2WLVA

Structure of the n-terminal capsid domain of hiv-2
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
144
structure length
144
Chain Sequence
PVQHVGGTYTHIPLSPRTLNAWVKLVEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIREIINEEAAEWDVQHPIPGPLPAGQLREPRGSDIAGTTSTVEEQIQWMFRPQNPVPVGNIYRRWIQIGLQKCVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN
publication title Active Site Remodelling Switches HIV Specificity of Antiretroviral Trimcyp
pubmed doi rcsb
source organism Human immunodeficiency virus type 2 (isolate d194)
total genus 51
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2009-06-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2wlvA00
4DGEC 4HTWA 1EM9A 3BP9A 1E6JP 4PH3A 4U0FA 2XGUA 1U7KA 2X2DD 4XFYA 2M8PA 4J93A 1M9CC 4XRQA 1EIAA 4QNBA 4B4NA 4LQWC 4U0DA 2EIAA 4WYMA 3P05A 1AK4C 4XROA 4DGAC 4U0BA 5HGKA 2XGYA 4E92A 2M8LA 1M9DC 2PXRC 2KGFA 5HGOA 1AFVA 1M9XC 5HGMA 4PH0A 2JPRA 4U0CA 4PH2A 1M9YC 2Y4ZA 4NX4C 5HGLA 3H4EA 1G03A 4XFXA 3H47A 1L6NA 2X82A 4E91A 2LF4A 4U0EA 1M9FC 2PWMA 2WLVB 2GONA 2M8NA 4XFZA 1D1DA 3NTEA 5HGNA 1QRJA 4INBA 2PWOA 5JPAA 2X83A 2WLVA 2XDEA 4U0AA 1P7NA 3MGEA 2V4XA 1M9EC 2GOLB 2XGVA 1GWPA
chains in the Genus database with same CATH superfamily
4DGEC 4HTWA 1EM9A 3BP9A 1E6JP 4PH3A 4U0FA 2XGUA 1U7KA 2X2DD 4XFYA 2M8PA 4J93A 1M9CC 4XRQA 1EIAA 4QNBA 4B4NA 4LQWC 4U0DA 2EIAA 4WYMA 3P05A 1AK4C 4XROA 4DGAC 4U0BA 5HGKA 2XGYA 4E92A 2M8LA 1M9DC 2PXRC 2KGFA 5HGOA 1AFVA 1M9XC 5HGMA 4PH0A 2JPRA 4U0CA 4PH2A 1M9YC 2Y4ZA 4NX4C 5HGLA 3H4EA 1G03A 4XFXA 3H47A 1L6NA 2X82A 4E91A 2LF4A 4U0EA 1M9FC 2PWMA 2WLVB 2GONA 2M8NA 4XFZA 1D1DA 3NTEA 5HGNA 1QRJA 4INBA 2PWOA 5JPAA 2X83A 2WLVA 2XDEA 4U0AA 1P7NA 3MGEA 2V4XA 1M9EC 2GOLB 2XGVA 1GWPA
chains in the Genus database with same CATH topology
4DGEC 4HTWA 1EM9A 3BP9A 1E6JP 4PH3A 4U0FA 2XGUA 1U7KA 2X2DD 4XFYA 2M8PA 4J93A 1M9CC 4XRQA 1EIAA 4QNBA 4B4NA 4LQWC 4U0DA 2EIAA 4WYMA 3P05A 1AK4C 4XROA 4DGAC 4U0BA 5HGKA 2XGYA 4E92A 2M8LA 1M9DC 2PXRC 2KGFA 5HGOA 1AFVA 1M9XC 5HGMA 4PH0A 2JPRA 4U0CA 4PH2A 1M9YC 2Y4ZA 4NX4C 5HGLA 3H4EA 1G03A 4XFXA 3H47A 1L6NA 2X82A 4E91A 2LF4A 4U0EA 1M9FC 2PWMA 2WLVB 2GONA 2M8NA 4XFZA 1D1DA 3NTEA 5HGNA 1QRJA 4INBA 2PWOA 5JPAA 2X83A 2WLVA 2XDEA 4U0AA 1P7NA 3MGEA 2V4XA 1M9EC 2GOLB 2XGVA 1GWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGE C;  4HTW A;  1EM9 A;  3BP9 A;  1E6J P;  4PH3 A;  4U0F A;  2XGU A;  1U7K A;  2X2D D;  4XFY A;  2M8P A;  4J93 A;  1M9C C;  4XRQ A;  1EIA A;  4QNB A;  4B4N A;  4LQW C;  4U0D A;  2EIA A;  4WYM A;  3P05 A;  1AK4 C;  4XRO A;  4DGA C;  4U0B A;  5HGK A;  2XGY A;  4E92 A;  2M8L A;  1M9D C;  2PXR C;  2KGF A;  5HGO A;  1AFV A;  1M9X C;  5HGM A;  4PH0 A;  2JPR A;  4U0C A;  4PH2 A;  1M9Y C;  2Y4Z A;  4NX4 C;  5HGL A;  3H4E A;  1G03 A;  4XFX A;  3H47 A;  1L6N A;  2X82 A;  4E91 A;  2LF4 A;  4U0E A;  1M9F C;  2PWM A;  2WLV B;  2GON A;  2M8N A;  4XFZ A;  1D1D A;  3NTE A;  5HGN A;  1QRJ A;  4INB A;  2PWO A;  5JPA A;  2X83 A;  2WLV A;  2XDE A;  4U0A A;  1P7N A;  3MGE A;  2V4X A;  1M9E C;  2GOL B;  2XGV A;  1GWP A; 
#chains in the Genus database with same CATH topology
 4DGE C;  4HTW A;  1EM9 A;  3BP9 A;  1E6J P;  4PH3 A;  4U0F A;  2XGU A;  1U7K A;  2X2D D;  4XFY A;  2M8P A;  4J93 A;  1M9C C;  4XRQ A;  1EIA A;  4QNB A;  4B4N A;  4LQW C;  4U0D A;  2EIA A;  4WYM A;  3P05 A;  1AK4 C;  4XRO A;  4DGA C;  4U0B A;  5HGK A;  2XGY A;  4E92 A;  2M8L A;  1M9D C;  2PXR C;  2KGF A;  5HGO A;  1AFV A;  1M9X C;  5HGM A;  4PH0 A;  2JPR A;  4U0C A;  4PH2 A;  1M9Y C;  2Y4Z A;  4NX4 C;  5HGL A;  3H4E A;  1G03 A;  4XFX A;  3H47 A;  1L6N A;  2X82 A;  4E91 A;  2LF4 A;  4U0E A;  1M9F C;  2PWM A;  2WLV B;  2GON A;  2M8N A;  4XFZ A;  1D1D A;  3NTE A;  5HGN A;  1QRJ A;  4INB A;  2PWO A;  5JPA A;  2X83 A;  2WLV A;  2XDE A;  4U0A A;  1P7N A;  3MGE A;  2V4X A;  1M9E C;  2GOL B;  2XGV A;  1GWP A; 
#chains in the Genus database with same CATH homology
 4DGE C;  4HTW A;  1EM9 A;  3BP9 A;  1E6J P;  4PH3 A;  4U0F A;  2XGU A;  1U7K A;  2X2D D;  4XFY A;  2M8P A;  4J93 A;  1M9C C;  4XRQ A;  1EIA A;  4QNB A;  4B4N A;  4LQW C;  4U0D A;  2EIA A;  4WYM A;  3P05 A;  1AK4 C;  4XRO A;  4DGA C;  4U0B A;  5HGK A;  2XGY A;  4E92 A;  2M8L A;  1M9D C;  2PXR C;  2KGF A;  5HGO A;  1AFV A;  1M9X C;  5HGM A;  4PH0 A;  2JPR A;  4U0C A;  4PH2 A;  1M9Y C;  2Y4Z A;  4NX4 C;  5HGL A;  3H4E A;  1G03 A;  4XFX A;  3H47 A;  1L6N A;  2X82 A;  4E91 A;  2LF4 A;  4U0E A;  1M9F C;  2PWM A;  2WLV B;  2GON A;  2M8N A;  4XFZ A;  1D1D A;  3NTE A;  5HGN A;  1QRJ A;  4INB A;  2PWO A;  5JPA A;  2X83 A;  2WLV A;  2XDE A;  4U0A A;  1P7N A;  3MGE A;  2V4X A;  1M9E C;  2GOL B;  2XGV A;  1GWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...