3H4EA

X-ray structure of hexameric hiv-1 ca
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
218
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQENAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of the hexameric building block of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 77
structure length 218
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3h4eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3h4eA02
1EOQA 2X2DD 4INBA 1AFVA 2PWOA 4PH3A 5HGNA 4PH0A 1EM9A 3H47A 5HGLA 1EIAA 2JPRA 4J93A 2WLVA 1AK4C 2PWMA 2XGUA 3G1GA 3DS2A 1A43A 4XFXA 2KODA 3VRLC 3MGEA 2Y4ZA 4U0BA 4DGAC 4XFYA 3G29A 4QNBA 1M9XC 4COPA 2X83A 5HGKA 2L6EA 1M9CC 3DS4A 2XT1A 4U0EA 2V4XA 3G21A 1E6JP 2KGFA 4B4NA 5HGOA 2XXMA 3H4EA 2BUOA 4U0AA 2GOLB 4U0CA 1M9DC 4NX4C 5JPAA 3P05A 4U0FA 3NTEA 2M8PA 4PH2A 4M0IA 2XGVA 1GWPA 2WLVB 4PH1A 4WYMA 4E92A 4LQWC 2XGYA 2JO0A 4XROA 1U7KA 3BP9A 4IPYA 1D1DA 2XDEA 4U0DA 5HGMA 1QRJA 4DGEC 2XV6A 3DTJA 4XFZA 3DS1A 3G28A 4COCA 4HTWA 1P7NA 3DS5A 1L6NA 2M8NA 1AUMA 3DPHA 4E91A 5DCKA 4XRQA 3G0VA 1A8OA 3DS0A 2LF4A 5I4TG 2JYGA 3G26A 1M9YC 2ONTA 2EIAA 1BAJA 1G03A 2GONA 1M9FC 2M8LA 3DS3A 2X82A 3G1IA 1M9EC 2PXRC 3LRYA 2JYLA
chains in the Genus database with same CATH superfamily
1EOQA 2VLOA 3CC7P 1AFVA 3NY7B 3I56P 4PXHB 1EM9A 3HZQA 2KG6A 4HKGA 2JPRA 2AVAA 2FADA 3RG6C 7CEIA 2CG5B 2WLVA 1AK4C 2PWMA 3CCQP 2KODA 2KWLA 3HYBA 3MGEA 2Y4ZA 4U0BA 2KGDA 1M9XC 3CCJP 5HV8A 2K0DX 2P9XA 2KGFA 2LIUA 4PWVB 5HGOA 2PENA 3H4EA 3CC2P 1AYIA 5F2KA 2BUOA 2LKIA 2KOPA 4BPGA 1Q86Q 2N5HA 1VQ7P 2XGVA 5KP8B 1GWPA 2MF4A 2WLVB 4R0MA 1U7KA 2PY8A 2Z44A 2JQ4A 3CCLP 2XDEA 1QRJA 1N8RQ 1M6NA 1HY8A 1L0HA 2ERHA 1YI2P 3GZLA 2MR8A 1VQ8P 3CPWO 3DS1A 2EHTA 2L0QA 1IMPA 3DPHA 1IMQA 2K94A 2LL8A 3G0VA 2LF4A 5I4TG 1JJ2O 2KG9A 2AF8A 2EIAA 1E0HA 2FQ1A 1KQSO 2KOSA 5BS1A 2GONA 1M9FC 2X82A 3G28A 3LRYA 5BS2A 2JYLA 1Q81Q 2FHSC 4INBA 4CA3A 1Q7YQ 4PH3A 1M1KQ 5HGLA 2JBGA 2Z46A 3EJEA 2MR7A 3CCSP 3G1GA 1VQLP 2GZIA 3DS2A 3CCEP 1F80D 2CGQA 1L0IA 4DGAC 2L22A 3G29A 4COPA 3GKLC 2JGPA 5HGKA 1K30A 3CMAP 2L6EA 2QNWA 1M9CC 3CCRP 3LMOA 1KC8Q 1VQ4P 2PEIA 1DNYA 2V4XA 3G21A 4NEOA 2QEXP 1E6JP 2ROQA 2FAEA 1M90Q 2XXMA 4U0AA 2GOLB 1AF8A 4U0CA 1BXIA 2VLNA 2E1MA 1VHNA 3NTEA 4M0IA 2M5RA 2GZFA 1T8KA 1VQMP 4PH1A 2FVEA 2XGYA 3M1MA 2JU1A 2JO0A 2X2BA 4XROA 2N6ZA 2XV6A 2DGYA 2LMLA 2N50A 1NJIQ 1VQKP 3CCMP 1UJZA 2FVAA 1P7NA 2BHVA 1VKUA 2M8NA 1CEIA 4BPFA 2CNRA 2XZ1C 4GR6A 3B4QA 1UNKA 2ONTA 3G71P 2GDYA 2GZEA 3DS3A 1GPJA 3G1IA 1M9EC 1YJNP 2X2DD 4H2YC 2VLQA 2PWOA 1KD1Q 4PH0A 3H47A 4GR2A 1VQPP 1GXGA 1YIJP 3CMEP 2GZJA 4J93A 3OW2O 3CCVP 1A43A 2EHSA 4XFXA 1Z6MA 4XFYA 1ACPA 3CCUP 2FVFA 2EFJA 1W2BO 2CWOA 4U0EA 2JAZA 2K0YA 2PEKA 3WBHA 1EMVA 2DNWA 2JU2A 1VQ9P 1M9DC 3U43A 2JB0A 1M74A 1M6EX 2K93A 2MVUA 2K2QA 3B5IA 2GZGA 2GDWA 4MRTC 1NQ4A 4E92A 2VLPA 2GYKA 1K73Q 5EW5E 2CQ8A 4IPYA 2FQ0A 3G4SP 1YJWP 2LPKA 2WPTA 3DTJA 4F37A 2OTLP 1RO0A 4XFZA 4COCA 4HTWA 3EJDA 2XZ0D 1L6NA 1VQ6P 1YHQP 4E91A 1OR5A 2EG5A 1RNIA 1A8OA 3DS0A 3G6EP 2MY5A 1Q82Q 2KOOA 2KORA 3G26A 1MZ8A 2KG8A 2LOLA 1BAJA 3H0DA 1G03A 2OTJP 2M8LA 1YITP 4UHPB 3EJBA 2PXRC 5F2OA 3Q20A 2LIWA 2PEQA 5HGNA 1ZNVA 2L4BA 5EJDA 1VQNP 2KW2A 5CZDB 2KGCA 1EIAA 2AFEA 1DV5A 1VQOP 2K0XA 2PEOA 3CE7A 2XGUA 2FQ2A 2KGAA 5KP7B 5KP6B 1HQBA 3VRLC 4DG9A 4QNBA 2FACA 2LTEA 1QVGO 1S72P 2X83A 3RG2A 2GDXA 3DS4A 2XT1A 4QKOA 1RO2A 1K8AQ 4B4NA 2OARA 2QA4P 3E2DA 3CC4P 1ZMBA 2L9FA 4NX4C 5JPAA 3P05A 4U0FA 2M8PA 4PH2A 1X3OA 2KR5A 2NO8A 1QVFO 2VSQA 4IZ6A 4WYMA 2MVVA 4LQWC 1GXHA 1KLPA 3BP9A 1D1DA 4U0DA 5HGMA 2N98A 2AFDA 2KOQA 4DGEC 2PEMA 1K9MQ 2N5IA 4H2XC 2Z45A 1FR2A 2PNGA 1YJ9P 3DS5A 3CXCO 5F2NA 1AUMA 1IUQA 2MD9A 5DCKA 4XRQA 4H2WC 3GZMA 1VQ5P 2JYGA 5HVCA 2KGEA 3I55P 1M9YC 4BPHA 3GJNA 2PEJA 2N6YA 3CD6P 2K5XA 2K92A
chains in the Genus database with same CATH topology
1EOQA 5F2OA 3CC7P 1YJNP 2X2DD 4INBA 3Q20A 1AFVA 2PEQA 3I56P 1Q7YQ 2PWOA 4PH3A 5HGNA 1M1KQ 1KD1Q 1VQNP 4PH0A 1EM9A 3H47A 5HGLA 3HZQA 2Z46A 4GR2A 1VQPP 1YIJP 3CMEP 1EIAA 2JPRA 3CCSP 3RG6C 4J93A 1VQOP 2PEOA 3OW2O 2WLVA 1AK4C 2PWMA 2XGUA 3G1GA 3DS2A 3CCVP 1A43A 3CCQP 1VQLP 3CCEP 4XFXA 2KODA 3HYBA 3VRLC 3MGEA 2Y4ZA 4U0BA 4DGAC 4XFYA 3G29A 4QNBA 1M9XC 3CCJP 1QVGO 4COPA 1S72P 3CCUP 2X83A 5HGKA 2EFJA 1K30A 3CMAP 2L6EA 1W2BO 1M9CC 2CWOA 3CCRP 1KC8Q 3DS4A 1VQ4P 2PEIA 2P9XA 2XT1A 4U0EA 1RO2A 2PEKA 1K8AQ 2V4XA 3G21A 2QEXP 1E6JP 3WBHA 2KGFA 4B4NA 5HGOA 5BS2A 1M90Q 2PENA 2XXMA 3H4EA 3CC2P 5F2KA 2BUOA 4U0AA 2OARA 2GOLB 4U0CA 2QA4P 1VQ9P 3E2DA 1M9DC 1Q86Q 3CC4P 1ZMBA 4NX4C 2E1MA 5JPAA 3P05A 1M74A 1M6EX 4U0FA 3NTEA 2M8PA 4PH2A 4M0IA 1VQ7P 2XGVA 1QVFO 3B5IA 1GWPA 1VQMP 2WLVB 4PH1A 4WYMA 4E92A 4LQWC 2XGYA 1K73Q 3M1MA 2JO0A 4XROA 1U7KA 2PY8A 3BP9A 2Z44A 1D1DA 4IPYA 2XDEA 4U0DA 3CCLP 5HGMA 3G4SP 1YJWP 1QRJA 4DGEC 2XV6A 1N8RQ 2PEMA 1K9MQ 3DTJA 2DGYA 2OTLP 1M6NA 2Z45A 1RO0A 1NJIQ 1VQKP 3CCMP 1YI2P 4XFZA 1VQ8P 1YJ9P 3CPWO 3DS1A 3G28A 4COCA 4HTWA 1P7NA 1Q81Q 2BHVA 3DS5A 3CXCO 1L6NA 2M8NA 1AUMA 5F2NA 1VQ6P 1IUQA 3DPHA 1YHQP 4GR6A 4E91A 5DCKA 4XRQA 2EG5A 1RNIA 3G0VA 1A8OA 3DS0A 2LF4A 3G6EP 5I4TG 1JJ2O 1VQ5P 2JYGA 1Q82Q 3I55P 3G26A 1M9YC 2ONTA 2EIAA 1BAJA 3G71P 2PEJA 3H0DA 1KQSO 1G03A 5BS1A 3CD6P 2OTJP 2GONA 1M9FC 2M8LA 3DS3A 1YITP 2X82A 3G1IA 1M9EC 2PXRC 3LRYA 2JYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOQ A;  2X2D D;  4INB A;  1AFV A;  2PWO A;  4PH3 A;  5HGN A;  4PH0 A;  1EM9 A;  3H47 A;  5HGL A;  1EIA A;  2JPR A;  4J93 A;  2WLV A;  1AK4 C;  2PWM A;  2XGU A;  3G1G A;  3DS2 A;  1A43 A;  4XFX A;  2KOD A;  3VRL C;  3MGE A;  2Y4Z A;  4U0B A;  4DGA C;  4XFY A;  3G29 A;  4QNB A;  1M9X C;  4COP A;  2X83 A;  5HGK A;  2L6E A;  1M9C C;  3DS4 A;  2XT1 A;  4U0E A;  2V4X A;  3G21 A;  1E6J P;  2KGF A;  4B4N A;  5HGO A;  2XXM A;  3H4E A;  2BUO A;  4U0A A;  2GOL B;  4U0C A;  1M9D C;  4NX4 C;  5JPA A;  3P05 A;  4U0F A;  3NTE A;  2M8P A;  4PH2 A;  4M0I A;  2XGV A;  1GWP A;  2WLV B;  4PH1 A;  4WYM A;  4E92 A;  4LQW C;  2XGY A;  2JO0 A;  4XRO A;  1U7K A;  3BP9 A;  4IPY A;  1D1D A;  2XDE A;  4U0D A;  5HGM A;  1QRJ A;  4DGE C;  2XV6 A;  3DTJ A;  4XFZ A;  3DS1 A;  3G28 A;  4COC A;  4HTW A;  1P7N A;  3DS5 A;  1L6N A;  2M8N A;  1AUM A;  3DPH A;  4E91 A;  5DCK A;  4XRQ A;  3G0V A;  1A8O A;  3DS0 A;  2LF4 A;  5I4T G;  2JYG A;  3G26 A;  1M9Y C;  2ONT A;  2EIA A;  1BAJ A;  1G03 A;  2GON A;  1M9F C;  2M8L A;  3DS3 A;  2X82 A;  3G1I A;  1M9E C;  2PXR C;  3LRY A;  2JYL A; 
#chains in the Genus database with same CATH topology
 1EOQ A;  2VLO A;  3CC7 P;  1AFV A;  3NY7 B;  3I56 P;  4PXH B;  1EM9 A;  3HZQ A;  2KG6 A;  4HKG A;  2JPR A;  2AVA A;  2FAD A;  3RG6 C;  7CEI A;  2CG5 B;  2WLV A;  1AK4 C;  2PWM A;  3CCQ P;  2KOD A;  2KWL A;  3HYB A;  3MGE A;  2Y4Z A;  4U0B A;  2KGD A;  1M9X C;  3CCJ P;  5HV8 A;  2K0D X;  2P9X A;  2KGF A;  2LIU A;  4PWV B;  5HGO A;  2PEN A;  3H4E A;  3CC2 P;  1AYI A;  5F2K A;  2BUO A;  2LKI A;  2KOP A;  4BPG A;  1Q86 Q;  2N5H A;  1VQ7 P;  2XGV A;  5KP8 B;  1GWP A;  2MF4 A;  2WLV B;  4R0M A;  1U7K A;  2PY8 A;  2Z44 A;  2JQ4 A;  3CCL P;  2XDE A;  1QRJ A;  1N8R Q;  1M6N A;  1HY8 A;  1L0H A;  2ERH A;  1YI2 P;  3GZL A;  2MR8 A;  1VQ8 P;  3CPW O;  3DS1 A;  2EHT A;  2L0Q A;  1IMP A;  3DPH A;  1IMQ A;  2K94 A;  2LL8 A;  3G0V A;  2LF4 A;  5I4T G;  1JJ2 O;  2KG9 A;  2AF8 A;  2EIA A;  1E0H A;  2FQ1 A;  1KQS O;  2KOS A;  5BS1 A;  2GON A;  1M9F C;  2X82 A;  3G28 A;  3LRY A;  5BS2 A;  2JYL A;  1Q81 Q;  2FHS C;  4INB A;  4CA3 A;  1Q7Y Q;  4PH3 A;  1M1K Q;  5HGL A;  2JBG A;  2Z46 A;  3EJE A;  2MR7 A;  3CCS P;  3G1G A;  1VQL P;  2GZI A;  3DS2 A;  3CCE P;  1F80 D;  2CGQ A;  1L0I A;  4DGA C;  2L22 A;  3G29 A;  4COP A;  3GKL C;  2JGP A;  5HGK A;  1K30 A;  3CMA P;  2L6E A;  2QNW A;  1M9C C;  3CCR P;  3LMO A;  1KC8 Q;  1VQ4 P;  2PEI A;  1DNY A;  2V4X A;  3G21 A;  4NEO A;  2QEX P;  1E6J P;  2ROQ A;  2FAE A;  1M90 Q;  2XXM A;  4U0A A;  2GOL B;  1AF8 A;  4U0C A;  1BXI A;  2VLN A;  2E1M A;  1VHN A;  3NTE A;  4M0I A;  2M5R A;  2GZF A;  1T8K A;  1VQM P;  4PH1 A;  2FVE A;  2XGY A;  3M1M A;  2JU1 A;  2JO0 A;  2X2B A;  4XRO A;  2N6Z A;  2XV6 A;  2DGY A;  2LML A;  2N50 A;  1NJI Q;  1VQK P;  3CCM P;  1UJZ A;  2FVA A;  1P7N A;  2BHV A;  1VKU A;  2M8N A;  1CEI A;  4BPF A;  2CNR A;  2XZ1 C;  4GR6 A;  3B4Q A;  1UNK A;  2ONT A;  3G71 P;  2GDY A;  2GZE A;  3DS3 A;  1GPJ A;  3G1I A;  1M9E C;  1YJN P;  2X2D D;  4H2Y C;  2VLQ A;  2PWO A;  1KD1 Q;  4PH0 A;  3H47 A;  4GR2 A;  1VQP P;  1GXG A;  1YIJ P;  3CME P;  2GZJ A;  4J93 A;  3OW2 O;  3CCV P;  1A43 A;  2EHS A;  4XFX A;  1Z6M A;  4XFY A;  1ACP A;  3CCU P;  2FVF A;  2EFJ A;  1W2B O;  2CWO A;  4U0E A;  2JAZ A;  2K0Y A;  2PEK A;  3WBH A;  1EMV A;  2DNW A;  2JU2 A;  1VQ9 P;  1M9D C;  3U43 A;  2JB0 A;  1M74 A;  1M6E X;  2K93 A;  2MVU A;  2K2Q A;  3B5I A;  2GZG A;  2GDW A;  4MRT C;  1NQ4 A;  4E92 A;  2VLP A;  2GYK A;  1K73 Q;  5EW5 E;  2CQ8 A;  4IPY A;  2FQ0 A;  3G4S P;  1YJW P;  2LPK A;  2WPT A;  3DTJ A;  4F37 A;  2OTL P;  1RO0 A;  4XFZ A;  4COC A;  4HTW A;  3EJD A;  2XZ0 D;  1L6N A;  1VQ6 P;  1YHQ P;  4E91 A;  1OR5 A;  2EG5 A;  1RNI A;  1A8O A;  3DS0 A;  3G6E P;  2MY5 A;  1Q82 Q;  2KOO A;  2KOR A;  3G26 A;  1MZ8 A;  2KG8 A;  2LOL A;  1BAJ A;  3H0D A;  1G03 A;  2OTJ P;  2M8L A;  1YIT P;  4UHP B;  3EJB A;  2PXR C;  5F2O A;  3Q20 A;  2LIW A;  2PEQ A;  5HGN A;  1ZNV A;  2L4B A;  5EJD A;  1VQN P;  2KW2 A;  5CZD B;  2KGC A;  1EIA A;  2AFE A;  1DV5 A;  1VQO P;  2K0X A;  2PEO A;  3CE7 A;  2XGU A;  2FQ2 A;  2KGA A;  5KP7 B;  5KP6 B;  1HQB A;  3VRL C;  4DG9 A;  4QNB A;  2FAC A;  2LTE A;  1QVG O;  1S72 P;  2X83 A;  3RG2 A;  2GDX A;  3DS4 A;  2XT1 A;  4QKO A;  1RO2 A;  1K8A Q;  4B4N A;  2OAR A;  2QA4 P;  3E2D A;  3CC4 P;  1ZMB A;  2L9F A;  4NX4 C;  5JPA A;  3P05 A;  4U0F A;  2M8P A;  4PH2 A;  1X3O A;  2KR5 A;  2NO8 A;  1QVF O;  2VSQ A;  4IZ6 A;  4WYM A;  2MVV A;  4LQW C;  1GXH A;  1KLP A;  3BP9 A;  1D1D A;  4U0D A;  5HGM A;  2N98 A;  2AFD A;  2KOQ A;  4DGE C;  2PEM A;  1K9M Q;  2N5I A;  4H2X C;  2Z45 A;  1FR2 A;  2PNG A;  1YJ9 P;  3DS5 A;  3CXC O;  5F2N A;  1AUM A;  1IUQ A;  2MD9 A;  5DCK A;  4XRQ A;  4H2W C;  3GZM A;  1VQ5 P;  2JYG A;  5HVC A;  2KGE A;  3I55 P;  1M9Y C;  4BPH A;  3GJN A;  2PEJ A;  2N6Y A;  3CD6 P;  2K5X A;  2K92 A; 
#chains in the Genus database with same CATH homology
 1EOQ A;  5F2O A;  3CC7 P;  1YJN P;  2X2D D;  4INB A;  3Q20 A;  1AFV A;  2PEQ A;  3I56 P;  1Q7Y Q;  2PWO A;  4PH3 A;  5HGN A;  1M1K Q;  1KD1 Q;  1VQN P;  4PH0 A;  1EM9 A;  3H47 A;  5HGL A;  3HZQ A;  2Z46 A;  4GR2 A;  1VQP P;  1YIJ P;  3CME P;  1EIA A;  2JPR A;  3CCS P;  3RG6 C;  4J93 A;  1VQO P;  2PEO A;  3OW2 O;  2WLV A;  1AK4 C;  2PWM A;  2XGU A;  3G1G A;  3DS2 A;  3CCV P;  1A43 A;  3CCQ P;  1VQL P;  3CCE P;  4XFX A;  2KOD A;  3HYB A;  3VRL C;  3MGE A;  2Y4Z A;  4U0B A;  4DGA C;  4XFY A;  3G29 A;  4QNB A;  1M9X C;  3CCJ P;  1QVG O;  4COP A;  1S72 P;  3CCU P;  2X83 A;  5HGK A;  2EFJ A;  1K30 A;  3CMA P;  2L6E A;  1W2B O;  1M9C C;  2CWO A;  3CCR P;  1KC8 Q;  3DS4 A;  1VQ4 P;  2PEI A;  2P9X A;  2XT1 A;  4U0E A;  1RO2 A;  2PEK A;  1K8A Q;  2V4X A;  3G21 A;  2QEX P;  1E6J P;  3WBH A;  2KGF A;  4B4N A;  5HGO A;  5BS2 A;  1M90 Q;  2PEN A;  2XXM A;  3H4E A;  3CC2 P;  5F2K A;  2BUO A;  4U0A A;  2OAR A;  2GOL B;  4U0C A;  2QA4 P;  1VQ9 P;  3E2D A;  1M9D C;  1Q86 Q;  3CC4 P;  1ZMB A;  4NX4 C;  2E1M A;  5JPA A;  3P05 A;  1M74 A;  1M6E X;  4U0F A;  3NTE A;  2M8P A;  4PH2 A;  4M0I A;  1VQ7 P;  2XGV A;  1QVF O;  3B5I A;  1GWP A;  1VQM P;  2WLV B;  4PH1 A;  4WYM A;  4E92 A;  4LQW C;  2XGY A;  1K73 Q;  3M1M A;  2JO0 A;  4XRO A;  1U7K A;  2PY8 A;  3BP9 A;  2Z44 A;  1D1D A;  4IPY A;  2XDE A;  4U0D A;  3CCL P;  5HGM A;  3G4S P;  1YJW P;  1QRJ A;  4DGE C;  2XV6 A;  1N8R Q;  2PEM A;  1K9M Q;  3DTJ A;  2DGY A;  2OTL P;  1M6N A;  2Z45 A;  1RO0 A;  1NJI Q;  1VQK P;  3CCM P;  1YI2 P;  4XFZ A;  1VQ8 P;  1YJ9 P;  3CPW O;  3DS1 A;  3G28 A;  4COC A;  4HTW A;  1P7N A;  1Q81 Q;  2BHV A;  3DS5 A;  3CXC O;  1L6N A;  2M8N A;  1AUM A;  5F2N A;  1VQ6 P;  1IUQ A;  3DPH A;  1YHQ P;  4GR6 A;  4E91 A;  5DCK A;  4XRQ A;  2EG5 A;  1RNI A;  3G0V A;  1A8O A;  3DS0 A;  2LF4 A;  3G6E P;  5I4T G;  1JJ2 O;  1VQ5 P;  2JYG A;  1Q82 Q;  3I55 P;  3G26 A;  1M9Y C;  2ONT A;  2EIA A;  1BAJ A;  3G71 P;  2PEJ A;  3H0D A;  1KQS O;  1G03 A;  5BS1 A;  3CD6 P;  2OTJ P;  2GON A;  1M9F C;  2M8L A;  3DS3 A;  1YIT P;  2X82 A;  3G1I A;  1M9E C;  2PXR C;  3LRY A;  2JYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...