4B4NA

Cpsf6 defines a conserved capsid interface that modulates hiv-1 replication
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
146
structure length
136
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpsf6 Defines a Conserved Capsid Interface that Modulates HIV-1 Replication.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/rna binding protein
molecule keywords GAG PROTEIN
total genus 50
structure length 136
sequence length 146
ec nomenclature
pdb deposition date 2012-07-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4b4nA00
1P7NA 3NTEA 2LF4A 1AK4C 1M9DC 2V4XA 2PWMA 4WYMA 3P05A 1U7KA 5HGNA 1AFVA 2XDEA 2EIAA 4QNBA 4U0BA 2JPRA 2M8PA 4J93A 1EIAA 1M9CC 2WLVA 4PH2A 4XFYA 5HGKA 2M8LA 4B4NA 4PH0A 4XRQA 4XFZA 1M9XC 1D1DA 4LQWC 4NX4C 1E6JP 2XGUA 4U0CA 4U0DA 5HGLA 4DGEC 1M9EC 1EM9A 1M9FC 2WLVB 4INBA 4E92A 2X2DD 2Y4ZA 4XROA 4E91A 5JPAA 3H4EA 2X82A 2XGVA 4PH3A 4U0AA 4XFXA 2X83A 1QRJA 5HGMA 2KGFA 1G03A 2PXRC 1GWPA 2GOLB 4HTWA 3MGEA 4DGAC 2XGYA 3BP9A 1M9YC 3H47A 4U0EA 2M8NA 2GONA 1L6NA 5HGOA 2PWOA 4U0FA
chains in the Genus database with same CATH superfamily
1P7NA 3NTEA 2LF4A 1AK4C 1M9DC 2V4XA 2PWMA 4WYMA 3P05A 1U7KA 5HGNA 1AFVA 2XDEA 2EIAA 4QNBA 4U0BA 2JPRA 2M8PA 4J93A 1EIAA 1M9CC 2WLVA 4PH2A 4XFYA 5HGKA 2M8LA 4B4NA 4PH0A 4XRQA 4XFZA 1M9XC 1D1DA 4LQWC 4NX4C 1E6JP 2XGUA 4U0CA 4U0DA 5HGLA 4DGEC 1M9EC 1EM9A 1M9FC 2WLVB 4INBA 4E92A 2X2DD 2Y4ZA 4XROA 4E91A 5JPAA 3H4EA 2X82A 2XGVA 4PH3A 4U0AA 4XFXA 2X83A 1QRJA 5HGMA 2KGFA 1G03A 2PXRC 1GWPA 2GOLB 4HTWA 3MGEA 4DGAC 2XGYA 3BP9A 1M9YC 3H47A 4U0EA 2M8NA 2GONA 1L6NA 5HGOA 2PWOA 4U0FA
chains in the Genus database with same CATH topology
1P7NA 3NTEA 2LF4A 1AK4C 1M9DC 2V4XA 2PWMA 4WYMA 3P05A 1U7KA 5HGNA 1AFVA 2XDEA 2EIAA 4QNBA 4U0BA 2JPRA 2M8PA 4J93A 1EIAA 1M9CC 2WLVA 4PH2A 4XFYA 5HGKA 2M8LA 4B4NA 4PH0A 4XRQA 4XFZA 1M9XC 1D1DA 4LQWC 4NX4C 1E6JP 2XGUA 4U0CA 4U0DA 5HGLA 4DGEC 1M9EC 1EM9A 1M9FC 2WLVB 4INBA 4E92A 2X2DD 2Y4ZA 4XROA 4E91A 5JPAA 3H4EA 2X82A 2XGVA 4PH3A 4U0AA 4XFXA 2X83A 1QRJA 5HGMA 2KGFA 1G03A 2PXRC 1GWPA 2GOLB 4HTWA 3MGEA 4DGAC 2XGYA 3BP9A 1M9YC 3H47A 4U0EA 2M8NA 2GONA 1L6NA 5HGOA 2PWOA 4U0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7N A;  3NTE A;  2LF4 A;  1AK4 C;  1M9D C;  2V4X A;  2PWM A;  4WYM A;  3P05 A;  1U7K A;  5HGN A;  1AFV A;  2XDE A;  2EIA A;  4QNB A;  4U0B A;  2JPR A;  2M8P A;  4J93 A;  1EIA A;  1M9C C;  2WLV A;  4PH2 A;  4XFY A;  5HGK A;  2M8L A;  4B4N A;  4PH0 A;  4XRQ A;  4XFZ A;  1M9X C;  1D1D A;  4LQW C;  4NX4 C;  1E6J P;  2XGU A;  4U0C A;  4U0D A;  5HGL A;  4DGE C;  1M9E C;  1EM9 A;  1M9F C;  2WLV B;  4INB A;  4E92 A;  2X2D D;  2Y4Z A;  4XRO A;  4E91 A;  5JPA A;  3H4E A;  2X82 A;  2XGV A;  4PH3 A;  4U0A A;  4XFX A;  2X83 A;  1QRJ A;  5HGM A;  2KGF A;  1G03 A;  2PXR C;  1GWP A;  2GOL B;  4HTW A;  3MGE A;  4DGA C;  2XGY A;  3BP9 A;  1M9Y C;  3H47 A;  4U0E A;  2M8N A;  2GON A;  1L6N A;  5HGO A;  2PWO A;  4U0F A; 
#chains in the Genus database with same CATH topology
 1P7N A;  3NTE A;  2LF4 A;  1AK4 C;  1M9D C;  2V4X A;  2PWM A;  4WYM A;  3P05 A;  1U7K A;  5HGN A;  1AFV A;  2XDE A;  2EIA A;  4QNB A;  4U0B A;  2JPR A;  2M8P A;  4J93 A;  1EIA A;  1M9C C;  2WLV A;  4PH2 A;  4XFY A;  5HGK A;  2M8L A;  4B4N A;  4PH0 A;  4XRQ A;  4XFZ A;  1M9X C;  1D1D A;  4LQW C;  4NX4 C;  1E6J P;  2XGU A;  4U0C A;  4U0D A;  5HGL A;  4DGE C;  1M9E C;  1EM9 A;  1M9F C;  2WLV B;  4INB A;  4E92 A;  2X2D D;  2Y4Z A;  4XRO A;  4E91 A;  5JPA A;  3H4E A;  2X82 A;  2XGV A;  4PH3 A;  4U0A A;  4XFX A;  2X83 A;  1QRJ A;  5HGM A;  2KGF A;  1G03 A;  2PXR C;  1GWP A;  2GOL B;  4HTW A;  3MGE A;  4DGA C;  2XGY A;  3BP9 A;  1M9Y C;  3H47 A;  4U0E A;  2M8N A;  2GON A;  1L6N A;  5HGO A;  2PWO A;  4U0F A; 
#chains in the Genus database with same CATH homology
 1P7N A;  3NTE A;  2LF4 A;  1AK4 C;  1M9D C;  2V4X A;  2PWM A;  4WYM A;  3P05 A;  1U7K A;  5HGN A;  1AFV A;  2XDE A;  2EIA A;  4QNB A;  4U0B A;  2JPR A;  2M8P A;  4J93 A;  1EIA A;  1M9C C;  2WLV A;  4PH2 A;  4XFY A;  5HGK A;  2M8L A;  4B4N A;  4PH0 A;  4XRQ A;  4XFZ A;  1M9X C;  1D1D A;  4LQW C;  4NX4 C;  1E6J P;  2XGU A;  4U0C A;  4U0D A;  5HGL A;  4DGE C;  1M9E C;  1EM9 A;  1M9F C;  2WLV B;  4INB A;  4E92 A;  2X2D D;  2Y4Z A;  4XRO A;  4E91 A;  5JPA A;  3H4E A;  2X82 A;  2XGV A;  4PH3 A;  4U0A A;  4XFX A;  2X83 A;  1QRJ A;  5HGM A;  2KGF A;  1G03 A;  2PXR C;  1GWP A;  2GOL B;  4HTW A;  3MGE A;  4DGA C;  2XGY A;  3BP9 A;  1M9Y C;  3H47 A;  4U0E A;  2M8N A;  2GON A;  1L6N A;  5HGO A;  2PWO A;  4U0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...