3H4EA

X-ray structure of hexameric hiv-1 ca
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
218
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQENAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title X-ray structures of the hexameric building block of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 77
structure length 218
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3h4eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3h4eA02
2XDEA 2JYGA 2LF4A 3DS0A 3MGEA 3NTEA 2XT1A 3H47A 3DS4A 4B4NA 4HTWA 3DS5A 2BUOA 4XROA 2M8NA 2XV6A 1BAJA 1M9EC 4XFZA 1M9CC 1M9FC 3BP9A 2KODA 2EIAA 4COCA 1EIAA 2WLVA 5JPAA 3VRLC 4U0BA 2Y4ZA 4PH0A 3DS3A 3G29A 4INBA 3DS2A 2JYLA 4COPA 3G1IA 4U0AA 2PXRC 1EM9A 4E92A 4LQWC 2JO0A 4PH1A 4DGAC 2WLVB 1G03A 3DS1A 4XFYA 4PH2A 4PH3A 1AFVA 3H4EA 1EOQA 2GOLB 4U0DA 3G21A 3P05A 4XFXA 4U0FA 3DPHA 1QRJA 5HGKA 5HGMA 5I4TG 2XGUA 4QNBA 2M8LA 1A43A 2PWOA 2PWMA 4J93A 1M9YC 1GWPA 2GONA 1L6NA 2X82A 4M0IA 2V4XA 2KGFA 3G1GA 3LRYA 5DCKA 1U7KA 1A8OA 2XGYA 1M9XC 4NX4C 4U0EA 3G28A 1AUMA 3G0VA 1D1DA 4E91A 1E6JP 2JPRA 2X83A 2XGVA 5HGLA 1P7NA 2X2DD 2ONTA 1M9DC 4XRQA 3G26A 5HGNA 4WYMA 2L6EA 4U0CA 4DGEC 2XXMA 1AK4C 2M8PA 4IPYA 3DTJA 5HGOA
chains in the Genus database with same CATH superfamily
4H2XC 1ZNVA 2VLQA 1F80D 3DS0A 2PY8A 3NTEA 3H47A 2PEKA 1M9EC 1E0HA 2GZGA 2LOLA 2M5RA 2LL8A 2K0YA 3VRLC 1M6NA 1L0HA 3CE7A 4PH0A 3RG2A 1DV5A 3DS3A 3I55P 2K93A 2VSQA 1S72P 1VQ5P 2FHSC 1JJ2O 4H2WC 4PH1A 3DS1A 4XFYA 1YI2P 2JB0A 4GR6A 4PH2A 4PH3A 1AFVA 2GOLB 2LIUA 2LMLA 1RO2A 5HV8A 2L0QA 2JU1A 3DPHA 5HGMA 2XGUA 2AVAA 2MR7A 1A43A 2K2QA 3CCEP 1YHQP 3HYBA 4J93A 2E1MA 1GXGA 2KOSA 2GONA 1NJIQ 4M0IA 2X82A 1Q86Q 1VQ7P 1YJWP 1VHNA 2KGFA 3CD6P 2PENA 2KOPA 5DCKA 2XGYA 2N6YA 2Z44A 2PEMA 4BPGA 1OR5A 1D1DA 2GZIA 2KGEA 3B5IA 1E6JP 4BPHA 2LTEA 2X83A 5HGLA 2JGPA 2NO8A 1VQPP 3CCVP 1Q82Q 5EW5E 2K5XA 2XXMA 1AK4C 2QNWA 2KR5A 5HGOA 2XDEA 3CMAP 2CNRA 2KG8A 4PWVB 2EG5A 3CCRP 1QVGO 2N5HA 1MZ8A 1UJZA 2BUOA 4XROA 3GZLA 2GDYA 4XFZA 1M9FC 2FVAA 1K73Q 2EIAA 1EIAA 1ZMBA 3GZMA 3I56P 2WLVA 1UNKA 1YITP 2FVEA 3G29A 4INBA 3DS2A 5HVCA 4COPA 4BPFA 2PXRC 1EM9A 2CG5B 3WBHA 1HQBA 3CCUP 2L9FA 2FQ0A 4DGAC 2AFEA 2BHVA 2AF8A 3H4EA 1EOQA 3CC4P 3G21A 4XFXA 3CPWO 2XZ0D 5KP7B 5HGKA 3GKLC 2Z46A 1Z6MA 3CCJP 2GDWA 3CCMP 2VLPA 2GZJA 2MF4A 4HKGA 5KP8B 3U43A 1VQ9P 1EMVA 2K92A 2LKIA 1HY8A 1RO0A 1IUQA 2FADA 1VKUA 2PNGA 2QA4P 1YJNP 2K0XA 3CCLP 3B4QA 1M1KQ 4U0EA 3G28A 4E91A 2FAEA 4DG9A 3H0DA 1VQMP 7CEIA 2MVVA 2JPRA 2PEJA 3M1MA 4H2YC 2XZ1C 5HGNA 2L6EA 2JBGA 2K0DX 2GYKA 3HZQA 2PEOA 2M8PA 1DNYA 2KORA 2FACA 2GZFA 3DTJA 2MR8A 1K8AQ 1FR2A 2KGAA 3MGEA 1X3OA 3DS4A 1YJ9P 1CEIA 2N50A 4HTWA 1M74A 3CC7P 3G4SP 1M9CC 2ERHA 5KP6B 3CCSP 4CA3A 3E2DA 5F2OA 5JPAA 3LMOA 1GPJA 3EJDA 1Q7YQ 1N8RQ 5F2KA 4IZ6A 5F2NA 2LPKA 2OTLP 4LQWC 3CCQP 2WLVB 1G03A 2L22A 1BXIA 4U0DA 2DNWA 2KOQA 3P05A 2KOOA 1W2BO 4U0FA 1VQ8P 1QRJA 4F37A 1ACPA 3OW2O 5I4TG 4QNBA 2AFDA 1YIJP 2VLOA 1VQ6P 2LIWA 2GZEA 1IMPA 1Q81Q 1L6NA 2DGYA 1RNIA 1GXHA 3GJNA 3NY7B 3LRYA 1A8OA 2PEIA 1KLPA 2N98A 1AYIA 4NX4C 1KQSO 1AUMA 3G0VA 2WPTA 1NQ4A 2CWOA 2JQ4A 2EHSA 3CMEP 1P7NA 5BS1A 2X2DD 4XRQA 3G26A 1VQNP 2ROQA 2KWLA 2FVFA 4IPYA 2X2BA 2JU2A 2JYGA 1VQ4P 2OARA 1VQOP 2LF4A 2FQ2A 2XT1A 2N6ZA 4B4NA 5EJDA 3EJEA 5BS2A 3G71P 2KGDA 2M8NA 3CXCO 2XV6A 2Z45A 1BAJA 3RG6C 3BP9A 2KODA 1KD1Q 4COCA 1M6EX 2EFJA 4U0BA 2Y4ZA 2MVUA 2JYLA 4UHPB 1VQKP 2GDXA 3G1IA 4U0AA 2CQ8A 1K9MQ 4E92A 2QEXP 2JO0A 2N5IA 3CC2P 3Q20A 1K30A 4PXHB 4R0MA 4QKOA 4MRTC 2M8LA 1KC8Q 2L4BA 2PWOA 2PWMA 3EJBA 1T8KA 2KG9A 1M9YC 1GWPA 2FQ1A 2MD9A 2JAZA 2V4XA 2CGQA 5CZDB 2KG6A 3G6EP 3G1GA 1U7KA 1M9XC 2VLNA 1IMQA 2K94A 2P9XA 1M90Q 1QVFO 2OTJP 2XGVA 1L0IA 2ONTA 1M9DC 2EHTA 2MY5A 4WYMA 1AF8A 4U0CA 4DGEC 1VQLP 2KGCA 4NEOA 4GR2A 2PEQA 3DS5A 2KW2A
chains in the Genus database with same CATH topology
2XDEA 3CMAP 2JYGA 1K8AQ 1VQ4P 2OARA 1VQOP 2LF4A 3DS0A 2PY8A 3MGEA 3NTEA 2XT1A 3H47A 2EG5A 3DS4A 3CCRP 1YJ9P 4B4NA 1QVGO 4HTWA 2PEKA 3DS5A 1M74A 2BUOA 3CC7P 5BS2A 3G71P 4XROA 3G4SP 2M8NA 3CXCO 2XV6A 2Z45A 1BAJA 1M9EC 3RG6C 4XFZA 1M9CC 1M9FC 3BP9A 2KODA 1K73Q 1KD1Q 2EIAA 4COCA 1EIAA 1ZMBA 3I56P 3CCSP 2WLVA 1M6EX 3E2DA 5F2OA 2EFJA 5JPAA 3VRLC 4U0BA 2Y4ZA 1M6NA 4PH0A 1Q7YQ 1YITP 3DS3A 3G29A 4INBA 3DS2A 3I55P 2JYLA 4COPA 1N8RQ 5F2KA 1VQKP 3G1IA 4U0AA 1S72P 5F2NA 2PXRC 1K9MQ 1EM9A 1VQ5P 3WBHA 2OTLP 1JJ2O 4E92A 2QEXP 3CCUP 4LQWC 2JO0A 4PH1A 4DGAC 3CCQP 2WLVB 1G03A 3DS1A 4XFYA 3CC2P 1YI2P 2BHVA 4GR6A 4PH2A 4PH3A 1AFVA 3H4EA 1EOQA 2GOLB 4U0DA 3CC4P 3Q20A 1RO2A 3G21A 1K30A 3P05A 4XFXA 3CPWO 1W2BO 4U0FA 3DPHA 1VQ8P 1QRJA 3OW2O 5HGKA 5HGMA 5I4TG 2XGUA 4QNBA 2M8LA 1KC8Q 1A43A 2PWOA 2PWMA 2Z46A 3CCJP 1YIJP 3CCEP 3CCMP 3HYBA 1YHQP 4J93A 1M9YC 2E1MA 1GWPA 1VQ6P 2GONA 1NJIQ 1Q81Q 1L6NA 2X82A 4M0IA 2DGYA 1Q86Q 1VQ7P 1VQ9P 1YJWP 2V4XA 1RNIA 2KGFA 3CD6P 3G6EP 2PENA 1RO0A 3G1GA 3LRYA 1IUQA 1U7KA 1A8OA 2PEIA 5DCKA 2XGYA 1M9XC 1YJNP 2QA4P 2Z44A 2PEMA 3CCLP 4NX4C 1M1KQ 4U0EA 1KQSO 3G28A 1AUMA 3G0VA 1D1DA 4E91A 3B5IA 2P9XA 1E6JP 2CWOA 3H0DA 1VQMP 1M90Q 1QVFO 2JPRA 2OTJP 2X83A 2XGVA 5HGLA 1P7NA 2PEJA 5BS1A 3M1MA 2X2DD 3CMEP 2ONTA 1M9DC 4XRQA 3G26A 5HGNA 4WYMA 1VQPP 2L6EA 3CCVP 1Q82Q 4U0CA 3HZQA 4DGEC 2XXMA 1VQNP 1AK4C 1VQLP 2PEOA 4GR2A 2M8PA 2PEQA 4IPYA 3DTJA 5HGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XDE A;  2JYG A;  2LF4 A;  3DS0 A;  3MGE A;  3NTE A;  2XT1 A;  3H47 A;  3DS4 A;  4B4N A;  4HTW A;  3DS5 A;  2BUO A;  4XRO A;  2M8N A;  2XV6 A;  1BAJ A;  1M9E C;  4XFZ A;  1M9C C;  1M9F C;  3BP9 A;  2KOD A;  2EIA A;  4COC A;  1EIA A;  2WLV A;  5JPA A;  3VRL C;  4U0B A;  2Y4Z A;  4PH0 A;  3DS3 A;  3G29 A;  4INB A;  3DS2 A;  2JYL A;  4COP A;  3G1I A;  4U0A A;  2PXR C;  1EM9 A;  4E92 A;  4LQW C;  2JO0 A;  4PH1 A;  4DGA C;  2WLV B;  1G03 A;  3DS1 A;  4XFY A;  4PH2 A;  4PH3 A;  1AFV A;  3H4E A;  1EOQ A;  2GOL B;  4U0D A;  3G21 A;  3P05 A;  4XFX A;  4U0F A;  3DPH A;  1QRJ A;  5HGK A;  5HGM A;  5I4T G;  2XGU A;  4QNB A;  2M8L A;  1A43 A;  2PWO A;  2PWM A;  4J93 A;  1M9Y C;  1GWP A;  2GON A;  1L6N A;  2X82 A;  4M0I A;  2V4X A;  2KGF A;  3G1G A;  3LRY A;  5DCK A;  1U7K A;  1A8O A;  2XGY A;  1M9X C;  4NX4 C;  4U0E A;  3G28 A;  1AUM A;  3G0V A;  1D1D A;  4E91 A;  1E6J P;  2JPR A;  2X83 A;  2XGV A;  5HGL A;  1P7N A;  2X2D D;  2ONT A;  1M9D C;  4XRQ A;  3G26 A;  5HGN A;  4WYM A;  2L6E A;  4U0C A;  4DGE C;  2XXM A;  1AK4 C;  2M8P A;  4IPY A;  3DTJ A;  5HGO A; 
#chains in the Genus database with same CATH topology
 4H2X C;  1ZNV A;  2VLQ A;  1F80 D;  3DS0 A;  2PY8 A;  3NTE A;  3H47 A;  2PEK A;  1M9E C;  1E0H A;  2GZG A;  2LOL A;  2M5R A;  2LL8 A;  2K0Y A;  3VRL C;  1M6N A;  1L0H A;  3CE7 A;  4PH0 A;  3RG2 A;  1DV5 A;  3DS3 A;  3I55 P;  2K93 A;  2VSQ A;  1S72 P;  1VQ5 P;  2FHS C;  1JJ2 O;  4H2W C;  4PH1 A;  3DS1 A;  4XFY A;  1YI2 P;  2JB0 A;  4GR6 A;  4PH2 A;  4PH3 A;  1AFV A;  2GOL B;  2LIU A;  2LML A;  1RO2 A;  5HV8 A;  2L0Q A;  2JU1 A;  3DPH A;  5HGM A;  2XGU A;  2AVA A;  2MR7 A;  1A43 A;  2K2Q A;  3CCE P;  1YHQ P;  3HYB A;  4J93 A;  2E1M A;  1GXG A;  2KOS A;  2GON A;  1NJI Q;  4M0I A;  2X82 A;  1Q86 Q;  1VQ7 P;  1YJW P;  1VHN A;  2KGF A;  3CD6 P;  2PEN A;  2KOP A;  5DCK A;  2XGY A;  2N6Y A;  2Z44 A;  2PEM A;  4BPG A;  1OR5 A;  1D1D A;  2GZI A;  2KGE A;  3B5I A;  1E6J P;  4BPH A;  2LTE A;  2X83 A;  5HGL A;  2JGP A;  2NO8 A;  1VQP P;  3CCV P;  1Q82 Q;  5EW5 E;  2K5X A;  2XXM A;  1AK4 C;  2QNW A;  2KR5 A;  5HGO A;  2XDE A;  3CMA P;  2CNR A;  2KG8 A;  4PWV B;  2EG5 A;  3CCR P;  1QVG O;  2N5H A;  1MZ8 A;  1UJZ A;  2BUO A;  4XRO A;  3GZL A;  2GDY A;  4XFZ A;  1M9F C;  2FVA A;  1K73 Q;  2EIA A;  1EIA A;  1ZMB A;  3GZM A;  3I56 P;  2WLV A;  1UNK A;  1YIT P;  2FVE A;  3G29 A;  4INB A;  3DS2 A;  5HVC A;  4COP A;  4BPF A;  2PXR C;  1EM9 A;  2CG5 B;  3WBH A;  1HQB A;  3CCU P;  2L9F A;  2FQ0 A;  4DGA C;  2AFE A;  2BHV A;  2AF8 A;  3H4E A;  1EOQ A;  3CC4 P;  3G21 A;  4XFX A;  3CPW O;  2XZ0 D;  5KP7 B;  5HGK A;  3GKL C;  2Z46 A;  1Z6M A;  3CCJ P;  2GDW A;  3CCM P;  2VLP A;  2GZJ A;  2MF4 A;  4HKG A;  5KP8 B;  3U43 A;  1VQ9 P;  1EMV A;  2K92 A;  2LKI A;  1HY8 A;  1RO0 A;  1IUQ A;  2FAD A;  1VKU A;  2PNG A;  2QA4 P;  1YJN P;  2K0X A;  3CCL P;  3B4Q A;  1M1K Q;  4U0E A;  3G28 A;  4E91 A;  2FAE A;  4DG9 A;  3H0D A;  1VQM P;  7CEI A;  2MVV A;  2JPR A;  2PEJ A;  3M1M A;  4H2Y C;  2XZ1 C;  5HGN A;  2L6E A;  2JBG A;  2K0D X;  2GYK A;  3HZQ A;  2PEO A;  2M8P A;  1DNY A;  2KOR A;  2FAC A;  2GZF A;  3DTJ A;  2MR8 A;  1K8A Q;  1FR2 A;  2KGA A;  3MGE A;  1X3O A;  3DS4 A;  1YJ9 P;  1CEI A;  2N50 A;  4HTW A;  1M74 A;  3CC7 P;  3G4S P;  1M9C C;  2ERH A;  5KP6 B;  3CCS P;  4CA3 A;  3E2D A;  5F2O A;  5JPA A;  3LMO A;  1GPJ A;  3EJD A;  1Q7Y Q;  1N8R Q;  5F2K A;  4IZ6 A;  5F2N A;  2LPK A;  2OTL P;  4LQW C;  3CCQ P;  2WLV B;  1G03 A;  2L22 A;  1BXI A;  4U0D A;  2DNW A;  2KOQ A;  3P05 A;  2KOO A;  1W2B O;  4U0F A;  1VQ8 P;  1QRJ A;  4F37 A;  1ACP A;  3OW2 O;  5I4T G;  4QNB A;  2AFD A;  1YIJ P;  2VLO A;  1VQ6 P;  2LIW A;  2GZE A;  1IMP A;  1Q81 Q;  1L6N A;  2DGY A;  1RNI A;  1GXH A;  3GJN A;  3NY7 B;  3LRY A;  1A8O A;  2PEI A;  1KLP A;  2N98 A;  1AYI A;  4NX4 C;  1KQS O;  1AUM A;  3G0V A;  2WPT A;  1NQ4 A;  2CWO A;  2JQ4 A;  2EHS A;  3CME P;  1P7N A;  5BS1 A;  2X2D D;  4XRQ A;  3G26 A;  1VQN P;  2ROQ A;  2KWL A;  2FVF A;  4IPY A;  2X2B A;  2JU2 A;  2JYG A;  1VQ4 P;  2OAR A;  1VQO P;  2LF4 A;  2FQ2 A;  2XT1 A;  2N6Z A;  4B4N A;  5EJD A;  3EJE A;  5BS2 A;  3G71 P;  2KGD A;  2M8N A;  3CXC O;  2XV6 A;  2Z45 A;  1BAJ A;  3RG6 C;  3BP9 A;  2KOD A;  1KD1 Q;  4COC A;  1M6E X;  2EFJ A;  4U0B A;  2Y4Z A;  2MVU A;  2JYL A;  4UHP B;  1VQK P;  2GDX A;  3G1I A;  4U0A A;  2CQ8 A;  1K9M Q;  4E92 A;  2QEX P;  2JO0 A;  2N5I A;  3CC2 P;  3Q20 A;  1K30 A;  4PXH B;  4R0M A;  4QKO A;  4MRT C;  2M8L A;  1KC8 Q;  2L4B A;  2PWO A;  2PWM A;  3EJB A;  1T8K A;  2KG9 A;  1M9Y C;  1GWP A;  2FQ1 A;  2MD9 A;  2JAZ A;  2V4X A;  2CGQ A;  5CZD B;  2KG6 A;  3G6E P;  3G1G A;  1U7K A;  1M9X C;  2VLN A;  1IMQ A;  2K94 A;  2P9X A;  1M90 Q;  1QVF O;  2OTJ P;  2XGV A;  1L0I A;  2ONT A;  1M9D C;  2EHT A;  2MY5 A;  4WYM A;  1AF8 A;  4U0C A;  4DGE C;  1VQL P;  2KGC A;  4NEO A;  4GR2 A;  2PEQ A;  3DS5 A;  2KW2 A; 
#chains in the Genus database with same CATH homology
 2XDE A;  3CMA P;  2JYG A;  1K8A Q;  1VQ4 P;  2OAR A;  1VQO P;  2LF4 A;  3DS0 A;  2PY8 A;  3MGE A;  3NTE A;  2XT1 A;  3H47 A;  2EG5 A;  3DS4 A;  3CCR P;  1YJ9 P;  4B4N A;  1QVG O;  4HTW A;  2PEK A;  3DS5 A;  1M74 A;  2BUO A;  3CC7 P;  5BS2 A;  3G71 P;  4XRO A;  3G4S P;  2M8N A;  3CXC O;  2XV6 A;  2Z45 A;  1BAJ A;  1M9E C;  3RG6 C;  4XFZ A;  1M9C C;  1M9F C;  3BP9 A;  2KOD A;  1K73 Q;  1KD1 Q;  2EIA A;  4COC A;  1EIA A;  1ZMB A;  3I56 P;  3CCS P;  2WLV A;  1M6E X;  3E2D A;  5F2O A;  2EFJ A;  5JPA A;  3VRL C;  4U0B A;  2Y4Z A;  1M6N A;  4PH0 A;  1Q7Y Q;  1YIT P;  3DS3 A;  3G29 A;  4INB A;  3DS2 A;  3I55 P;  2JYL A;  4COP A;  1N8R Q;  5F2K A;  1VQK P;  3G1I A;  4U0A A;  1S72 P;  5F2N A;  2PXR C;  1K9M Q;  1EM9 A;  1VQ5 P;  3WBH A;  2OTL P;  1JJ2 O;  4E92 A;  2QEX P;  3CCU P;  4LQW C;  2JO0 A;  4PH1 A;  4DGA C;  3CCQ P;  2WLV B;  1G03 A;  3DS1 A;  4XFY A;  3CC2 P;  1YI2 P;  2BHV A;  4GR6 A;  4PH2 A;  4PH3 A;  1AFV A;  3H4E A;  1EOQ A;  2GOL B;  4U0D A;  3CC4 P;  3Q20 A;  1RO2 A;  3G21 A;  1K30 A;  3P05 A;  4XFX A;  3CPW O;  1W2B O;  4U0F A;  3DPH A;  1VQ8 P;  1QRJ A;  3OW2 O;  5HGK A;  5HGM A;  5I4T G;  2XGU A;  4QNB A;  2M8L A;  1KC8 Q;  1A43 A;  2PWO A;  2PWM A;  2Z46 A;  3CCJ P;  1YIJ P;  3CCE P;  3CCM P;  3HYB A;  1YHQ P;  4J93 A;  1M9Y C;  2E1M A;  1GWP A;  1VQ6 P;  2GON A;  1NJI Q;  1Q81 Q;  1L6N A;  2X82 A;  4M0I A;  2DGY A;  1Q86 Q;  1VQ7 P;  1VQ9 P;  1YJW P;  2V4X A;  1RNI A;  2KGF A;  3CD6 P;  3G6E P;  2PEN A;  1RO0 A;  3G1G A;  3LRY A;  1IUQ A;  1U7K A;  1A8O A;  2PEI A;  5DCK A;  2XGY A;  1M9X C;  1YJN P;  2QA4 P;  2Z44 A;  2PEM A;  3CCL P;  4NX4 C;  1M1K Q;  4U0E A;  1KQS O;  3G28 A;  1AUM A;  3G0V A;  1D1D A;  4E91 A;  3B5I A;  2P9X A;  1E6J P;  2CWO A;  3H0D A;  1VQM P;  1M90 Q;  1QVF O;  2JPR A;  2OTJ P;  2X83 A;  2XGV A;  5HGL A;  1P7N A;  2PEJ A;  5BS1 A;  3M1M A;  2X2D D;  3CME P;  2ONT A;  1M9D C;  4XRQ A;  3G26 A;  5HGN A;  4WYM A;  1VQP P;  2L6E A;  3CCV P;  1Q82 Q;  4U0C A;  3HZQ A;  4DGE C;  2XXM A;  1VQN P;  1AK4 C;  1VQL P;  2PEO A;  4GR2 A;  2M8P A;  2PEQ A;  4IPY A;  3DTJ A;  5HGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...