4B4NA

Cpsf6 defines a conserved capsid interface that modulates hiv-1 replication
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
136
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG PROTEIN
publication title Cpsf6 Defines a Conserved Capsid Interface that Modulates HIV-1 Replication.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/rna binding protein
total genus 50
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4b4nA00
4J93A 1M9DC 3H4EA 3P05A 1QRJA 2PWMA 2X2DD 2X82A 3NTEA 2V4XA 2JPRA 1D1DA 2EIAA 4DGEC 5JPAA 4LQWC 2XGUA 1AK4C 1M9CC 1GWPA 4B4NA 2GOLB 1M9FC 5HGMA 4U0CA 5HGNA 2XGYA 2WLVA 2KGFA 2M8PA 3H47A 4XROA 1M9XC 2Y4ZA 4XRQA 2X83A 5HGLA 4XFXA 1M9EC 2XDEA 4XFYA 3MGEA 2LF4A 2PWOA 3BP9A 1U7KA 1EIAA 2GONA 1M9YC 4U0AA 4INBA 4DGAC 4QNBA 4U0EA 1P7NA 4NX4C 4PH3A 2PXRC 5HGKA 4E92A 4U0DA 5HGOA 4WYMA 1E6JP 2WLVB 4PH2A 4PH0A 4XFZA 1AFVA 1G03A 1L6NA 4U0BA 1EM9A 2M8NA 4E91A 2M8LA 4U0FA 2XGVA 4HTWA
chains in the Genus database with same CATH superfamily
4J93A 1M9DC 3H4EA 3P05A 1QRJA 2PWMA 2X2DD 2X82A 3NTEA 2V4XA 2JPRA 1D1DA 2EIAA 4DGEC 5JPAA 4LQWC 2XGUA 1AK4C 1M9CC 1GWPA 4B4NA 2GOLB 1M9FC 5HGMA 4U0CA 5HGNA 2XGYA 2WLVA 2KGFA 2M8PA 3H47A 4XROA 1M9XC 2Y4ZA 4XRQA 2X83A 5HGLA 4XFXA 1M9EC 2XDEA 4XFYA 3MGEA 2LF4A 2PWOA 3BP9A 1U7KA 1EIAA 2GONA 1M9YC 4U0AA 4INBA 4DGAC 4QNBA 4U0EA 1P7NA 4NX4C 4PH3A 2PXRC 5HGKA 4E92A 4U0DA 5HGOA 4WYMA 1E6JP 2WLVB 4PH2A 4PH0A 4XFZA 1AFVA 1G03A 1L6NA 4U0BA 1EM9A 2M8NA 4E91A 2M8LA 4U0FA 2XGVA 4HTWA
chains in the Genus database with same CATH topology
4J93A 1M9DC 3H4EA 3P05A 1QRJA 2PWMA 2X2DD 2X82A 3NTEA 2V4XA 2JPRA 1D1DA 2EIAA 4DGEC 5JPAA 4LQWC 2XGUA 1AK4C 1M9CC 1GWPA 4B4NA 2GOLB 1M9FC 5HGMA 4U0CA 5HGNA 2XGYA 2WLVA 2KGFA 2M8PA 3H47A 4XROA 1M9XC 2Y4ZA 4XRQA 2X83A 5HGLA 4XFXA 1M9EC 2XDEA 4XFYA 3MGEA 2LF4A 2PWOA 3BP9A 1U7KA 1EIAA 2GONA 1M9YC 4U0AA 4INBA 4DGAC 4QNBA 4U0EA 1P7NA 4NX4C 4PH3A 2PXRC 5HGKA 4E92A 4U0DA 5HGOA 4WYMA 1E6JP 2WLVB 4PH2A 4PH0A 4XFZA 1AFVA 1G03A 1L6NA 4U0BA 1EM9A 2M8NA 4E91A 2M8LA 4U0FA 2XGVA 4HTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J93 A;  1M9D C;  3H4E A;  3P05 A;  1QRJ A;  2PWM A;  2X2D D;  2X82 A;  3NTE A;  2V4X A;  2JPR A;  1D1D A;  2EIA A;  4DGE C;  5JPA A;  4LQW C;  2XGU A;  1AK4 C;  1M9C C;  1GWP A;  4B4N A;  2GOL B;  1M9F C;  5HGM A;  4U0C A;  5HGN A;  2XGY A;  2WLV A;  2KGF A;  2M8P A;  3H47 A;  4XRO A;  1M9X C;  2Y4Z A;  4XRQ A;  2X83 A;  5HGL A;  4XFX A;  1M9E C;  2XDE A;  4XFY A;  3MGE A;  2LF4 A;  2PWO A;  3BP9 A;  1U7K A;  1EIA A;  2GON A;  1M9Y C;  4U0A A;  4INB A;  4DGA C;  4QNB A;  4U0E A;  1P7N A;  4NX4 C;  4PH3 A;  2PXR C;  5HGK A;  4E92 A;  4U0D A;  5HGO A;  4WYM A;  1E6J P;  2WLV B;  4PH2 A;  4PH0 A;  4XFZ A;  1AFV A;  1G03 A;  1L6N A;  4U0B A;  1EM9 A;  2M8N A;  4E91 A;  2M8L A;  4U0F A;  2XGV A;  4HTW A; 
#chains in the Genus database with same CATH topology
 4J93 A;  1M9D C;  3H4E A;  3P05 A;  1QRJ A;  2PWM A;  2X2D D;  2X82 A;  3NTE A;  2V4X A;  2JPR A;  1D1D A;  2EIA A;  4DGE C;  5JPA A;  4LQW C;  2XGU A;  1AK4 C;  1M9C C;  1GWP A;  4B4N A;  2GOL B;  1M9F C;  5HGM A;  4U0C A;  5HGN A;  2XGY A;  2WLV A;  2KGF A;  2M8P A;  3H47 A;  4XRO A;  1M9X C;  2Y4Z A;  4XRQ A;  2X83 A;  5HGL A;  4XFX A;  1M9E C;  2XDE A;  4XFY A;  3MGE A;  2LF4 A;  2PWO A;  3BP9 A;  1U7K A;  1EIA A;  2GON A;  1M9Y C;  4U0A A;  4INB A;  4DGA C;  4QNB A;  4U0E A;  1P7N A;  4NX4 C;  4PH3 A;  2PXR C;  5HGK A;  4E92 A;  4U0D A;  5HGO A;  4WYM A;  1E6J P;  2WLV B;  4PH2 A;  4PH0 A;  4XFZ A;  1AFV A;  1G03 A;  1L6N A;  4U0B A;  1EM9 A;  2M8N A;  4E91 A;  2M8L A;  4U0F A;  2XGV A;  4HTW A; 
#chains in the Genus database with same CATH homology
 4J93 A;  1M9D C;  3H4E A;  3P05 A;  1QRJ A;  2PWM A;  2X2D D;  2X82 A;  3NTE A;  2V4X A;  2JPR A;  1D1D A;  2EIA A;  4DGE C;  5JPA A;  4LQW C;  2XGU A;  1AK4 C;  1M9C C;  1GWP A;  4B4N A;  2GOL B;  1M9F C;  5HGM A;  4U0C A;  5HGN A;  2XGY A;  2WLV A;  2KGF A;  2M8P A;  3H47 A;  4XRO A;  1M9X C;  2Y4Z A;  4XRQ A;  2X83 A;  5HGL A;  4XFX A;  1M9E C;  2XDE A;  4XFY A;  3MGE A;  2LF4 A;  2PWO A;  3BP9 A;  1U7K A;  1EIA A;  2GON A;  1M9Y C;  4U0A A;  4INB A;  4DGA C;  4QNB A;  4U0E A;  1P7N A;  4NX4 C;  4PH3 A;  2PXR C;  5HGK A;  4E92 A;  4U0D A;  5HGO A;  4WYM A;  1E6J P;  2WLV B;  4PH2 A;  4PH0 A;  4XFZ A;  1AFV A;  1G03 A;  1L6N A;  4U0B A;  1EM9 A;  2M8N A;  4E91 A;  2M8L A;  4U0F A;  2XGV A;  4HTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...