2Y4ZA

Structure of the amino-terminal capsid restriction escape mutation n- mlv l10w
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
135
structure length
135
Chain Sequence
PLRLGGNGQWQYWPFSSSDLYNWKNNNPSFSEDPGKLTALIESVLTTHQPTWDDCQQLLGTLLTGEEKQRVLLEARKAVRGNDGRPTQLPNEVDAAFPLERPDWDYTTQRGRNHLVLYRQLLLAGLQNAGRSLEH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Novel Escape Mutants Suggest an Extensive Trim5Alpha Binding Site Spanning the Entire Outer Surface of the Murine Leukemia Virus Capsid Protein.
pubmed doi rcsb
source organism Murine leukemia virus
molecule tags Viral protein
molecule keywords CAPSID PROTEIN P30
total genus 47
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2011-01-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2y4zA00
1G03A 2M8NA 1M9YC 5HGOA 4U0BA 4U0EA 3H47A 2M8PA 2WLVA 4U0CA 2V4XA 1M9EC 2XGUA 4NX4C 4U0DA 5HGLA 5JPAA 4XFYA 1EM9A 4QNBA 1EIAA 4PH3A 4E92A 1M9DC 2XGYA 3NTEA 4U0FA 1L6NA 2M8LA 1D1DA 2KGFA 4E91A 1QRJA 2WLVB 1M9CC 4DGEC 4PH0A 4B4NA 2EIAA 4U0AA 1U7KA 4XFXA 5HGNA 2XGVA 1AFVA 3BP9A 2X83A 4XROA 3MGEA 4HTWA 4WYMA 4XFZA 2GOLB 2PWMA 1GWPA 3P05A 4LQWC 4XRQA 1M9XC 4INBA 2LF4A 2PXRC 4PH2A 2GONA 4J93A 5HGKA 2X82A 2JPRA 4DGAC 5HGMA 2Y4ZA 1M9FC 2PWOA 2XDEA 3H4EA 1P7NA 1E6JP 1AK4C 2X2DD
chains in the Genus database with same CATH superfamily
1G03A 2M8NA 1M9YC 5HGOA 4U0BA 4U0EA 3H47A 2M8PA 2WLVA 4U0CA 2V4XA 1M9EC 2XGUA 4NX4C 4U0DA 5HGLA 5JPAA 4XFYA 1EM9A 4QNBA 1EIAA 4PH3A 4E92A 1M9DC 2XGYA 3NTEA 4U0FA 1L6NA 2M8LA 1D1DA 2KGFA 4E91A 1QRJA 2WLVB 1M9CC 4DGEC 4PH0A 4B4NA 2EIAA 4U0AA 1U7KA 4XFXA 5HGNA 2XGVA 1AFVA 3BP9A 2X83A 4XROA 3MGEA 4HTWA 4WYMA 4XFZA 2GOLB 2PWMA 1GWPA 3P05A 4LQWC 4XRQA 1M9XC 4INBA 2LF4A 2PXRC 4PH2A 2GONA 4J93A 5HGKA 2X82A 2JPRA 4DGAC 5HGMA 2Y4ZA 1M9FC 2PWOA 2XDEA 3H4EA 1P7NA 1E6JP 1AK4C 2X2DD
chains in the Genus database with same CATH topology
1G03A 2M8NA 1M9YC 5HGOA 4U0BA 4U0EA 3H47A 2M8PA 2WLVA 4U0CA 2V4XA 1M9EC 2XGUA 4NX4C 4U0DA 5HGLA 5JPAA 4XFYA 1EM9A 4QNBA 1EIAA 4PH3A 4E92A 1M9DC 2XGYA 3NTEA 4U0FA 1L6NA 2M8LA 1D1DA 2KGFA 4E91A 1QRJA 2WLVB 1M9CC 4DGEC 4PH0A 4B4NA 2EIAA 4U0AA 1U7KA 4XFXA 5HGNA 2XGVA 1AFVA 3BP9A 2X83A 4XROA 3MGEA 4HTWA 4WYMA 4XFZA 2GOLB 2PWMA 1GWPA 3P05A 4LQWC 4XRQA 1M9XC 4INBA 2LF4A 2PXRC 4PH2A 2GONA 4J93A 5HGKA 2X82A 2JPRA 4DGAC 5HGMA 2Y4ZA 1M9FC 2PWOA 2XDEA 3H4EA 1P7NA 1E6JP 1AK4C 2X2DD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G03 A;  2M8N A;  1M9Y C;  5HGO A;  4U0B A;  4U0E A;  3H47 A;  2M8P A;  2WLV A;  4U0C A;  2V4X A;  1M9E C;  2XGU A;  4NX4 C;  4U0D A;  5HGL A;  5JPA A;  4XFY A;  1EM9 A;  4QNB A;  1EIA A;  4PH3 A;  4E92 A;  1M9D C;  2XGY A;  3NTE A;  4U0F A;  1L6N A;  2M8L A;  1D1D A;  2KGF A;  4E91 A;  1QRJ A;  2WLV B;  1M9C C;  4DGE C;  4PH0 A;  4B4N A;  2EIA A;  4U0A A;  1U7K A;  4XFX A;  5HGN A;  2XGV A;  1AFV A;  3BP9 A;  2X83 A;  4XRO A;  3MGE A;  4HTW A;  4WYM A;  4XFZ A;  2GOL B;  2PWM A;  1GWP A;  3P05 A;  4LQW C;  4XRQ A;  1M9X C;  4INB A;  2LF4 A;  2PXR C;  4PH2 A;  2GON A;  4J93 A;  5HGK A;  2X82 A;  2JPR A;  4DGA C;  5HGM A;  2Y4Z A;  1M9F C;  2PWO A;  2XDE A;  3H4E A;  1P7N A;  1E6J P;  1AK4 C;  2X2D D; 
#chains in the Genus database with same CATH topology
 1G03 A;  2M8N A;  1M9Y C;  5HGO A;  4U0B A;  4U0E A;  3H47 A;  2M8P A;  2WLV A;  4U0C A;  2V4X A;  1M9E C;  2XGU A;  4NX4 C;  4U0D A;  5HGL A;  5JPA A;  4XFY A;  1EM9 A;  4QNB A;  1EIA A;  4PH3 A;  4E92 A;  1M9D C;  2XGY A;  3NTE A;  4U0F A;  1L6N A;  2M8L A;  1D1D A;  2KGF A;  4E91 A;  1QRJ A;  2WLV B;  1M9C C;  4DGE C;  4PH0 A;  4B4N A;  2EIA A;  4U0A A;  1U7K A;  4XFX A;  5HGN A;  2XGV A;  1AFV A;  3BP9 A;  2X83 A;  4XRO A;  3MGE A;  4HTW A;  4WYM A;  4XFZ A;  2GOL B;  2PWM A;  1GWP A;  3P05 A;  4LQW C;  4XRQ A;  1M9X C;  4INB A;  2LF4 A;  2PXR C;  4PH2 A;  2GON A;  4J93 A;  5HGK A;  2X82 A;  2JPR A;  4DGA C;  5HGM A;  2Y4Z A;  1M9F C;  2PWO A;  2XDE A;  3H4E A;  1P7N A;  1E6J P;  1AK4 C;  2X2D D; 
#chains in the Genus database with same CATH homology
 1G03 A;  2M8N A;  1M9Y C;  5HGO A;  4U0B A;  4U0E A;  3H47 A;  2M8P A;  2WLV A;  4U0C A;  2V4X A;  1M9E C;  2XGU A;  4NX4 C;  4U0D A;  5HGL A;  5JPA A;  4XFY A;  1EM9 A;  4QNB A;  1EIA A;  4PH3 A;  4E92 A;  1M9D C;  2XGY A;  3NTE A;  4U0F A;  1L6N A;  2M8L A;  1D1D A;  2KGF A;  4E91 A;  1QRJ A;  2WLV B;  1M9C C;  4DGE C;  4PH0 A;  4B4N A;  2EIA A;  4U0A A;  1U7K A;  4XFX A;  5HGN A;  2XGV A;  1AFV A;  3BP9 A;  2X83 A;  4XRO A;  3MGE A;  4HTW A;  4WYM A;  4XFZ A;  2GOL B;  2PWM A;  1GWP A;  3P05 A;  4LQW C;  4XRQ A;  1M9X C;  4INB A;  2LF4 A;  2PXR C;  4PH2 A;  2GON A;  4J93 A;  5HGK A;  2X82 A;  2JPR A;  4DGA C;  5HGM A;  2Y4Z A;  1M9F C;  2PWO A;  2XDE A;  3H4E A;  1P7N A;  1E6J P;  1AK4 C;  2X2D D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...