3H4EA

X-ray structure of hexameric hiv-1 ca
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
218
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQENAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein p24
publication title X-ray structures of the hexameric building block of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
total genus 77
structure length 218
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3h4eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3h4eA02
4QNBA 2JYLA 4PH3A 2L6EA 4INBA 4DGAC 5HGLA 3G0VA 2M8LA 2M8NA 3G28A 4U0AA 4LQWC 2BUOA 1BAJA 3VRLC 2XGVA 4IPYA 2M8PA 2V4XA 1M9EC 4M0IA 4PH1A 4B4NA 1EIAA 4U0CA 4E91A 3LRYA 3DPHA 3MGEA 2GONA 3BP9A 2GOLB 3DS3A 1A43A 4XRQA 1M9CC 1M9XC 2EIAA 4PH2A 4U0EA 1EOQA 1EM9A 4COCA 3P05A 4WYMA 2XGYA 2XDEA 3NTEA 3G29A 2X83A 4U0BA 5DCKA 2XXMA 3DS1A 1A8OA 1GWPA 2PWMA 4XROA 1M9FC 2Y4ZA 2ONTA 3H4EA 4DGEC 2XGUA 2X82A 5HGKA 2KGFA 3G1GA 4XFXA 1E6JP 1D1DA 2JPRA 2LF4A 1AUMA 4XFYA 3G26A 2KODA 1M9DC 2XT1A 1P7NA 4U0FA 2WLVA 1QRJA 2WLVB 1L6NA 4PH0A 4NX4C 3H47A 3G21A 3DS4A 2JYGA 1AFVA 3DS5A 2XV6A 4XFZA 5I4TG 5JPAA 1AK4C 3G1IA 3DTJA 4HTWA 5HGMA 1G03A 1U7KA 2PWOA 1M9YC 4J93A 3DS2A 4U0DA 4COPA 2X2DD 2JO0A 3DS0A 2PXRC 4E92A 5HGOA 5HGNA
chains in the Genus database with same CATH superfamily
3I56P 1DV5A 1VQKP 2XZ0D 2FHSC 3G0VA 3Q20A 3G28A 3GJNA 1KD1Q 1BAJA 1L0HA 3VRLC 2XGVA 1F80D 2V4XA 1M6EX 1HQBA 1VQPP 2DNWA 3GZMA 1VQ8P 1M74A 4U0CA 3LRYA 3BP9A 1DNYA 1X3OA 2LMLA 2GOLB 1A43A 2OARA 4COCA 3LMOA 4F37A 2GYKA 1GXGA 2XGYA 3G29A 1T8KA 4U0BA 5DCKA 2N50A 2PWMA 2LTEA 4XROA 2GZIA 2N98A 1S72P 1VQ9P 1IMPA 2FVAA 2LL8A 1UJZA 1M90Q 4DGEC 2X2BA 2N5HA 2X82A 5HGKA 3G1GA 4H2WC 3CCEP 2JPRA 3EJEA 1AUMA 2KGAA 3G26A 3CCJP 3I55P 1ACPA 1K30A 1CEIA 3H0DA 1VKUA 2CGQA 5HVCA 4IZ6A 1YI2P 2EHSA 2N5IA 3CCVP 3H47A 1E0HA 1YHQP 3DS4A 1AFVA 1YJWP 2JU2A 3RG6C 2L9FA 2XV6A 4XFZA 3G1IA 3DTJA 4HTWA 2PWOA 5BS2A 2OTJP 1VQ5P 4H2YC 2KORA 4E92A 5HGOA 2JQ4A 2VLPA 2LIWA 2KW2A 2LOLA 2GDWA 1AYIA 1W2BO 1ZNVA 2M8NA 3CPWO 1L0IA 1VQNP 4IPYA 2M8PA 2DGYA 2ERHA 1VQOP 4B4NA 2QEXP 2EFJA 1IMQA 3DPHA 4GR2A 2GONA 1K9MQ 2K92A 5F2NA 1M9XC 2FQ1A 2VLOA 4U0EA 4PH2A 2K5XA 2AFEA 3P05A 4WYMA 2XDEA 2K0DX 3U43A 3CC2P 1VQLP 2Z46A 4HKGA 1M9FC 4CA3A 5KP8B 2KOOA 2KG6A 4R0MA 2PY8A 3E2DA 2WPTA 2VSQA 2N6ZA 1D1DA 2LF4A 2KODA 2LIUA 1M9DC 2XT1A 2FADA 2L22A 2CQ8A 1QRJA 2GZJA 2PEQA 1NQ4A 2JAZA 4PH0A 4NX4C 2K93A 2KG9A 2ROQA 2MR8A 3DS5A 1K73Q 3EJDA 4PXHB 3B5IA 3CCLP 5JPAA 2PEOA 2MR7A 1BXIA 5HGMA 1G03A 2QNWA 2LKIA 5CZDB 4U0DA 5HGNA 5KP7B 4PH3A 5EW5E 2L6EA 2VLQA 2PEKA 1M1KQ 5HGLA 3CE7A 3CD6P 4MRTC 2E1MA 2M8LA 3CCSP 4U0AA 4LQWC 2K94A 2BUOA 3OW2O 2K2QA 1M6NA 1GPJA 3HYBA 3CMEP 2FQ2A 4BPFA 4PH1A 2FAEA 1YJ9P 3RG2A 2KG8A 2FVEA 3MGEA 2CNRA 7CEIA 2MVUA 2AFDA 4XRQA 1RNIA 2MVVA 3CCQP 2MD9A 1RO0A 1Q7YQ 3NY7B 3NTEA 4PWVB 2XXMA 1A8OA 1GWPA 3CMAP 2QA4P 2Y4ZA 3G4SP 2ONTA 3H4EA 2EG5A 3HZQA 1VQ4P 2Z45A 3CCRP 1Q86Q 2KWLA 4GR6A 1Z6MA 4BPGA 4XFXA 3CC7P 3EJBA 1FR2A 4XFYA 1VQMP 2L0QA 2MY5A 2GZGA 1P7NA 4U0FA 1ZMBA 1RO2A 1EMVA 2WLVA 2WLVB 3CCUP 2XZ1C 3G21A 5I4TG 2AF8A 3GKLC 3M1MA 2JU1A 1M9YC 2PENA 1JJ2O 4COPA 3DS0A 2JYLA 4E91A 2GZEA 2FACA 2LPKA 2CWOA 4QNBA 2GDXA 2KGDA 4INBA 2GZFA 5F2OA 3CXCO 1AF8A 3B4QA 2K0XA 2KOPA 4UHPB 1M9EC 4M0IA 1UNKA 2FVFA 2K0YA 1N8RQ 2KOQA 1IUQA 4NEOA 2M5RA 2KR5A 1EIAA 1Q82Q 1MZ8A 1VHNA 5EJDA 1KC8Q 2PNGA 3DS3A 1M9CC 1VQ6P 2EIAA 1EOQA 1Q81Q 1QVGO 2KGEA 1EM9A 4H2XC 2PEMA 2BHVA 1YIJP 4BPHA 2N6YA 3CC4P 3CCMP 3G6EP 1K8AQ 2X83A 2P9XA 2AVAA 3DS1A 2PEIA 1QVFO 2JB0A 2XGUA 1VQ7P 2CG5B 3G71P 2KGFA 1E6JP 2KGCA 2Z44A 5KP6B 1NJIQ 3GZLA 5F2KA 2NO8A 4DG9A 2JBGA 2PEJA 1L6NA 1GXHA 1YJNP 2JGPA 2JYGA 1HY8A 1YITP 2EHTA 2FQ0A 1KQSO 2KOSA 1AK4C 5BS1A 4QKOA 3WBHA 2L4BA 1OR5A 2MF4A 1U7KA 2GDYA 5HV8A 2VLNA 4J93A 2OTLP 3DS2A 2X2DD 2JO0A 2PXRC 1KLPA 4DGAC
chains in the Genus database with same CATH topology
2CWOA 4QNBA 2JYLA 3I56P 4PH3A 2L6EA 2PEKA 1M1KQ 1VQKP 4INBA 4DGAC 5F2OA 5HGLA 1W2BO 3G0VA 3CD6P 2E1MA 2M8LA 3Q20A 2M8NA 3CXCO 3CPWO 3G28A 4U0AA 4LQWC 3CCSP 2BUOA 3OW2O 1KD1Q 1BAJA 1VQNP 1M6NA 3VRLC 2XGVA 4IPYA 3CMEP 3HYBA 2M8PA 2V4XA 1M6EX 1M9EC 4M0IA 1VQPP 2DGYA 1N8RQ 1VQOP 1IUQA 4PH1A 4B4NA 1YJ9P 1VQ8P 1M74A 2QEXP 1EIAA 1Q82Q 2EFJA 4U0CA 4E91A 3LRYA 3DPHA 3MGEA 1KC8Q 4GR2A 2GONA 3BP9A 1K9MQ 2GOLB 3DS3A 5F2NA 1A43A 4XRQA 1M9CC 1RNIA 1M9XC 1VQ6P 2OARA 3CCQP 2EIAA 4PH2A 4U0EA 1EOQA 1Q81Q 1QVGO 1RO0A 1EM9A 4COCA 3P05A 1Q7YQ 2PEMA 2BHVA 4WYMA 1YIJP 3CC4P 2XGYA 2XDEA 3CCMP 3NTEA 3G29A 3G6EP 1K8AQ 2X83A 4U0BA 5DCKA 2XXMA 2P9XA 3CC2P 3DS1A 1A8OA 1GWPA 2PWMA 2PEIA 4XROA 2Z46A 3CMAP 2QA4P 1M9FC 1VQLP 1QVFO 2Y4ZA 3G4SP 2ONTA 1S72P 3H4EA 1VQ9P 2EG5A 3HZQA 1VQ4P 2Z45A 1M90Q 4DGEC 3CCRP 1Q86Q 2XGUA 1VQ7P 3G71P 2X82A 5HGKA 2KGFA 3G1GA 4GR6A 2PY8A 3E2DA 4XFXA 1E6JP 3CC7P 1D1DA 2Z44A 3CCEP 2JPRA 2LF4A 1AUMA 1NJIQ 4XFYA 3G26A 5F2KA 1VQMP 2KODA 3CCJP 3I55P 1K30A 1M9DC 2XT1A 3H0DA 1P7NA 4U0FA 1ZMBA 1RO2A 2WLVA 1QRJA 2PEQA 2WLVB 2PEJA 3CCUP 1L6NA 1YI2P 1YJNP 3CCVP 4PH0A 4NX4C 3H47A 3G21A 1YHQP 3DS4A 2JYGA 1YITP 1AFVA 1YJWP 3RG6C 3DS5A 1K73Q 1KQSO 2XV6A 3B5IA 4XFZA 3CCLP 5I4TG 5JPAA 1AK4C 2PEOA 5BS1A 3G1IA 3WBHA 3DTJA 3M1MA 4HTWA 5HGMA 1G03A 1U7KA 2PWOA 5BS2A 1M9YC 2OTJP 4J93A 2PENA 2OTLP 3DS2A 4U0DA 4COPA 1VQ5P 1JJ2O 2X2DD 2JO0A 3DS0A 2PXRC 4E92A 5HGOA 5HGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNB A;  2JYL A;  4PH3 A;  2L6E A;  4INB A;  4DGA C;  5HGL A;  3G0V A;  2M8L A;  2M8N A;  3G28 A;  4U0A A;  4LQW C;  2BUO A;  1BAJ A;  3VRL C;  2XGV A;  4IPY A;  2M8P A;  2V4X A;  1M9E C;  4M0I A;  4PH1 A;  4B4N A;  1EIA A;  4U0C A;  4E91 A;  3LRY A;  3DPH A;  3MGE A;  2GON A;  3BP9 A;  2GOL B;  3DS3 A;  1A43 A;  4XRQ A;  1M9C C;  1M9X C;  2EIA A;  4PH2 A;  4U0E A;  1EOQ A;  1EM9 A;  4COC A;  3P05 A;  4WYM A;  2XGY A;  2XDE A;  3NTE A;  3G29 A;  2X83 A;  4U0B A;  5DCK A;  2XXM A;  3DS1 A;  1A8O A;  1GWP A;  2PWM A;  4XRO A;  1M9F C;  2Y4Z A;  2ONT A;  3H4E A;  4DGE C;  2XGU A;  2X82 A;  5HGK A;  2KGF A;  3G1G A;  4XFX A;  1E6J P;  1D1D A;  2JPR A;  2LF4 A;  1AUM A;  4XFY A;  3G26 A;  2KOD A;  1M9D C;  2XT1 A;  1P7N A;  4U0F A;  2WLV A;  1QRJ A;  2WLV B;  1L6N A;  4PH0 A;  4NX4 C;  3H47 A;  3G21 A;  3DS4 A;  2JYG A;  1AFV A;  3DS5 A;  2XV6 A;  4XFZ A;  5I4T G;  5JPA A;  1AK4 C;  3G1I A;  3DTJ A;  4HTW A;  5HGM A;  1G03 A;  1U7K A;  2PWO A;  1M9Y C;  4J93 A;  3DS2 A;  4U0D A;  4COP A;  2X2D D;  2JO0 A;  3DS0 A;  2PXR C;  4E92 A;  5HGO A;  5HGN A; 
#chains in the Genus database with same CATH topology
 3I56 P;  1DV5 A;  1VQK P;  2XZ0 D;  2FHS C;  3G0V A;  3Q20 A;  3G28 A;  3GJN A;  1KD1 Q;  1BAJ A;  1L0H A;  3VRL C;  2XGV A;  1F80 D;  2V4X A;  1M6E X;  1HQB A;  1VQP P;  2DNW A;  3GZM A;  1VQ8 P;  1M74 A;  4U0C A;  3LRY A;  3BP9 A;  1DNY A;  1X3O A;  2LML A;  2GOL B;  1A43 A;  2OAR A;  4COC A;  3LMO A;  4F37 A;  2GYK A;  1GXG A;  2XGY A;  3G29 A;  1T8K A;  4U0B A;  5DCK A;  2N50 A;  2PWM A;  2LTE A;  4XRO A;  2GZI A;  2N98 A;  1S72 P;  1VQ9 P;  1IMP A;  2FVA A;  2LL8 A;  1UJZ A;  1M90 Q;  4DGE C;  2X2B A;  2N5H A;  2X82 A;  5HGK A;  3G1G A;  4H2W C;  3CCE P;  2JPR A;  3EJE A;  1AUM A;  2KGA A;  3G26 A;  3CCJ P;  3I55 P;  1ACP A;  1K30 A;  1CEI A;  3H0D A;  1VKU A;  2CGQ A;  5HVC A;  4IZ6 A;  1YI2 P;  2EHS A;  2N5I A;  3CCV P;  3H47 A;  1E0H A;  1YHQ P;  3DS4 A;  1AFV A;  1YJW P;  2JU2 A;  3RG6 C;  2L9F A;  2XV6 A;  4XFZ A;  3G1I A;  3DTJ A;  4HTW A;  2PWO A;  5BS2 A;  2OTJ P;  1VQ5 P;  4H2Y C;  2KOR A;  4E92 A;  5HGO A;  2JQ4 A;  2VLP A;  2LIW A;  2KW2 A;  2LOL A;  2GDW A;  1AYI A;  1W2B O;  1ZNV A;  2M8N A;  3CPW O;  1L0I A;  1VQN P;  4IPY A;  2M8P A;  2DGY A;  2ERH A;  1VQO P;  4B4N A;  2QEX P;  2EFJ A;  1IMQ A;  3DPH A;  4GR2 A;  2GON A;  1K9M Q;  2K92 A;  5F2N A;  1M9X C;  2FQ1 A;  2VLO A;  4U0E A;  4PH2 A;  2K5X A;  2AFE A;  3P05 A;  4WYM A;  2XDE A;  2K0D X;  3U43 A;  3CC2 P;  1VQL P;  2Z46 A;  4HKG A;  1M9F C;  4CA3 A;  5KP8 B;  2KOO A;  2KG6 A;  4R0M A;  2PY8 A;  3E2D A;  2WPT A;  2VSQ A;  2N6Z A;  1D1D A;  2LF4 A;  2KOD A;  2LIU A;  1M9D C;  2XT1 A;  2FAD A;  2L22 A;  2CQ8 A;  1QRJ A;  2GZJ A;  2PEQ A;  1NQ4 A;  2JAZ A;  4PH0 A;  4NX4 C;  2K93 A;  2KG9 A;  2ROQ A;  2MR8 A;  3DS5 A;  1K73 Q;  3EJD A;  4PXH B;  3B5I A;  3CCL P;  5JPA A;  2PEO A;  2MR7 A;  1BXI A;  5HGM A;  1G03 A;  2QNW A;  2LKI A;  5CZD B;  4U0D A;  5HGN A;  5KP7 B;  4PH3 A;  5EW5 E;  2L6E A;  2VLQ A;  2PEK A;  1M1K Q;  5HGL A;  3CE7 A;  3CD6 P;  4MRT C;  2E1M A;  2M8L A;  3CCS P;  4U0A A;  4LQW C;  2K94 A;  2BUO A;  3OW2 O;  2K2Q A;  1M6N A;  1GPJ A;  3HYB A;  3CME P;  2FQ2 A;  4BPF A;  4PH1 A;  2FAE A;  1YJ9 P;  3RG2 A;  2KG8 A;  2FVE A;  3MGE A;  2CNR A;  7CEI A;  2MVU A;  2AFD A;  4XRQ A;  1RNI A;  2MVV A;  3CCQ P;  2MD9 A;  1RO0 A;  1Q7Y Q;  3NY7 B;  3NTE A;  4PWV B;  2XXM A;  1A8O A;  1GWP A;  3CMA P;  2QA4 P;  2Y4Z A;  3G4S P;  2ONT A;  3H4E A;  2EG5 A;  3HZQ A;  1VQ4 P;  2Z45 A;  3CCR P;  1Q86 Q;  2KWL A;  4GR6 A;  1Z6M A;  4BPG A;  4XFX A;  3CC7 P;  3EJB A;  1FR2 A;  4XFY A;  1VQM P;  2L0Q A;  2MY5 A;  2GZG A;  1P7N A;  4U0F A;  1ZMB A;  1RO2 A;  1EMV A;  2WLV A;  2WLV B;  3CCU P;  2XZ1 C;  3G21 A;  5I4T G;  2AF8 A;  3GKL C;  3M1M A;  2JU1 A;  1M9Y C;  2PEN A;  1JJ2 O;  4COP A;  3DS0 A;  2JYL A;  4E91 A;  2GZE A;  2FAC A;  2LPK A;  2CWO A;  4QNB A;  2GDX A;  2KGD A;  4INB A;  2GZF A;  5F2O A;  3CXC O;  1AF8 A;  3B4Q A;  2K0X A;  2KOP A;  4UHP B;  1M9E C;  4M0I A;  1UNK A;  2FVF A;  2K0Y A;  1N8R Q;  2KOQ A;  1IUQ A;  4NEO A;  2M5R A;  2KR5 A;  1EIA A;  1Q82 Q;  1MZ8 A;  1VHN A;  5EJD A;  1KC8 Q;  2PNG A;  3DS3 A;  1M9C C;  1VQ6 P;  2EIA A;  1EOQ A;  1Q81 Q;  1QVG O;  2KGE A;  1EM9 A;  4H2X C;  2PEM A;  2BHV A;  1YIJ P;  4BPH A;  2N6Y A;  3CC4 P;  3CCM P;  3G6E P;  1K8A Q;  2X83 A;  2P9X A;  2AVA A;  3DS1 A;  2PEI A;  1QVF O;  2JB0 A;  2XGU A;  1VQ7 P;  2CG5 B;  3G71 P;  2KGF A;  1E6J P;  2KGC A;  2Z44 A;  5KP6 B;  1NJI Q;  3GZL A;  5F2K A;  2NO8 A;  4DG9 A;  2JBG A;  2PEJ A;  1L6N A;  1GXH A;  1YJN P;  2JGP A;  2JYG A;  1HY8 A;  1YIT P;  2EHT A;  2FQ0 A;  1KQS O;  2KOS A;  1AK4 C;  5BS1 A;  4QKO A;  3WBH A;  2L4B A;  1OR5 A;  2MF4 A;  1U7K A;  2GDY A;  5HV8 A;  2VLN A;  4J93 A;  2OTL P;  3DS2 A;  2X2D D;  2JO0 A;  2PXR C;  1KLP A;  4DGA C; 
#chains in the Genus database with same CATH homology
 2CWO A;  4QNB A;  2JYL A;  3I56 P;  4PH3 A;  2L6E A;  2PEK A;  1M1K Q;  1VQK P;  4INB A;  4DGA C;  5F2O A;  5HGL A;  1W2B O;  3G0V A;  3CD6 P;  2E1M A;  2M8L A;  3Q20 A;  2M8N A;  3CXC O;  3CPW O;  3G28 A;  4U0A A;  4LQW C;  3CCS P;  2BUO A;  3OW2 O;  1KD1 Q;  1BAJ A;  1VQN P;  1M6N A;  3VRL C;  2XGV A;  4IPY A;  3CME P;  3HYB A;  2M8P A;  2V4X A;  1M6E X;  1M9E C;  4M0I A;  1VQP P;  2DGY A;  1N8R Q;  1VQO P;  1IUQ A;  4PH1 A;  4B4N A;  1YJ9 P;  1VQ8 P;  1M74 A;  2QEX P;  1EIA A;  1Q82 Q;  2EFJ A;  4U0C A;  4E91 A;  3LRY A;  3DPH A;  3MGE A;  1KC8 Q;  4GR2 A;  2GON A;  3BP9 A;  1K9M Q;  2GOL B;  3DS3 A;  5F2N A;  1A43 A;  4XRQ A;  1M9C C;  1RNI A;  1M9X C;  1VQ6 P;  2OAR A;  3CCQ P;  2EIA A;  4PH2 A;  4U0E A;  1EOQ A;  1Q81 Q;  1QVG O;  1RO0 A;  1EM9 A;  4COC A;  3P05 A;  1Q7Y Q;  2PEM A;  2BHV A;  4WYM A;  1YIJ P;  3CC4 P;  2XGY A;  2XDE A;  3CCM P;  3NTE A;  3G29 A;  3G6E P;  1K8A Q;  2X83 A;  4U0B A;  5DCK A;  2XXM A;  2P9X A;  3CC2 P;  3DS1 A;  1A8O A;  1GWP A;  2PWM A;  2PEI A;  4XRO A;  2Z46 A;  3CMA P;  2QA4 P;  1M9F C;  1VQL P;  1QVF O;  2Y4Z A;  3G4S P;  2ONT A;  1S72 P;  3H4E A;  1VQ9 P;  2EG5 A;  3HZQ A;  1VQ4 P;  2Z45 A;  1M90 Q;  4DGE C;  3CCR P;  1Q86 Q;  2XGU A;  1VQ7 P;  3G71 P;  2X82 A;  5HGK A;  2KGF A;  3G1G A;  4GR6 A;  2PY8 A;  3E2D A;  4XFX A;  1E6J P;  3CC7 P;  1D1D A;  2Z44 A;  3CCE P;  2JPR A;  2LF4 A;  1AUM A;  1NJI Q;  4XFY A;  3G26 A;  5F2K A;  1VQM P;  2KOD A;  3CCJ P;  3I55 P;  1K30 A;  1M9D C;  2XT1 A;  3H0D A;  1P7N A;  4U0F A;  1ZMB A;  1RO2 A;  2WLV A;  1QRJ A;  2PEQ A;  2WLV B;  2PEJ A;  3CCU P;  1L6N A;  1YI2 P;  1YJN P;  3CCV P;  4PH0 A;  4NX4 C;  3H47 A;  3G21 A;  1YHQ P;  3DS4 A;  2JYG A;  1YIT P;  1AFV A;  1YJW P;  3RG6 C;  3DS5 A;  1K73 Q;  1KQS O;  2XV6 A;  3B5I A;  4XFZ A;  3CCL P;  5I4T G;  5JPA A;  1AK4 C;  2PEO A;  5BS1 A;  3G1I A;  3WBH A;  3DTJ A;  3M1M A;  4HTW A;  5HGM A;  1G03 A;  1U7K A;  2PWO A;  5BS2 A;  1M9Y C;  2OTJ P;  4J93 A;  2PEN A;  2OTL P;  3DS2 A;  4U0D A;  4COP A;  1VQ5 P;  1JJ2 O;  2X2D D;  2JO0 A;  3DS0 A;  2PXR C;  4E92 A;  5HGO A;  5HGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...