4B4NA

Cpsf6 defines a conserved capsid interface that modulates hiv-1 replication
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
136
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/rna binding protein
molecule keywords GAG PROTEIN
publication title Cpsf6 Defines a Conserved Capsid Interface that Modulates HIV-1 Replication.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 50
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4b4nA00
4U0EA 2X2DD 1AFVA 2KGFA 2WLVA 2GONA 2XGUA 5HGMA 4U0FA 1EM9A 4HTWA 2M8LA 1P7NA 5HGOA 2V4XA 4DGAC 1GWPA 4PH0A 1M9XC 1G03A 5HGLA 4XFZA 2WLVB 1M9FC 4U0CA 2M8NA 5HGNA 5HGKA 4XFXA 1M9YC 3NTEA 2EIAA 2GOLB 2Y4ZA 4E92A 3H4EA 2XDEA 2PWMA 2XGVA 1U7KA 1QRJA 3H47A 2XGYA 1D1DA 2PXRC 4PH2A 4E91A 2X83A 4LQWC 4XRQA 4U0BA 3BP9A 2PWOA 4J93A 4B4NA 2M8PA 2JPRA 3P05A 1M9CC 4DGEC 2LF4A 5JPAA 4WYMA 3MGEA 4NX4C 1AK4C 4INBA 2X82A 4U0DA 4XROA 1M9EC 4U0AA 1EIAA 1E6JP 4PH3A 4QNBA 1L6NA 4XFYA 1M9DC
chains in the Genus database with same CATH superfamily
4U0EA 2X2DD 1AFVA 2KGFA 2WLVA 2GONA 2XGUA 5HGMA 4U0FA 1EM9A 4HTWA 2M8LA 1P7NA 5HGOA 2V4XA 4DGAC 1GWPA 4PH0A 1M9XC 1G03A 5HGLA 4XFZA 2WLVB 1M9FC 4U0CA 2M8NA 5HGNA 5HGKA 4XFXA 1M9YC 3NTEA 2EIAA 2GOLB 2Y4ZA 4E92A 3H4EA 2XDEA 2PWMA 2XGVA 1U7KA 1QRJA 3H47A 2XGYA 1D1DA 2PXRC 4PH2A 4E91A 2X83A 4LQWC 4XRQA 4U0BA 3BP9A 2PWOA 4J93A 4B4NA 2M8PA 2JPRA 3P05A 1M9CC 4DGEC 2LF4A 5JPAA 4WYMA 3MGEA 4NX4C 1AK4C 4INBA 2X82A 4U0DA 4XROA 1M9EC 4U0AA 1EIAA 1E6JP 4PH3A 4QNBA 1L6NA 4XFYA 1M9DC
chains in the Genus database with same CATH topology
4U0EA 2X2DD 1AFVA 2KGFA 2WLVA 2GONA 2XGUA 5HGMA 4U0FA 1EM9A 4HTWA 2M8LA 1P7NA 5HGOA 2V4XA 4DGAC 1GWPA 4PH0A 1M9XC 1G03A 5HGLA 4XFZA 2WLVB 1M9FC 4U0CA 2M8NA 5HGNA 5HGKA 4XFXA 1M9YC 3NTEA 2EIAA 2GOLB 2Y4ZA 4E92A 3H4EA 2XDEA 2PWMA 2XGVA 1U7KA 1QRJA 3H47A 2XGYA 1D1DA 2PXRC 4PH2A 4E91A 2X83A 4LQWC 4XRQA 4U0BA 3BP9A 2PWOA 4J93A 4B4NA 2M8PA 2JPRA 3P05A 1M9CC 4DGEC 2LF4A 5JPAA 4WYMA 3MGEA 4NX4C 1AK4C 4INBA 2X82A 4U0DA 4XROA 1M9EC 4U0AA 1EIAA 1E6JP 4PH3A 4QNBA 1L6NA 4XFYA 1M9DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0E A;  2X2D D;  1AFV A;  2KGF A;  2WLV A;  2GON A;  2XGU A;  5HGM A;  4U0F A;  1EM9 A;  4HTW A;  2M8L A;  1P7N A;  5HGO A;  2V4X A;  4DGA C;  1GWP A;  4PH0 A;  1M9X C;  1G03 A;  5HGL A;  4XFZ A;  2WLV B;  1M9F C;  4U0C A;  2M8N A;  5HGN A;  5HGK A;  4XFX A;  1M9Y C;  3NTE A;  2EIA A;  2GOL B;  2Y4Z A;  4E92 A;  3H4E A;  2XDE A;  2PWM A;  2XGV A;  1U7K A;  1QRJ A;  3H47 A;  2XGY A;  1D1D A;  2PXR C;  4PH2 A;  4E91 A;  2X83 A;  4LQW C;  4XRQ A;  4U0B A;  3BP9 A;  2PWO A;  4J93 A;  4B4N A;  2M8P A;  2JPR A;  3P05 A;  1M9C C;  4DGE C;  2LF4 A;  5JPA A;  4WYM A;  3MGE A;  4NX4 C;  1AK4 C;  4INB A;  2X82 A;  4U0D A;  4XRO A;  1M9E C;  4U0A A;  1EIA A;  1E6J P;  4PH3 A;  4QNB A;  1L6N A;  4XFY A;  1M9D C; 
#chains in the Genus database with same CATH topology
 4U0E A;  2X2D D;  1AFV A;  2KGF A;  2WLV A;  2GON A;  2XGU A;  5HGM A;  4U0F A;  1EM9 A;  4HTW A;  2M8L A;  1P7N A;  5HGO A;  2V4X A;  4DGA C;  1GWP A;  4PH0 A;  1M9X C;  1G03 A;  5HGL A;  4XFZ A;  2WLV B;  1M9F C;  4U0C A;  2M8N A;  5HGN A;  5HGK A;  4XFX A;  1M9Y C;  3NTE A;  2EIA A;  2GOL B;  2Y4Z A;  4E92 A;  3H4E A;  2XDE A;  2PWM A;  2XGV A;  1U7K A;  1QRJ A;  3H47 A;  2XGY A;  1D1D A;  2PXR C;  4PH2 A;  4E91 A;  2X83 A;  4LQW C;  4XRQ A;  4U0B A;  3BP9 A;  2PWO A;  4J93 A;  4B4N A;  2M8P A;  2JPR A;  3P05 A;  1M9C C;  4DGE C;  2LF4 A;  5JPA A;  4WYM A;  3MGE A;  4NX4 C;  1AK4 C;  4INB A;  2X82 A;  4U0D A;  4XRO A;  1M9E C;  4U0A A;  1EIA A;  1E6J P;  4PH3 A;  4QNB A;  1L6N A;  4XFY A;  1M9D C; 
#chains in the Genus database with same CATH homology
 4U0E A;  2X2D D;  1AFV A;  2KGF A;  2WLV A;  2GON A;  2XGU A;  5HGM A;  4U0F A;  1EM9 A;  4HTW A;  2M8L A;  1P7N A;  5HGO A;  2V4X A;  4DGA C;  1GWP A;  4PH0 A;  1M9X C;  1G03 A;  5HGL A;  4XFZ A;  2WLV B;  1M9F C;  4U0C A;  2M8N A;  5HGN A;  5HGK A;  4XFX A;  1M9Y C;  3NTE A;  2EIA A;  2GOL B;  2Y4Z A;  4E92 A;  3H4E A;  2XDE A;  2PWM A;  2XGV A;  1U7K A;  1QRJ A;  3H47 A;  2XGY A;  1D1D A;  2PXR C;  4PH2 A;  4E91 A;  2X83 A;  4LQW C;  4XRQ A;  4U0B A;  3BP9 A;  2PWO A;  4J93 A;  4B4N A;  2M8P A;  2JPR A;  3P05 A;  1M9C C;  4DGE C;  2LF4 A;  5JPA A;  4WYM A;  3MGE A;  4NX4 C;  1AK4 C;  4INB A;  2X82 A;  4U0D A;  4XRO A;  1M9E C;  4U0A A;  1EIA A;  1E6J P;  4PH3 A;  4QNB A;  1L6N A;  4XFY A;  1M9D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...