3H4EA

X-ray structure of hexameric hiv-1 ca
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
218
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQENAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray structures of the hexameric building block of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 77
structure length 218
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3h4eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3h4eA02
2M8PA 2M8NA 1BAJA 4E92A 3G21A 2XGUA 1M9DC 2XV6A 1AUMA 4LQWC 3DTJA 1A8OA 2GOLB 1M9EC 5HGLA 4DGAC 3H4EA 2X82A 5HGOA 3G1IA 3H47A 3G0VA 1M9XC 3DS4A 3BP9A 1G03A 3G28A 4IPYA 4PH3A 2KODA 3G26A 5DCKA 4PH0A 1EIAA 1EOQA 2JYLA 4U0FA 1L6NA 3DS1A 4HTWA 2PWOA 4QNBA 2KGFA 4U0DA 4DGEC 2JO0A 4PH2A 2XGYA 4XRQA 4U0EA 4PH1A 1AK4C 4WYMA 4XFYA 5HGNA 1QRJA 2JYGA 4U0AA 2BUOA 2PXRC 4COCA 2EIAA 1A43A 2XGVA 3DS2A 2XT1A 2WLVA 4E91A 3DS3A 1D1DA 1AFVA 2ONTA 4M0IA 3DS0A 1P7NA 4J93A 4COPA 4U0BA 2GONA 2WLVB 1M9FC 1U7KA 5HGMA 2Y4ZA 2PWMA 4XFXA 4INBA 1M9YC 1E6JP 3P05A 2L6EA 2M8LA 4U0CA 3DPHA 2JPRA 4XROA 3MGEA 4NX4C 2LF4A 5HGKA 4XFZA 2XXMA 3LRYA 5JPAA 3G29A 2X2DD 3VRLC 1M9CC 5I4TG 2X83A 1GWPA 2V4XA 2XDEA 3G1GA 1EM9A 3NTEA 4B4NA 3DS5A
chains in the Genus database with same CATH superfamily
2MVVA 2KGCA 2M8PA 2M8NA 3B4QA 1L0IA 5F2OA 2XV6A 4LQWC 1YJNP 1RNIA 2EHTA 4DGAC 2K92A 3H4EA 2X82A 3G1IA 3EJEA 3G71P 2L4BA 1HY8A 1RO2A 4PH3A 2KODA 1Q82Q 1KC8Q 2OTLP 4U0FA 2AVAA 1VQ4P 1M74A 4HTWA 1ACPA 2PWOA 2WPTA 2CGQA 1M90Q 2K0DX 1M6EX 4PH2A 2GYKA 1X3OA 3B5IA 2L22A 1YI2P 2E1MA 1K30A 1QRJA 2OTJP 2PXRC 2FVAA 2FVFA 2EIAA 1VQPP 2LKIA 3CC4P 4E91A 2AFDA 5KP8B 4UHPB 5KP7B 1GPJA 3DS0A 1P7NA 4H2WC 2AF8A 1N8RQ 1L0HA 1M9FC 1MZ8A 5HGMA 2Y4ZA 2PWMA 2GZEA 4INBA 1M9YC 4BPGA 7CEIA 2M8LA 3CCSP 2FAEA 1VQLP 1KQSO 3CCMP 3CCLP 2MF4A 1VQ7P 2XXMA 3G29A 1Z6MA 2MR8A 2XZ0D 2DNWA 2KGEA 2MVUA 2JB0A 1EMVA 2K5XA 4PWVB 2PEKA 2FVEA 1YITP 5EW5E 1YHQP 2KGDA 3G21A 2FQ2A 2P9XA 1M9DC 1YJ9P 2PEIA 2VLNA 2FQ0A 4IZ6A 3E2DA 4DG9A 2CNRA 3GJNA 4QKOA 2KG9A 3EJDA 2N6ZA 3G0VA 2PEMA 3G28A 3CCEP 3G26A 5DCKA 2KORA 3HZQA 3DS1A 1IMQA 1T8KA 1QVFO 4QNBA 4DGEC 2JO0A 2KG6A 1M1KQ 5F2KA 3I56P 3CPWO 4WYMA 4XFYA 1VQOP 4HKGA 2VLOA 2GDWA 4COCA 2KWLA 2XGVA 4R0MA 2XT1A 3CCVP 2WLVA 3DS3A 1D1DA 1AFVA 2JBGA 1E0HA 2JQ4A 5F2NA 3CXCO 3CMAP 2WLVB 2LTEA 1K9MQ 3P05A 3GZMA 3NY7B 2JPRA 2FHSC 2GZFA 2PEQA 1Q7YQ 3HYBA 4NX4C 3H0DA 2KGAA 2FQ1A 3CMEP 1GXHA 5JPAA 2PNGA 2PY8A 3EJBA 1M9CC 3U43A 2X83A 3M1MA 1ZNVA 3G1GA 4BPHA 2MD9A 2OARA 1EM9A 4BPFA 2DGYA 4B4NA 1AF8A 5KP6B 1JJ2O 3CCUP 2KOQA 1VQ6P 4E92A 1BXIA 4GR6A 2XGUA 5HVCA 3CCRP 4H2YC 3G6EP 1A8OA 1VQ5P 2GOLB 1VKUA 2EFJA 5HGOA 2CG5B 2FACA 5CZDB 1RO0A 2VSQA 3DS4A 4MRTC 2QA4P 1QVGO 2GZJA 2KOSA 4PH0A 1EIAA 1EOQA 3G4SP 5EJDA 2GZGA 2LMLA 3CC2P 1K8AQ 2MR7A 3GZLA 4U0DA 4PXHB 2NO8A 2M5RA 2PEOA 3CC7P 2XGYA 4XRQA 2PENA 2MY5A 1S72P 1Q86Q 2ROQA 2K94A 4U0EA 4PH1A 1AK4C 2EHSA 2LL8A 2LOLA 2BUOA 2KR5A 1NJIQ 2KG8A 2N6YA 2ERHA 1VQ9P 1GXGA 3DS2A 3GKLC 3RG2A 1M6NA 4M0IA 3RG6C 1VQ8P 2KW2A 4COPA 3CD6P 2JAZA 1VQKP 1YJWP 2GONA 1U7KA 4XFXA 2L9FA 1E6JP 1AYIA 2CQ8A 4U0CA 3DPHA 4XROA 3MGEA 2LPKA 4NEOA 2KOPA 1VQMP 3CE7A 2GDYA 2VLPA 2LIUA 2X2DD 3WBHA 1F80D 2JGPA 3CCJP 1DNYA 2XDEA 3OW2O 3DS5A 1IUQA 2XZ1C 1BAJA 2N98A 2QEXP 2N50A 2Z46A 4H2XC 1AUMA 1K73Q 2K93A 2JU2A 3DTJA 1NQ4A 1M9EC 2L0QA 2EG5A 5HGLA 1UJZA 3H47A 1M9XC 1CEIA 2FADA 3BP9A 1G03A 1VHNA 2QNWA 4IPYA 1IMPA 2AFEA 3I55P 1UNKA 2JYLA 2N5IA 1KD1Q 1L6NA 2JU1A 2X2BA 1ZMBA 2K0XA 2KGFA 5BS2A 1YIJP 5BS1A 5HGNA 1VQNP 2JYGA 4U0AA 1FR2A 1A43A 2PEJA 2K0YA 2ONTA 2GDXA 4J93A 3Q20A 4U0BA 4F37A 1KLPA 2N5HA 2GZIA 2L6EA 1Q81Q 1HQBA 4CA3A 2LF4A 1DV5A 5HV8A 5HGKA 4XFZA 2K2QA 3CCQP 2KOOA 3LRYA 2BHVA 2VLQA 2Z44A 3LMOA 4GR2A 3VRLC 5I4TG 1W2BO 2Z45A 1GWPA 2V4XA 1OR5A 3NTEA 2LIWA 2CWOA
chains in the Genus database with same CATH topology
2PEKA 1JJ2O 1YITP 1IUQA 2M8PA 2M8NA 1YHQP 3CCUP 1BAJA 2QEXP 1VQ6P 4E92A 3G21A 4GR6A 2XGUA 2P9XA 1M9DC 2Z46A 5F2OA 2XV6A 3CCRP 1AUMA 1K73Q 1YJ9P 4LQWC 2PEIA 3DTJA 3G6EP 1A8OA 1VQ5P 2GOLB 1M9EC 3E2DA 2EFJA 1YJNP 1RNIA 2EG5A 5HGLA 4DGAC 3H4EA 2X82A 5HGOA 3G1IA 3H47A 1RO0A 3G0VA 1M9XC 3DS4A 3BP9A 1G03A 2PEMA 3G71P 3G28A 2QA4P 4IPYA 1RO2A 1QVGO 3CCEP 3I55P 4PH3A 2KODA 3G26A 5DCKA 1Q82Q 1KC8Q 4PH0A 1EIAA 2OTLP 1EOQA 2JYLA 1KD1Q 4U0FA 3G4SP 3HZQA 1VQ4P 1L6NA 1M74A 3DS1A 4HTWA 2PWOA 3CC2P 1K8AQ 1QVFO 1M90Q 4QNBA 1ZMBA 2KGFA 4U0DA 1M6EX 4DGEC 2JO0A 4PH2A 2PEOA 3B5IA 1M1KQ 3CC7P 5F2KA 2XGYA 4XRQA 2PENA 3I56P 5BS2A 1S72P 1Q86Q 3CPWO 1YIJP 5BS1A 1YI2P 4U0EA 4PH1A 1AK4C 4WYMA 4XFYA 2E1MA 5HGNA 1QRJA 1K30A 1VQOP 1VQNP 2JYGA 4U0AA 2BUOA 2OTJP 2PXRC 4COCA 1NJIQ 2EIAA 1A43A 1VQPP 2XGVA 1VQ9P 3DS2A 2PEJA 2XT1A 3CCVP 3CC4P 2WLVA 4E91A 3DS3A 1D1DA 1AFVA 2ONTA 1M6NA 4M0IA 3RG6C 3DS0A 1P7NA 1VQ8P 4J93A 4COPA 3CD6P 3Q20A 5F2NA 4U0BA 3CXCO 3CMAP 1N8RQ 1VQKP 1YJWP 2GONA 2WLVB 1M9FC 1U7KA 5HGMA 1K9MQ 2Y4ZA 2PWMA 4XFXA 4INBA 1M9YC 1E6JP 3P05A 2L6EA 2M8LA 3CCSP 4U0CA 1Q81Q 3DPHA 2JPRA 4XROA 2PEQA 3MGEA 3HYBA 1Q7YQ 4NX4C 2LF4A 1VQLP 5HGKA 1KQSO 4XFZA 3H0DA 3CCMP 3CCQP 1VQMP 3CCLP 3CMEP 1VQ7P 2XXMA 3LRYA 2BHVA 5JPAA 3G29A 2X2DD 3WBHA 2Z44A 2PY8A 4GR2A 3VRLC 3CCJP 1M9CC 5I4TG 1W2BO 2X83A 3M1MA 2Z45A 1GWPA 2V4XA 2XDEA 3G1GA 3OW2O 2OARA 1EM9A 3NTEA 2DGYA 4B4NA 3DS5A 2CWOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8P A;  2M8N A;  1BAJ A;  4E92 A;  3G21 A;  2XGU A;  1M9D C;  2XV6 A;  1AUM A;  4LQW C;  3DTJ A;  1A8O A;  2GOL B;  1M9E C;  5HGL A;  4DGA C;  3H4E A;  2X82 A;  5HGO A;  3G1I A;  3H47 A;  3G0V A;  1M9X C;  3DS4 A;  3BP9 A;  1G03 A;  3G28 A;  4IPY A;  4PH3 A;  2KOD A;  3G26 A;  5DCK A;  4PH0 A;  1EIA A;  1EOQ A;  2JYL A;  4U0F A;  1L6N A;  3DS1 A;  4HTW A;  2PWO A;  4QNB A;  2KGF A;  4U0D A;  4DGE C;  2JO0 A;  4PH2 A;  2XGY A;  4XRQ A;  4U0E A;  4PH1 A;  1AK4 C;  4WYM A;  4XFY A;  5HGN A;  1QRJ A;  2JYG A;  4U0A A;  2BUO A;  2PXR C;  4COC A;  2EIA A;  1A43 A;  2XGV A;  3DS2 A;  2XT1 A;  2WLV A;  4E91 A;  3DS3 A;  1D1D A;  1AFV A;  2ONT A;  4M0I A;  3DS0 A;  1P7N A;  4J93 A;  4COP A;  4U0B A;  2GON A;  2WLV B;  1M9F C;  1U7K A;  5HGM A;  2Y4Z A;  2PWM A;  4XFX A;  4INB A;  1M9Y C;  1E6J P;  3P05 A;  2L6E A;  2M8L A;  4U0C A;  3DPH A;  2JPR A;  4XRO A;  3MGE A;  4NX4 C;  2LF4 A;  5HGK A;  4XFZ A;  2XXM A;  3LRY A;  5JPA A;  3G29 A;  2X2D D;  3VRL C;  1M9C C;  5I4T G;  2X83 A;  1GWP A;  2V4X A;  2XDE A;  3G1G A;  1EM9 A;  3NTE A;  4B4N A;  3DS5 A; 
#chains in the Genus database with same CATH topology
 2MVV A;  2KGC A;  2M8P A;  2M8N A;  3B4Q A;  1L0I A;  5F2O A;  2XV6 A;  4LQW C;  1YJN P;  1RNI A;  2EHT A;  4DGA C;  2K92 A;  3H4E A;  2X82 A;  3G1I A;  3EJE A;  3G71 P;  2L4B A;  1HY8 A;  1RO2 A;  4PH3 A;  2KOD A;  1Q82 Q;  1KC8 Q;  2OTL P;  4U0F A;  2AVA A;  1VQ4 P;  1M74 A;  4HTW A;  1ACP A;  2PWO A;  2WPT A;  2CGQ A;  1M90 Q;  2K0D X;  1M6E X;  4PH2 A;  2GYK A;  1X3O A;  3B5I A;  2L22 A;  1YI2 P;  2E1M A;  1K30 A;  1QRJ A;  2OTJ P;  2PXR C;  2FVA A;  2FVF A;  2EIA A;  1VQP P;  2LKI A;  3CC4 P;  4E91 A;  2AFD A;  5KP8 B;  4UHP B;  5KP7 B;  1GPJ A;  3DS0 A;  1P7N A;  4H2W C;  2AF8 A;  1N8R Q;  1L0H A;  1M9F C;  1MZ8 A;  5HGM A;  2Y4Z A;  2PWM A;  2GZE A;  4INB A;  1M9Y C;  4BPG A;  7CEI A;  2M8L A;  3CCS P;  2FAE A;  1VQL P;  1KQS O;  3CCM P;  3CCL P;  2MF4 A;  1VQ7 P;  2XXM A;  3G29 A;  1Z6M A;  2MR8 A;  2XZ0 D;  2DNW A;  2KGE A;  2MVU A;  2JB0 A;  1EMV A;  2K5X A;  4PWV B;  2PEK A;  2FVE A;  1YIT P;  5EW5 E;  1YHQ P;  2KGD A;  3G21 A;  2FQ2 A;  2P9X A;  1M9D C;  1YJ9 P;  2PEI A;  2VLN A;  2FQ0 A;  4IZ6 A;  3E2D A;  4DG9 A;  2CNR A;  3GJN A;  4QKO A;  2KG9 A;  3EJD A;  2N6Z A;  3G0V A;  2PEM A;  3G28 A;  3CCE P;  3G26 A;  5DCK A;  2KOR A;  3HZQ A;  3DS1 A;  1IMQ A;  1T8K A;  1QVF O;  4QNB A;  4DGE C;  2JO0 A;  2KG6 A;  1M1K Q;  5F2K A;  3I56 P;  3CPW O;  4WYM A;  4XFY A;  1VQO P;  4HKG A;  2VLO A;  2GDW A;  4COC A;  2KWL A;  2XGV A;  4R0M A;  2XT1 A;  3CCV P;  2WLV A;  3DS3 A;  1D1D A;  1AFV A;  2JBG A;  1E0H A;  2JQ4 A;  5F2N A;  3CXC O;  3CMA P;  2WLV B;  2LTE A;  1K9M Q;  3P05 A;  3GZM A;  3NY7 B;  2JPR A;  2FHS C;  2GZF A;  2PEQ A;  1Q7Y Q;  3HYB A;  4NX4 C;  3H0D A;  2KGA A;  2FQ1 A;  3CME P;  1GXH A;  5JPA A;  2PNG A;  2PY8 A;  3EJB A;  1M9C C;  3U43 A;  2X83 A;  3M1M A;  1ZNV A;  3G1G A;  4BPH A;  2MD9 A;  2OAR A;  1EM9 A;  4BPF A;  2DGY A;  4B4N A;  1AF8 A;  5KP6 B;  1JJ2 O;  3CCU P;  2KOQ A;  1VQ6 P;  4E92 A;  1BXI A;  4GR6 A;  2XGU A;  5HVC A;  3CCR P;  4H2Y C;  3G6E P;  1A8O A;  1VQ5 P;  2GOL B;  1VKU A;  2EFJ A;  5HGO A;  2CG5 B;  2FAC A;  5CZD B;  1RO0 A;  2VSQ A;  3DS4 A;  4MRT C;  2QA4 P;  1QVG O;  2GZJ A;  2KOS A;  4PH0 A;  1EIA A;  1EOQ A;  3G4S P;  5EJD A;  2GZG A;  2LML A;  3CC2 P;  1K8A Q;  2MR7 A;  3GZL A;  4U0D A;  4PXH B;  2NO8 A;  2M5R A;  2PEO A;  3CC7 P;  2XGY A;  4XRQ A;  2PEN A;  2MY5 A;  1S72 P;  1Q86 Q;  2ROQ A;  2K94 A;  4U0E A;  4PH1 A;  1AK4 C;  2EHS A;  2LL8 A;  2LOL A;  2BUO A;  2KR5 A;  1NJI Q;  2KG8 A;  2N6Y A;  2ERH A;  1VQ9 P;  1GXG A;  3DS2 A;  3GKL C;  3RG2 A;  1M6N A;  4M0I A;  3RG6 C;  1VQ8 P;  2KW2 A;  4COP A;  3CD6 P;  2JAZ A;  1VQK P;  1YJW P;  2GON A;  1U7K A;  4XFX A;  2L9F A;  1E6J P;  1AYI A;  2CQ8 A;  4U0C A;  3DPH A;  4XRO A;  3MGE A;  2LPK A;  4NEO A;  2KOP A;  1VQM P;  3CE7 A;  2GDY A;  2VLP A;  2LIU A;  2X2D D;  3WBH A;  1F80 D;  2JGP A;  3CCJ P;  1DNY A;  2XDE A;  3OW2 O;  3DS5 A;  1IUQ A;  2XZ1 C;  1BAJ A;  2N98 A;  2QEX P;  2N50 A;  2Z46 A;  4H2X C;  1AUM A;  1K73 Q;  2K93 A;  2JU2 A;  3DTJ A;  1NQ4 A;  1M9E C;  2L0Q A;  2EG5 A;  5HGL A;  1UJZ A;  3H47 A;  1M9X C;  1CEI A;  2FAD A;  3BP9 A;  1G03 A;  1VHN A;  2QNW A;  4IPY A;  1IMP A;  2AFE A;  3I55 P;  1UNK A;  2JYL A;  2N5I A;  1KD1 Q;  1L6N A;  2JU1 A;  2X2B A;  1ZMB A;  2K0X A;  2KGF A;  5BS2 A;  1YIJ P;  5BS1 A;  5HGN A;  1VQN P;  2JYG A;  4U0A A;  1FR2 A;  1A43 A;  2PEJ A;  2K0Y A;  2ONT A;  2GDX A;  4J93 A;  3Q20 A;  4U0B A;  4F37 A;  1KLP A;  2N5H A;  2GZI A;  2L6E A;  1Q81 Q;  1HQB A;  4CA3 A;  2LF4 A;  1DV5 A;  5HV8 A;  5HGK A;  4XFZ A;  2K2Q A;  3CCQ P;  2KOO A;  3LRY A;  2BHV A;  2VLQ A;  2Z44 A;  3LMO A;  4GR2 A;  3VRL C;  5I4T G;  1W2B O;  2Z45 A;  1GWP A;  2V4X A;  1OR5 A;  3NTE A;  2LIW A;  2CWO A; 
#chains in the Genus database with same CATH homology
 2PEK A;  1JJ2 O;  1YIT P;  1IUQ A;  2M8P A;  2M8N A;  1YHQ P;  3CCU P;  1BAJ A;  2QEX P;  1VQ6 P;  4E92 A;  3G21 A;  4GR6 A;  2XGU A;  2P9X A;  1M9D C;  2Z46 A;  5F2O A;  2XV6 A;  3CCR P;  1AUM A;  1K73 Q;  1YJ9 P;  4LQW C;  2PEI A;  3DTJ A;  3G6E P;  1A8O A;  1VQ5 P;  2GOL B;  1M9E C;  3E2D A;  2EFJ A;  1YJN P;  1RNI A;  2EG5 A;  5HGL A;  4DGA C;  3H4E A;  2X82 A;  5HGO A;  3G1I A;  3H47 A;  1RO0 A;  3G0V A;  1M9X C;  3DS4 A;  3BP9 A;  1G03 A;  2PEM A;  3G71 P;  3G28 A;  2QA4 P;  4IPY A;  1RO2 A;  1QVG O;  3CCE P;  3I55 P;  4PH3 A;  2KOD A;  3G26 A;  5DCK A;  1Q82 Q;  1KC8 Q;  4PH0 A;  1EIA A;  2OTL P;  1EOQ A;  2JYL A;  1KD1 Q;  4U0F A;  3G4S P;  3HZQ A;  1VQ4 P;  1L6N A;  1M74 A;  3DS1 A;  4HTW A;  2PWO A;  3CC2 P;  1K8A Q;  1QVF O;  1M90 Q;  4QNB A;  1ZMB A;  2KGF A;  4U0D A;  1M6E X;  4DGE C;  2JO0 A;  4PH2 A;  2PEO A;  3B5I A;  1M1K Q;  3CC7 P;  5F2K A;  2XGY A;  4XRQ A;  2PEN A;  3I56 P;  5BS2 A;  1S72 P;  1Q86 Q;  3CPW O;  1YIJ P;  5BS1 A;  1YI2 P;  4U0E A;  4PH1 A;  1AK4 C;  4WYM A;  4XFY A;  2E1M A;  5HGN A;  1QRJ A;  1K30 A;  1VQO P;  1VQN P;  2JYG A;  4U0A A;  2BUO A;  2OTJ P;  2PXR C;  4COC A;  1NJI Q;  2EIA A;  1A43 A;  1VQP P;  2XGV A;  1VQ9 P;  3DS2 A;  2PEJ A;  2XT1 A;  3CCV P;  3CC4 P;  2WLV A;  4E91 A;  3DS3 A;  1D1D A;  1AFV A;  2ONT A;  1M6N A;  4M0I A;  3RG6 C;  3DS0 A;  1P7N A;  1VQ8 P;  4J93 A;  4COP A;  3CD6 P;  3Q20 A;  5F2N A;  4U0B A;  3CXC O;  3CMA P;  1N8R Q;  1VQK P;  1YJW P;  2GON A;  2WLV B;  1M9F C;  1U7K A;  5HGM A;  1K9M Q;  2Y4Z A;  2PWM A;  4XFX A;  4INB A;  1M9Y C;  1E6J P;  3P05 A;  2L6E A;  2M8L A;  3CCS P;  4U0C A;  1Q81 Q;  3DPH A;  2JPR A;  4XRO A;  2PEQ A;  3MGE A;  3HYB A;  1Q7Y Q;  4NX4 C;  2LF4 A;  1VQL P;  5HGK A;  1KQS O;  4XFZ A;  3H0D A;  3CCM P;  3CCQ P;  1VQM P;  3CCL P;  3CME P;  1VQ7 P;  2XXM A;  3LRY A;  2BHV A;  5JPA A;  3G29 A;  2X2D D;  3WBH A;  2Z44 A;  2PY8 A;  4GR2 A;  3VRL C;  3CCJ P;  1M9C C;  5I4T G;  1W2B O;  2X83 A;  3M1M A;  2Z45 A;  1GWP A;  2V4X A;  2XDE A;  3G1G A;  3OW2 O;  2OAR A;  1EM9 A;  3NTE A;  2DGY A;  4B4N A;  3DS5 A;  2CWO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...