2WLVA

Structure of the n-terminal capsid domain of hiv-2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
144
structure length
144
Chain Sequence
PVQHVGGTYTHIPLSPRTLNAWVKLVEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIREIINEEAAEWDVQHPIPGPLPAGQLREPRGSDIAGTTSTVEEQIQWMFRPQNPVPVGNIYRRWIQIGLQKCVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Active Site Remodelling Switches HIV Specificity of Antiretroviral Trimcyp
pubmed doi rcsb
source organism Human immunodeficiency virus type 2 (isolate d194)
molecule tags Viral protein
total genus 51
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2009-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2wlvA00
1EIAA 2GONA 2XGVA 4PH3A 4U0BA 4XFYA 5JPAA 4PH2A 2PWOA 1M9XC 5HGLA 4XFZA 1M9DC 4NX4C 1M9YC 2WLVA 2PWMA 4XROA 1M9CC 3H4EA 1E6JP 2XDEA 4U0DA 5HGOA 1P7NA 3BP9A 2JPRA 4E91A 1L6NA 4J93A 1M9EC 4DGEC 4B4NA 2GOLB 2EIAA 4QNBA 4PH0A 2WLVB 2X82A 4E92A 4WYMA 4LQWC 4U0FA 4XRQA 2X2DD 3MGEA 1EM9A 1U7KA 4HTWA 5HGMA 2XGUA 2X83A 3H47A 2LF4A 2KGFA 5HGKA 1G03A 2M8NA 4U0CA 2PXRC 2V4XA 2Y4ZA 1AK4C 2XGYA 1D1DA 1AFVA 1GWPA 5HGNA 3P05A 4INBA 1M9FC 2M8LA 1QRJA 3NTEA 4U0AA 4DGAC 4U0EA 4XFXA 2M8PA
chains in the Genus database with same CATH superfamily
1EIAA 2GONA 2XGVA 4PH3A 4U0BA 4XFYA 5JPAA 4PH2A 2PWOA 1M9XC 5HGLA 4XFZA 1M9DC 4NX4C 1M9YC 2WLVA 2PWMA 4XROA 1M9CC 3H4EA 1E6JP 2XDEA 4U0DA 5HGOA 1P7NA 3BP9A 2JPRA 4E91A 1L6NA 4J93A 1M9EC 4DGEC 4B4NA 2GOLB 2EIAA 4QNBA 4PH0A 2WLVB 2X82A 4E92A 4WYMA 4LQWC 4U0FA 4XRQA 2X2DD 3MGEA 1EM9A 1U7KA 4HTWA 5HGMA 2XGUA 2X83A 3H47A 2LF4A 2KGFA 5HGKA 1G03A 2M8NA 4U0CA 2PXRC 2V4XA 2Y4ZA 1AK4C 2XGYA 1D1DA 1AFVA 1GWPA 5HGNA 3P05A 4INBA 1M9FC 2M8LA 1QRJA 3NTEA 4U0AA 4DGAC 4U0EA 4XFXA 2M8PA
chains in the Genus database with same CATH topology
1EIAA 2GONA 2XGVA 4PH3A 4U0BA 4XFYA 5JPAA 4PH2A 2PWOA 1M9XC 5HGLA 4XFZA 1M9DC 4NX4C 1M9YC 2WLVA 2PWMA 4XROA 1M9CC 3H4EA 1E6JP 2XDEA 4U0DA 5HGOA 1P7NA 3BP9A 2JPRA 4E91A 1L6NA 4J93A 1M9EC 4DGEC 4B4NA 2GOLB 2EIAA 4QNBA 4PH0A 2WLVB 2X82A 4E92A 4WYMA 4LQWC 4U0FA 4XRQA 2X2DD 3MGEA 1EM9A 1U7KA 4HTWA 5HGMA 2XGUA 2X83A 3H47A 2LF4A 2KGFA 5HGKA 1G03A 2M8NA 4U0CA 2PXRC 2V4XA 2Y4ZA 1AK4C 2XGYA 1D1DA 1AFVA 1GWPA 5HGNA 3P05A 4INBA 1M9FC 2M8LA 1QRJA 3NTEA 4U0AA 4DGAC 4U0EA 4XFXA 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EIA A;  2GON A;  2XGV A;  4PH3 A;  4U0B A;  4XFY A;  5JPA A;  4PH2 A;  2PWO A;  1M9X C;  5HGL A;  4XFZ A;  1M9D C;  4NX4 C;  1M9Y C;  2WLV A;  2PWM A;  4XRO A;  1M9C C;  3H4E A;  1E6J P;  2XDE A;  4U0D A;  5HGO A;  1P7N A;  3BP9 A;  2JPR A;  4E91 A;  1L6N A;  4J93 A;  1M9E C;  4DGE C;  4B4N A;  2GOL B;  2EIA A;  4QNB A;  4PH0 A;  2WLV B;  2X82 A;  4E92 A;  4WYM A;  4LQW C;  4U0F A;  4XRQ A;  2X2D D;  3MGE A;  1EM9 A;  1U7K A;  4HTW A;  5HGM A;  2XGU A;  2X83 A;  3H47 A;  2LF4 A;  2KGF A;  5HGK A;  1G03 A;  2M8N A;  4U0C A;  2PXR C;  2V4X A;  2Y4Z A;  1AK4 C;  2XGY A;  1D1D A;  1AFV A;  1GWP A;  5HGN A;  3P05 A;  4INB A;  1M9F C;  2M8L A;  1QRJ A;  3NTE A;  4U0A A;  4DGA C;  4U0E A;  4XFX A;  2M8P A; 
#chains in the Genus database with same CATH topology
 1EIA A;  2GON A;  2XGV A;  4PH3 A;  4U0B A;  4XFY A;  5JPA A;  4PH2 A;  2PWO A;  1M9X C;  5HGL A;  4XFZ A;  1M9D C;  4NX4 C;  1M9Y C;  2WLV A;  2PWM A;  4XRO A;  1M9C C;  3H4E A;  1E6J P;  2XDE A;  4U0D A;  5HGO A;  1P7N A;  3BP9 A;  2JPR A;  4E91 A;  1L6N A;  4J93 A;  1M9E C;  4DGE C;  4B4N A;  2GOL B;  2EIA A;  4QNB A;  4PH0 A;  2WLV B;  2X82 A;  4E92 A;  4WYM A;  4LQW C;  4U0F A;  4XRQ A;  2X2D D;  3MGE A;  1EM9 A;  1U7K A;  4HTW A;  5HGM A;  2XGU A;  2X83 A;  3H47 A;  2LF4 A;  2KGF A;  5HGK A;  1G03 A;  2M8N A;  4U0C A;  2PXR C;  2V4X A;  2Y4Z A;  1AK4 C;  2XGY A;  1D1D A;  1AFV A;  1GWP A;  5HGN A;  3P05 A;  4INB A;  1M9F C;  2M8L A;  1QRJ A;  3NTE A;  4U0A A;  4DGA C;  4U0E A;  4XFX A;  2M8P A; 
#chains in the Genus database with same CATH homology
 1EIA A;  2GON A;  2XGV A;  4PH3 A;  4U0B A;  4XFY A;  5JPA A;  4PH2 A;  2PWO A;  1M9X C;  5HGL A;  4XFZ A;  1M9D C;  4NX4 C;  1M9Y C;  2WLV A;  2PWM A;  4XRO A;  1M9C C;  3H4E A;  1E6J P;  2XDE A;  4U0D A;  5HGO A;  1P7N A;  3BP9 A;  2JPR A;  4E91 A;  1L6N A;  4J93 A;  1M9E C;  4DGE C;  4B4N A;  2GOL B;  2EIA A;  4QNB A;  4PH0 A;  2WLV B;  2X82 A;  4E92 A;  4WYM A;  4LQW C;  4U0F A;  4XRQ A;  2X2D D;  3MGE A;  1EM9 A;  1U7K A;  4HTW A;  5HGM A;  2XGU A;  2X83 A;  3H47 A;  2LF4 A;  2KGF A;  5HGK A;  1G03 A;  2M8N A;  4U0C A;  2PXR C;  2V4X A;  2Y4Z A;  1AK4 C;  2XGY A;  1D1D A;  1AFV A;  1GWP A;  5HGN A;  3P05 A;  4INB A;  1M9F C;  2M8L A;  1QRJ A;  3NTE A;  4U0A A;  4DGA C;  4U0E A;  4XFX A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...