4NX4C

Re-refinement of cap-1 hiv-ca complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
145
structure length
145
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein structural ensembles are revealed by redefining X-ray electron density noise.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Gag-Pol polyprotein
total genus 47
structure length 145
sequence length 145
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-12-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4nx4C00
1U7KA 2GONA 4PH2A 5HGOA 2WLVB 2XDEA 1M9XC 4U0AA 1EM9A 3H47A 4XRQA 1M9CC 4DGEC 2EIAA 2M8NA 2WLVA 1QRJA 2V4XA 3BP9A 1AK4C 2M8LA 4NX4C 2XGVA 1M9FC 2GOLB 4U0DA 2PWMA 3MGEA 4U0FA 1L6NA 2KGFA 4PH3A 1GWPA 3H4EA 2LF4A 4WYMA 2X2DD 2M8PA 1M9YC 4INBA 4E91A 4PH0A 2PXRC 2XGYA 3P05A 2PWOA 2JPRA 4U0BA 4XFZA 4E92A 5HGNA 5HGMA 2Y4ZA 5HGKA 4XROA 1M9EC 4LQWC 1AFVA 2X82A 4U0EA 5HGLA 5JPAA 2X83A 4XFYA 4QNBA 1M9DC 4U0CA 4XFXA 4HTWA 4B4NA 1P7NA 1E6JP 2XGUA 1D1DA 4DGAC 1G03A 4J93A 1EIAA 3NTEA
chains in the Genus database with same CATH superfamily
1U7KA 2GONA 4PH2A 5HGOA 2WLVB 2XDEA 1M9XC 4U0AA 1EM9A 3H47A 4XRQA 1M9CC 4DGEC 2EIAA 2M8NA 2WLVA 1QRJA 2V4XA 3BP9A 1AK4C 2M8LA 4NX4C 2XGVA 1M9FC 2GOLB 4U0DA 2PWMA 3MGEA 4U0FA 1L6NA 2KGFA 4PH3A 1GWPA 3H4EA 2LF4A 4WYMA 2X2DD 2M8PA 1M9YC 4INBA 4E91A 4PH0A 2PXRC 2XGYA 3P05A 2PWOA 2JPRA 4U0BA 4XFZA 4E92A 5HGNA 5HGMA 2Y4ZA 5HGKA 4XROA 1M9EC 4LQWC 1AFVA 2X82A 4U0EA 5HGLA 5JPAA 2X83A 4XFYA 4QNBA 1M9DC 4U0CA 4XFXA 4HTWA 4B4NA 1P7NA 1E6JP 2XGUA 1D1DA 4DGAC 1G03A 4J93A 1EIAA 3NTEA
chains in the Genus database with same CATH topology
1U7KA 2GONA 4PH2A 5HGOA 2WLVB 2XDEA 1M9XC 4U0AA 1EM9A 3H47A 4XRQA 1M9CC 4DGEC 2EIAA 2M8NA 2WLVA 1QRJA 2V4XA 3BP9A 1AK4C 2M8LA 4NX4C 2XGVA 1M9FC 2GOLB 4U0DA 2PWMA 3MGEA 4U0FA 1L6NA 2KGFA 4PH3A 1GWPA 3H4EA 2LF4A 4WYMA 2X2DD 2M8PA 1M9YC 4INBA 4E91A 4PH0A 2PXRC 2XGYA 3P05A 2PWOA 2JPRA 4U0BA 4XFZA 4E92A 5HGNA 5HGMA 2Y4ZA 5HGKA 4XROA 1M9EC 4LQWC 1AFVA 2X82A 4U0EA 5HGLA 5JPAA 2X83A 4XFYA 4QNBA 1M9DC 4U0CA 4XFXA 4HTWA 4B4NA 1P7NA 1E6JP 2XGUA 1D1DA 4DGAC 1G03A 4J93A 1EIAA 3NTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7K A;  2GON A;  4PH2 A;  5HGO A;  2WLV B;  2XDE A;  1M9X C;  4U0A A;  1EM9 A;  3H47 A;  4XRQ A;  1M9C C;  4DGE C;  2EIA A;  2M8N A;  2WLV A;  1QRJ A;  2V4X A;  3BP9 A;  1AK4 C;  2M8L A;  4NX4 C;  2XGV A;  1M9F C;  2GOL B;  4U0D A;  2PWM A;  3MGE A;  4U0F A;  1L6N A;  2KGF A;  4PH3 A;  1GWP A;  3H4E A;  2LF4 A;  4WYM A;  2X2D D;  2M8P A;  1M9Y C;  4INB A;  4E91 A;  4PH0 A;  2PXR C;  2XGY A;  3P05 A;  2PWO A;  2JPR A;  4U0B A;  4XFZ A;  4E92 A;  5HGN A;  5HGM A;  2Y4Z A;  5HGK A;  4XRO A;  1M9E C;  4LQW C;  1AFV A;  2X82 A;  4U0E A;  5HGL A;  5JPA A;  2X83 A;  4XFY A;  4QNB A;  1M9D C;  4U0C A;  4XFX A;  4HTW A;  4B4N A;  1P7N A;  1E6J P;  2XGU A;  1D1D A;  4DGA C;  1G03 A;  4J93 A;  1EIA A;  3NTE A; 
#chains in the Genus database with same CATH topology
 1U7K A;  2GON A;  4PH2 A;  5HGO A;  2WLV B;  2XDE A;  1M9X C;  4U0A A;  1EM9 A;  3H47 A;  4XRQ A;  1M9C C;  4DGE C;  2EIA A;  2M8N A;  2WLV A;  1QRJ A;  2V4X A;  3BP9 A;  1AK4 C;  2M8L A;  4NX4 C;  2XGV A;  1M9F C;  2GOL B;  4U0D A;  2PWM A;  3MGE A;  4U0F A;  1L6N A;  2KGF A;  4PH3 A;  1GWP A;  3H4E A;  2LF4 A;  4WYM A;  2X2D D;  2M8P A;  1M9Y C;  4INB A;  4E91 A;  4PH0 A;  2PXR C;  2XGY A;  3P05 A;  2PWO A;  2JPR A;  4U0B A;  4XFZ A;  4E92 A;  5HGN A;  5HGM A;  2Y4Z A;  5HGK A;  4XRO A;  1M9E C;  4LQW C;  1AFV A;  2X82 A;  4U0E A;  5HGL A;  5JPA A;  2X83 A;  4XFY A;  4QNB A;  1M9D C;  4U0C A;  4XFX A;  4HTW A;  4B4N A;  1P7N A;  1E6J P;  2XGU A;  1D1D A;  4DGA C;  1G03 A;  4J93 A;  1EIA A;  3NTE A; 
#chains in the Genus database with same CATH homology
 1U7K A;  2GON A;  4PH2 A;  5HGO A;  2WLV B;  2XDE A;  1M9X C;  4U0A A;  1EM9 A;  3H47 A;  4XRQ A;  1M9C C;  4DGE C;  2EIA A;  2M8N A;  2WLV A;  1QRJ A;  2V4X A;  3BP9 A;  1AK4 C;  2M8L A;  4NX4 C;  2XGV A;  1M9F C;  2GOL B;  4U0D A;  2PWM A;  3MGE A;  4U0F A;  1L6N A;  2KGF A;  4PH3 A;  1GWP A;  3H4E A;  2LF4 A;  4WYM A;  2X2D D;  2M8P A;  1M9Y C;  4INB A;  4E91 A;  4PH0 A;  2PXR C;  2XGY A;  3P05 A;  2PWO A;  2JPR A;  4U0B A;  4XFZ A;  4E92 A;  5HGN A;  5HGM A;  2Y4Z A;  5HGK A;  4XRO A;  1M9E C;  4LQW C;  1AFV A;  2X82 A;  4U0E A;  5HGL A;  5JPA A;  2X83 A;  4XFY A;  4QNB A;  1M9D C;  4U0C A;  4XFX A;  4HTW A;  4B4N A;  1P7N A;  1E6J P;  2XGU A;  1D1D A;  4DGA C;  1G03 A;  4J93 A;  1EIA A;  3NTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...