJB A;  5DCK A;  2M8L A;  1K9M Q;  5F2N A;  1T8K A;  2AFD A;  1YJN P;  1GPJ A;  2QEX P;  2KGA A;  3DS1 A;  1CEI A;  1DNY A;  1HQB A;  1EM9 A;  2FQ0 A;  1BXI A;  3GZL A;  3CCM P;  1Q7Y Q;  2KGD A;  4H2X C;  2L4B A;  3I56 P;  2ONT A;  3G6E P;  1VQ8 P;  2LIW A;  2JGP A;  3WBH A;  2AF8 A;  2WPT A;  2E1M A;  2LPK A;  2WLV A;  1M9D C;  2PXR C;  2PWO A;  2X82 A;  1AF8 A;  2NO8 A;  1E6J P;  2K0Y A;  5HGN A;  4DGA C;  1HY8 A;  3DS4 A;  1YIT P;  2PEK A;  3H47 A;  2XZ0 D;  3CC4 P;  1EIA A;  2MF4 A;  4XFZ A;  2KOS A;  2GZJ A;  2PEJ A;  2EFJ A;  7CEI A;  2CGQ A;  1MZ8 A;  1L6N A;  4E91 A;  3G71 P;  4XRQ A;  1K73 Q;  4XFX A;  3CC7 P;  2LL8 A;  3RG6 C;  3CCU P;  4PH2 A;  3B5I A;  3NY7 B;  4QNB A;  2GYK A;  2MY5 A;  2ERH A;  2Y4Z A;  5I4T G;  4J93 A;  1YIJ P;  4WYM A;  2KG6 A;  4GR2 A;  2GZF A;  1KQS O;  4PXH B;  5HGK A;  2KOR A;  3CC2 P;  3HYB A;  3GJN A;  1NJI Q;  1Q82 Q;  1NQ4 A;  2JYG A;  4PH1 A;  1VQN P;  2X2B A;  4UHP B;  2XDE A;  2QNW A;  2N6Y A;  2PEM A;  5F2O A;  2PEI A;  2Z45 A;  2CG5 B;  2EIA A;  1S72 P;  2M8N A;  1Q81 Q;  5BS2 A;  1QVF O;  2JPR A;  1U7K A;  2JBG A;  2FVF A;  3H4E A;  5HGO A;  5JPA A;  4CA3 A;  1VQL P;  1IMQ A;  4HTW A;  2N50 A;  4PWV B;  4QKO A;  2MD9 A;  5CZD B;  2ROQ A;  2QA4 P;  1G03 A;  3CME P;  1P7N A;  4U0C A;  4BPF A;  1VHN A;  1N8R Q;  2KG8 A;  3VRL C;  2M5R A;  1AUM A;  1YHQ P;  4U0F A;  4MRT C;  2VLN A;  1ZNV A;  3G1G A;  1ACP A;  2K0D X;  4BPH A;  3DS2 A;  2JU1 A;  3G21 A;  2K92 A;  3G28 A;  2V4X A;  1M9X C;  1W2B O;  2LKI A;  3DTJ A;  2VLO A;  1E0H A;  5F2K A;  2CWO A;  1ZMB A;  1GXH A;  1VQ7 P;  3CMA P;  2L9F A;  1KC8 Q;  1JJ2 O;  2LTE A;  4COP A;  1X3O A;  1UNK A;  1VKU A;  4PH0 A;  1VQ9 P;  2XGV A;  2PEN A;  1M74 A;  2MVU A;  4LQW C;  2KGE A;  2K93 A;  3DPH A;  2FQ1 A;  2LML A;  3CCE P;  3I55 P;  4U0E A;  2CNR A;  2KG9 A;  5HGL A;  5BS1 A;  3OW2 O;  1M1K Q;  4PH3 A;  5HV8 A;  2VSQ A;  1VQM P;  4IPY A;  2EG5 A;  3G29 A;  2KW2 A;  2XT1 A;  3CCV P;  3G1I A;  1M90 Q;  1RNI A;  2AFE A;  2PWM A;  4DG9 A;  2VLQ A;  2PEO A;  2LF4 A;  4XFY A;  2L0Q A;  1A43 A;  2JQ4 A;  3CCJ P;  3DS5 A;  4HKG A;  1EMV A;  2N6Z A;  2XZ1 C;  2N98 A;  3HZQ A;  3LMO A;  2XGY A;  1AK4 C;  4H2W C;  2EHS A;  2GZG A;  3BP9 A;  2KGC A;  2OTL P;  2JO0 A;  2KOO A;  3NTE A;  2XV6 A;  2KOD A;  2LIU A;  1GWP A;  1AYI A;  2PNG A;  3RG2 A;  2MR7 A;  2KR5 A;  1AFV A;  2AVA A;  5HVC A;  1VQO P;  3G26 A;  1Z6M A;  2GZE A;  1VQ4 P;  1K8A Q;  3M1M A;  1QRJ A;  5KP6 B;  1KD1 Q;  3CE7 A;  3E2D A;  2LOL A;  2FAC A;  3G4S P;  1VQP P;  2MR8 A;  4H2Y C;  2KOQ A;  1M9F C;  2VLP A;  2OTJ P;  4U0D A; 
#chains in the Genus database with same CATH homology
 2XGU A;  4XRO A;  3CCS P;  1M9E C;  1L6N A;  4PH0 A;  4M0I A;  4E91 A;  1VQ9 P;  2XGV A;  4NX4 C;  1M6E X;  1M6N A;  2OAR A;  1QVG O;  4INB A;  3CXC O;  2PEN A;  3G71 P;  1M74 A;  4XRQ A;  3CCQ P;  1K73 Q;  4XFX A;  2DGY A;  3CD6 P;  3CC7 P;  4LQW C;  3RG6 C;  3CCU P;  3CCL P;  1VQ6 P;  4PH2 A;  3B5I A;  4QNB A;  2GON A;  3DPH A;  1K30 A;  1M9Y C;  3DS0 A;  3P05 A;  2Y4Z A;  5I4T G;  4J93 A;  1A8O A;  1YIJ P;  4WYM A;  3Q20 A;  4GR2 A;  3CCE P;  3I55 P;  4U0E A;  2X83 A;  1RO0 A;  5HGL A;  5BS1 A;  1KQS O;  3OW2 O;  1M1K Q;  4PH3 A;  2X2D D;  5HGK A;  2BUO A;  1BAJ A;  3CC2 P;  1VQM P;  1YJW P;  3HYB A;  4IPY A;  2EG5 A;  2PEQ A;  4B4N A;  1NJI Q;  4E92 A;  1D1D A;  3G0V A;  4COC A;  1Q82 Q;  3G29 A;  1M9C C;  2XXM A;  2JYG A;  2GOL B;  2XT1 A;  4PH1 A;  3CCV P;  3G1I A;  1VQN P;  1M90 Q;  1RNI A;  2XDE A;  1IUQ A;  4U0B A;  3CCR P;  4GR6 A;  3CPW O;  2PWM A;  2PEM A;  5DCK A;  5F2O A;  2M8L A;  1K9M Q;  5F2N A;  2PEO A;  1YJN P;  2PEI A;  2JYL A;  2Z45 A;  2LF4 A;  4XFY A;  2EIA A;  3DS3 A;  1A43 A;  2QEX P;  1S72 P;  2M8N A;  3CCJ P;  1Q81 Q;  3DS5 A;  2BHV A;  3DS1 A;  2WLV B;  5BS2 A;  1QVF O;  2JPR A;  1U7K A;  2L6E A;  3H4E A;  1EM9 A;  1EOQ A;  5HGO A;  5JPA A;  2KGF A;  3CCM P;  1YI2 P;  1Q7Y Q;  3HZQ A;  2Z44 A;  2PY8 A;  2XGY A;  1AK4 C;  1VQL P;  4HTW A;  2OTL P;  3BP9 A;  3CME P;  2JO0 A;  2QA4 P;  3I56 P;  1G03 A;  3NTE A;  1P7N A;  4U0C A;  2ONT A;  2XV6 A;  2KOD A;  3G6E P;  1VQ8 P;  1GWP A;  1VQ5 P;  3WBH A;  1N8R Q;  3VRL C;  1AUM A;  4U0A A;  2E1M A;  1YHQ P;  4U0F A;  2WLV A;  1M9D C;  2PXR C;  2PWO A;  2X82 A;  3G1G A;  1Q86 Q;  1AFV A;  1E6J P;  3DS2 A;  3G26 A;  1VQO P;  3G21 A;  3G28 A;  5HGN A;  2V4X A;  1M9X C;  3MGE A;  4DGA C;  3DS4 A;  1VQ4 P;  4DGE C;  1YIT P;  1K8A Q;  2PEK A;  1W2B O;  3DTJ A;  3H47 A;  1YJ9 P;  2P9X A;  3LRY A;  3M1M A;  5F2K A;  2CWO A;  1QRJ A;  3CC4 P;  1ZMB A;  1EIA A;  1KD1 Q;  3CMA P;  1VQ7 P;  3H0D A;  3E2D A;  5HGM A;  4XFZ A;  1KC8 Q;  1JJ2 O;  2PEJ A;  2EFJ A;  3G4S P;  1VQP P;  1M9F C;  4COP A;  1VQK P;  2M8P A;  2Z46 A;  1RO2 A;  2OTJ P;  4U0D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...