3H4EA

X-ray structure of hexameric hiv-1 ca
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
218
Chain Sequence
b'PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQENAATETLLVQNANPDCKTILKALGPGATLEEMMTACQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title X-ray structures of the hexameric building block of the HIV capsid.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 77
structure length 218
sequence length 220
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3h4eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3h4eA02
4XFZA 3G1IA 2PWMA 4B4NA 2L6EA 2EIAA 1AUMA 3VRLC 5HGKA 4XFYA 4M0IA 5HGNA 2GOLB 1M9CC 2PWOA 2XT1A 2GONA 3DS1A 1A8OA 1E6JP 5JPAA 1P7NA 2JPRA 2BUOA 3G0VA 2WLVA 3DTJA 2XGUA 4PH3A 3G21A 2PXRC 4U0AA 2KGFA 1A43A 2X82A 3NTEA 3G26A 5DCKA 1M9DC 2M8NA 4U0BA 2M8LA 1G03A 4INBA 3BP9A 4COCA 2JYLA 4IPYA 2WLVB 4PH0A 4PH1A 4LQWC 4WYMA 1M9FC 4U0DA 3G1GA 2JO0A 2XV6A 2KODA 1M9XC 4QNBA 5HGMA 3DS2A 4DGEC 3MGEA 2JYGA 4XFXA 3H4EA 1U7KA 3DS0A 3G29A 3DS3A 4J93A 4U0EA 2XGVA 2ONTA 4U0FA 4E91A 1M9EC 4COPA 2XDEA 3DPHA 3DS4A 1GWPA 3DS5A 3G28A 1AFVA 1EM9A 2XGYA 2LF4A 2Y4ZA 4HTWA 4PH2A 5HGOA 2V4XA 4DGAC 3P05A 1D1DA 2X2DD 2XXMA 4XRQA 1QRJA 1M9YC 1EIAA 1L6NA 5I4TG 1BAJA 3LRYA 3H47A 2X83A 4U0CA 1AK4C 4E92A 1EOQA 4XROA 2M8PA 4NX4C 5HGLA
chains in the Genus database with same CATH superfamily
2GZFA 4XFZA 3OW2O 1IMQA 2JQ4A 2KGDA 2K0XA 3GJNA 1K8AQ 5HGKA 2KGAA 7CEIA 5HGNA 2GOLB 4H2XC 2VLPA 2KG6A 4BPHA 1GPJA 3GZLA 1Q81Q 2BUOA 2DGYA 2WLVA 1EMVA 2KOQA 3I55P 4U0AA 2X82A 3CC2P 3BP9A 1K73Q 3U43A 4IPYA 3CC7P 2E1MA 4PH1A 1VQKP 1M9FC 2CQ8A 4GR2A 1L0HA 1UNKA 1JJ2O 2QNWA 5CZDB 3I56P 3DS2A 3Q20A 1KQSO 2PEIA 2JAZA 2JYGA 2LL8A 3G71P 1L0IA 3G29A 1T8KA 2JBGA 3DS3A 2X2BA 2FQ1A 2ONTA 2CG5B 4E91A 4COPA 1QVFO 2KOPA 1DV5A 2K2QA 2QA4P 1EM9A 2OTLP 4HTWA 3P05A 1VQ9P 1UJZA 2AF8A 2PEQA 3GKLC 1RO0A 4XRQA 4H2WC 4CA3A 1Q86Q 1EIAA 3WBHA 2KWLA 1L6NA 2WPTA 1BAJA 1HY8A 1M6EX 1F80D 1RO2A 4U0CA 1AK4C 1EOQA 2KR5A 2LIUA 2MF4A 2KOOA 4NX4C 5HGLA 2EG5A 3G1IA 1M1KQ 2PWMA 2N5IA 3CD6P 2L6EA 3CCJP 2VSQA 3VRLC 1K9MQ 1M9CC 2AVAA 2PWOA 2GONA 1A8OA 2VLOA 3CCUP 2Z44A 3G0VA 2N6YA 1MZ8A 2KGFA 3NTEA 1GXHA 1M9DC 3HZQA 2GDWA 1VQ5P 1YJWP 1VQMP 5F2NA 2FQ0A 1YIJP 1Q7YQ 2KORA 2MR8A 4HKGA 2OTJP 4U0EA 1Z6MA 3EJDA 2K5XA 3HYBA 3CCRP 2XDEA 2KGEA 1GWPA 2N5HA 3DS5A 2LOLA 2GDXA 1ACPA 2FVFA 2KG9A 2CGQA 3CXCO 1Q82Q 1FR2A 2K94A 4PH2A 2KGCA 2K0DX 4BPGA 2PNGA 2FQ2A 1M9YC 5I4TG 1VQPP 2FVEA 5F2KA 4DG9A 3RG6C 2FADA 2XZ0D 3NY7B 4GR6A 1X3OA 2M8PA 1YHQP 2MVVA 4PXHB 5KP8B 3M1MA 2K0YA 3B4QA 3GZMA 1AUMA 1IUQA 1AF8A 2LIWA 2GZGA 4M0IA 4F37A 2JU1A 1S72P 2FVAA 3CE7A 2JB0A 2MY5A 1E6JP 5JPAA 1P7NA 3DTJA 2XGUA 4PH3A 2PXRC 3B5IA 1A43A 4QKOA 2KOSA 4MRTC 1NJIQ 3G6EP 2M8LA 1G03A 2WLVB 5KP7B 2KW2A 4LQWC 5EJDA 4U0DA 4PWVB 3RG2A 3G1GA 2JO0A 2XV6A 1ZNVA 1KC8Q 5HGMA 2GDYA 2L9FA 4DGEC 2ROQA 3MGEA 2MVUA 2CWOA 3H4EA 1U7KA 1M6NA 2PEMA 3CC4P 5KP6B 4IZ6A 1VQ7P 1YITP 2GZIA 3E2DA 4U0FA 1M9EC 2FAEA 5HV8A 1OR5A 1VQ4P 2CNRA 2VLQA 1VQ6P 3EJEA 2N98A 2LF4A 2Y4ZA 1GXGA 2JU2A 2PEOA 2X2DD 2XXMA 3CCSP 2EHTA 1W2BO 1QRJA 2MR7A 2L22A 1E0HA 1DNYA 2FACA 3H47A 1RNIA 2PEKA 2L4BA 3CMAP 3CCQP 2LTEA 2P9XA 3CMEP 5F2OA 2M5RA 4B4NA 1KD1Q 2NO8A 3LMOA 2EIAA 2QEXP 3G4SP 4XFYA 2LMLA 2MD9A 2XT1A 3DS1A 2EFJA 1AYIA 2JPRA 2LPKA 1KLPA 3H0DA 3G21A 1BXIA 1NQ4A 1YJNP 1QVGO 1K30A 3CCMP 1YJ9P 1HQBA 3CCVP 3G26A 5DCKA 2M8NA 4U0BA 4INBA 4COCA 2JYLA 5BS1A 4PH0A 3EJBA 1VQLP 2GZEA 2JGPA 2GZJA 4WYMA 1VQOP 5BS2A 2N50A 2KODA 1M9XC 4QNBA 1ZMBA 4R0MA 2AFEA 2PEJA 3CPWO 4XFXA 3DS0A 2DNWA 2L0QA 4J93A 2K92A 2XGVA 2BHVA 3CCLP 5EW5E 4NEOA 1VKUA 2EHSA 2KG8A 1IMPA 3DS4A 2FHSC 3DPHA 2VLNA 3G28A 1AFVA 2LKIA 1VHNA 2GYKA 2XGYA 2K93A 2OARA 5HGOA 1M90Q 2V4XA 1M74A 4DGAC 3CCEP 1D1DA 2PENA 1CEIA 4UHPB 1VQ8P 2AFDA 4H2YC 2Z45A 2PY8A 2XZ1C 4BPFA 3LRYA 1N8RQ 2X83A 5HVCA 4E92A 2ERHA 4XROA 1VQNP 2Z46A 1YI2P 2N6ZA
chains in the Genus database with same CATH topology
4XFZA 3G1IA 1M1KQ 2PWMA 4B4NA 3M1MA 3OW2O 1YHQP 1KD1Q 3CD6P 2L6EA 2EIAA 3CCJP 1AUMA 1IUQA 2QEXP 1K8AQ 3VRLC 3G4SP 5HGKA 4XFYA 4M0IA 1K9MQ 5HGNA 2GOLB 1S72P 1M9CC 2PWOA 2XT1A 2GONA 3DS1A 1A8OA 1E6JP 2EFJA 3CCUP 5JPAA 1P7NA 2JPRA 2BUOA 1Q81Q 2DGYA 2Z44A 2WLVA 3DTJA 2XGUA 4PH3A 3G0VA 3G21A 3H0DA 2PXRC 4U0AA 3I55P 2KGFA 3B5IA 1YJNP 1A43A 2X82A 1QVGO 3NTEA 1K30A 3CCMP 1YJ9P 3CCVP 3G26A 5DCKA 1NJIQ 1M9DC 3CC2P 2M8NA 4U0BA 3G6EP 3HZQA 2M8LA 1G03A 4INBA 3BP9A 4COCA 1K73Q 1VQ5P 2JYLA 4IPYA 2WLVB 3CC7P 5BS1A 1YJWP 2E1MA 4PH0A 1VQMP 1VQLP 4PH1A 1VQKP 4LQWC 4WYMA 1M9FC 4U0DA 1VQOP 5F2NA 5BS2A 3G1GA 2JO0A 2XV6A 4GR2A 2KODA 1YIJP 1M9XC 1KC8Q 4QNBA 1JJ2O 5HGMA 1Q7YQ 3I56P 3DS2A 4DGEC 1ZMBA 3Q20A 1KQSO 3MGEA 2PEIA 2CWOA 2JYGA 4XFXA 2PEJA 3G71P 3H4EA 3CPWO 2OTJP 1U7KA 3DS0A 1M6NA 3G29A 2PEMA 3DS3A 3CC4P 4J93A 4U0EA 2XGVA 2BHVA 1YITP 1VQ7P 3CCLP 2ONTA 3E2DA 4U0FA 4E91A 1M9EC 3HYBA 4COPA 3CCRP 1QVFO 2XDEA 3DPHA 3DS4A 1VQ4P 1GWPA 1YI2P 3DS5A 2QA4P 1VQ6P 3G28A 1AFVA 1EM9A 2XGYA 2OTLP 2LF4A 2OARA 3CXCO 2Y4ZA 1Q82Q 4HTWA 4PH2A 5HGOA 1M90Q 2V4XA 1M74A 4DGAC 3P05A 1VQ9P 1D1DA 2PENA 3CCEP 2PEOA 2X2DD 2XXMA 1VQ8P 2PEQA 3CCSP 1RO0A 4XRQA 1QRJA 1W2BO 1Q86Q 2Z45A 1M9YC 1EIAA 2PY8A 3WBHA 1L6NA 5I4TG 1BAJA 1VQPP 3LRYA 1N8RQ 3H47A 2X83A 1RNIA 1M6EX 2PEKA 5F2KA 3RG6C 1RO2A 3CMAP 4U0CA 3CCQP 1AK4C 4E92A 4GR6A 1EOQA 4XROA 2P9XA 3CMEP 2M8PA 1VQNP 2Z46A 4NX4C 5HGLA 2EG5A 5F2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFZ A;  3G1I A;  2PWM A;  4B4N A;  2L6E A;  2EIA A;  1AUM A;  3VRL C;  5HGK A;  4XFY A;  4M0I A;  5HGN A;  2GOL B;  1M9C C;  2PWO A;  2XT1 A;  2GON A;  3DS1 A;  1A8O A;  1E6J P;  5JPA A;  1P7N A;  2JPR A;  2BUO A;  3G0V A;  2WLV A;  3DTJ A;  2XGU A;  4PH3 A;  3G21 A;  2PXR C;  4U0A A;  2KGF A;  1A43 A;  2X82 A;  3NTE A;  3G26 A;  5DCK A;  1M9D C;  2M8N A;  4U0B A;  2M8L A;  1G03 A;  4INB A;  3BP9 A;  4COC A;  2JYL A;  4IPY A;  2WLV B;  4PH0 A;  4PH1 A;  4LQW C;  4WYM A;  1M9F C;  4U0D A;  3G1G A;  2JO0 A;  2XV6 A;  2KOD A;  1M9X C;  4QNB A;  5HGM A;  3DS2 A;  4DGE C;  3MGE A;  2JYG A;  4XFX A;  3H4E A;  1U7K A;  3DS0 A;  3G29 A;  3DS3 A;  4J93 A;  4U0E A;  2XGV A;  2ONT A;  4U0F A;  4E91 A;  1M9E C;  4COP A;  2XDE A;  3DPH A;  3DS4 A;  1GWP A;  3DS5 A;  3G28 A;  1AFV A;  1EM9 A;  2XGY A;  2LF4 A;  2Y4Z A;  4HTW A;  4PH2 A;  5HGO A;  2V4X A;  4DGA C;  3P05 A;  1D1D A;  2X2D D;  2XXM A;  4XRQ A;  1QRJ A;  1M9Y C;  1EIA A;  1L6N A;  5I4T G;  1BAJ A;  3LRY A;  3H47 A;  2X83 A;  4U0C A;  1AK4 C;  4E92 A;  1EOQ A;  4XRO A;  2M8P A;  4NX4 C;  5HGL A; 
#chains in the Genus database with same CATH topology
 2GZF A;  4XFZ A;  3OW2 O;  1IMQ A;  2JQ4 A;  2KGD A;  2K0X A;  3GJN A;  1K8A Q;  5HGK A;  2KGA A;  7CEI A;  5HGN A;  2GOL B;  4H2X C;  2VLP A;  2KG6 A;  4BPH A;  1GPJ A;  3GZL A;  1Q81 Q;  2BUO A;  2DGY A;  2WLV A;  1EMV A;  2KOQ A;  3I55 P;  4U0A A;  2X82 A;  3CC2 P;  3BP9 A;  1K73 Q;  3U43 A;  4IPY A;  3CC7 P;  2E1M A;  4PH1 A;  1VQK P;  1M9F C;  2CQ8 A;  4GR2 A;  1L0H A;  1UNK A;  1JJ2 O;  2QNW A;  5CZD B;  3I56 P;  3DS2 A;  3Q20 A;  1KQS O;  2PEI A;  2JAZ A;  2JYG A;  2LL8 A;  3G71 P;  1L0I A;  3G29 A;  1T8K A;  2JBG A;  3DS3 A;  2X2B A;  2FQ1 A;  2ONT A;  2CG5 B;  4E91 A;  4COP A;  1QVF O;  2KOP A;  1DV5 A;  2K2Q A;  2QA4 P;  1EM9 A;  2OTL P;  4HTW A;  3P05 A;  1VQ9 P;  1UJZ A;  2AF8 A;  2PEQ A;  3GKL C;  1RO0 A;  4XRQ A;  4H2W C;  4CA3 A;  1Q86 Q;  1EIA A;  3WBH A;  2KWL A;  1L6N A;  2WPT A;  1BAJ A;  1HY8 A;  1M6E X;  1F80 D;  1RO2 A;  4U0C A;  1AK4 C;  1EOQ A;  2KR5 A;  2LIU A;  2MF4 A;  2KOO A;  4NX4 C;  5HGL A;  2EG5 A;  3G1I A;  1M1K Q;  2PWM A;  2N5I A;  3CD6 P;  2L6E A;  3CCJ P;  2VSQ A;  3VRL C;  1K9M Q;  1M9C C;  2AVA A;  2PWO A;  2GON A;  1A8O A;  2VLO A;  3CCU P;  2Z44 A;  3G0V A;  2N6Y A;  1MZ8 A;  2KGF A;  3NTE A;  1GXH A;  1M9D C;  3HZQ A;  2GDW A;  1VQ5 P;  1YJW P;  1VQM P;  5F2N A;  2FQ0 A;  1YIJ P;  1Q7Y Q;  2KOR A;  2MR8 A;  4HKG A;  2OTJ P;  4U0E A;  1Z6M A;  3EJD A;  2K5X A;  3HYB A;  3CCR P;  2XDE A;  2KGE A;  1GWP A;  2N5H A;  3DS5 A;  2LOL A;  2GDX A;  1ACP A;  2FVF A;  2KG9 A;  2CGQ A;  3CXC O;  1Q82 Q;  1FR2 A;  2K94 A;  4PH2 A;  2KGC A;  2K0D X;  4BPG A;  2PNG A;  2FQ2 A;  1M9Y C;  5I4T G;  1VQP P;  2FVE A;  5F2K A;  4DG9 A;  3RG6 C;  2FAD A;  2XZ0 D;  3NY7 B;  4GR6 A;  1X3O A;  2M8P A;  1YHQ P;  2MVV A;  4PXH B;  5KP8 B;  3M1M A;  2K0Y A;  3B4Q A;  3GZM A;  1AUM A;  1IUQ A;  1AF8 A;  2LIW A;  2GZG A;  4M0I A;  4F37 A;  2JU1 A;  1S72 P;  2FVA A;  3CE7 A;  2JB0 A;  2MY5 A;  1E6J P;  5JPA A;  1P7N A;  3DTJ A;  2XGU A;  4PH3 A;  2PXR C;  3B5I A;  1A43 A;  4QKO A;  2KOS A;  4MRT C;  1NJI Q;  3G6E P;  2M8L A;  1G03 A;  2WLV B;  5KP7 B;  2KW2 A;  4LQW C;  5EJD A;  4U0D A;  4PWV B;  3RG2 A;  3G1G A;  2JO0 A;  2XV6 A;  1ZNV A;  1KC8 Q;  5HGM A;  2GDY A;  2L9F A;  4DGE C;  2ROQ A;  3MGE A;  2MVU A;  2CWO A;  3H4E A;  1U7K A;  1M6N A;  2PEM A;  3CC4 P;  5KP6 B;  4IZ6 A;  1VQ7 P;  1YIT P;  2GZI A;  3E2D A;  4U0F A;  1M9E C;  2FAE A;  5HV8 A;  1OR5 A;  1VQ4 P;  2CNR A;  2VLQ A;  1VQ6 P;  3EJE A;  2N98 A;  2LF4 A;  2Y4Z A;  1GXG A;  2JU2 A;  2PEO A;  2X2D D;  2XXM A;  3CCS P;  2EHT A;  1W2B O;  1QRJ A;  2MR7 A;  2L22 A;  1E0H A;  1DNY A;  2FAC A;  3H47 A;  1RNI A;  2PEK A;  2L4B A;  3CMA P;  3CCQ P;  2LTE A;  2P9X A;  3CME P;  5F2O A;  2M5R A;  4B4N A;  1KD1 Q;  2NO8 A;  3LMO A;  2EIA A;  2QEX P;  3G4S P;  4XFY A;  2LML A;  2MD9 A;  2XT1 A;  3DS1 A;  2EFJ A;  1AYI A;  2JPR A;  2LPK A;  1KLP A;  3H0D A;  3G21 A;  1BXI A;  1NQ4 A;  1YJN P;  1QVG O;  1K30 A;  3CCM P;  1YJ9 P;  1HQB A;  3CCV P;  3G26 A;  5DCK A;  2M8N A;  4U0B A;  4INB A;  4COC A;  2JYL A;  5BS1 A;  4PH0 A;  3EJB A;  1VQL P;  2GZE A;  2JGP A;  2GZJ A;  4WYM A;  1VQO P;  5BS2 A;  2N50 A;  2KOD A;  1M9X C;  4QNB A;  1ZMB A;  4R0M A;  2AFE A;  2PEJ A;  3CPW O;  4XFX A;  3DS0 A;  2DNW A;  2L0Q A;  4J93 A;  2K92 A;  2XGV A;  2BHV A;  3CCL P;  5EW5 E;  4NEO A;  1VKU A;  2EHS A;  2KG8 A;  1IMP A;  3DS4 A;  2FHS C;  3DPH A;  2VLN A;  3G28 A;  1AFV A;  2LKI A;  1VHN A;  2GYK A;  2XGY A;  2K93 A;  2OAR A;  5HGO A;  1M90 Q;  2V4X A;  1M74 A;  4DGA C;  3CCE P;  1D1D A;  2PEN A;  1CEI A;  4UHP B;  1VQ8 P;  2AFD A;  4H2Y C;  2Z45 A;  2PY8 A;  2XZ1 C;  4BPF A;  3LRY A;  1N8R Q;  2X83 A;  5HVC A;  4E92 A;  2ERH A;  4XRO A;  1VQN P;  2Z46 A;  1YI2 P;  2N6Z A; 
#chains in the Genus database with same CATH homology
 4XFZ A;  3G1I A;  1M1K Q;  2PWM A;  4B4N A;  3M1M A;  3OW2 O;  1YHQ P;  1KD1 Q;  3CD6 P;  2L6E A;  2EIA A;  3CCJ P;  1AUM A;  1IUQ A;  2QEX P;  1K8A Q;  3VRL C;  3G4S P;  5HGK A;  4XFY A;  4M0I A;  1K9M Q;  5HGN A;  2GOL B;  1S72 P;  1M9C C;  2PWO A;  2XT1 A;  2GON A;  3DS1 A;  1A8O A;  1E6J P;  2EFJ A;  3CCU P;  5JPA A;  1P7N A;  2JPR A;  2BUO A;  1Q81 Q;  2DGY A;  2Z44 A;  2WLV A;  3DTJ A;  2XGU A;  4PH3 A;  3G0V A;  3G21 A;  3H0D A;  2PXR C;  4U0A A;  3I55 P;  2KGF A;  3B5I A;  1YJN P;  1A43 A;  2X82 A;  1QVG O;  3NTE A;  1K30 A;  3CCM P;  1YJ9 P;  3CCV P;  3G26 A;  5DCK A;  1NJI Q;  1M9D C;  3CC2 P;  2M8N A;  4U0B A;  3G6E P;  3HZQ A;  2M8L A;  1G03 A;  4INB A;  3BP9 A;  4COC A;  1K73 Q;  1VQ5 P;  2JYL A;  4IPY A;  2WLV B;  3CC7 P;  5BS1 A;  1YJW P;  2E1M A;  4PH0 A;  1VQM P;  1VQL P;  4PH1 A;  1VQK P;  4LQW C;  4WYM A;  1M9F C;  4U0D A;  1VQO P;  5F2N A;  5BS2 A;  3G1G A;  2JO0 A;  2XV6 A;  4GR2 A;  2KOD A;  1YIJ P;  1M9X C;  1KC8 Q;  4QNB A;  1JJ2 O;  5HGM A;  1Q7Y Q;  3I56 P;  3DS2 A;  4DGE C;  1ZMB A;  3Q20 A;  1KQS O;  3MGE A;  2PEI A;  2CWO A;  2JYG A;  4XFX A;  2PEJ A;  3G71 P;  3H4E A;  3CPW O;  2OTJ P;  1U7K A;  3DS0 A;  1M6N A;  3G29 A;  2PEM A;  3DS3 A;  3CC4 P;  4J93 A;  4U0E A;  2XGV A;  2BHV A;  1YIT P;  1VQ7 P;  3CCL P;  2ONT A;  3E2D A;  4U0F A;  4E91 A;  1M9E C;  3HYB A;  4COP A;  3CCR P;  1QVF O;  2XDE A;  3DPH A;  3DS4 A;  1VQ4 P;  1GWP A;  1YI2 P;  3DS5 A;  2QA4 P;  1VQ6 P;  3G28 A;  1AFV A;  1EM9 A;  2XGY A;  2OTL P;  2LF4 A;  2OAR A;  3CXC O;  2Y4Z A;  1Q82 Q;  4HTW A;  4PH2 A;  5HGO A;  1M90 Q;  2V4X A;  1M74 A;  4DGA C;  3P05 A;  1VQ9 P;  1D1D A;  2PEN A;  3CCE P;  2PEO A;  2X2D D;  2XXM A;  1VQ8 P;  2PEQ A;  3CCS P;  1RO0 A;  4XRQ A;  1QRJ A;  1W2B O;  1Q86 Q;  2Z45 A;  1M9Y C;  1EIA A;  2PY8 A;  3WBH A;  1L6N A;  5I4T G;  1BAJ A;  1VQP P;  3LRY A;  1N8R Q;  3H47 A;  2X83 A;  1RNI A;  1M6E X;  2PEK A;  5F2K A;  3RG6 C;  1RO2 A;  3CMA P;  4U0C A;  3CCQ P;  1AK4 C;  4E92 A;  4GR6 A;  1EOQ A;  4XRO A;  2P9X A;  3CME P;  2M8P A;  1VQN P;  2Z46 A;  4NX4 C;  5HGL A;  2EG5 A;  5F2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...