5HGOA

Hexameric hiv-1 ca r18g mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
219
structure length
205
Chain Sequence
PIVQNLQGQMVHQCISPGTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 75
structure length 205
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgoA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgoA02
2XGUA 1M9EC 4LQWC 4IPYA 4COPA 2XT1A 1AFVA 3VRLC 3G0VA 4PH1A 1AK4C 1M9DC 2V4XA 2M8PA 2M8NA 2X82A 3LRYA 5HGMA 2PXRC 2KODA 5DCKA 2XDEA 2WLVA 1EIAA 3DS4A 4U0FA 4E92A 2XV6A 1BAJA 3DS3A 4XFZA 2JYLA 4XFXA 2X83A 2WLVB 4PH2A 4J93A 2PWMA 2M8LA 1EM9A 5HGKA 4QNBA 3H47A 1E6JP 1D1DA 4HTWA 4U0EA 2LF4A 2KGFA 1A43A 1U7KA 2JPRA 2L6EA 4DGEC 3MGEA 2JO0A 3BP9A 3DS0A 2BUOA 1M9CC 5JPAA 1QRJA 3G1GA 4PH0A 4B4NA 2X2DD 4M0IA 4XFYA 4U0CA 1M9FC 3DPHA 2XGVA 1G03A 3G28A 4WYMA 5HGLA 4DGAC 3G26A 2EIAA 1M9XC 3G1IA 4PH3A 2JYGA 3G29A 4XRQA 3DS1A 3NTEA 3P05A 2PWOA 3DS2A 1M9YC 4U0DA 1P7NA 4U0BA 2GONA 5HGNA 5I4TG 3G21A 3DS5A 1A8OA 2GOLB 2XGYA 4U0AA 2XXMA 4XROA 4E91A 3DTJA 5HGOA 4NX4C 3H4EA 1EOQA 2ONTA 1GWPA 2Y4ZA 1L6NA 1AUMA 4COCA 4INBA
chains in the Genus database with same CATH superfamily
2N5HA 1Z6MA 3GJNA 1VQ7P 2M8PA 3EJDA 3CMAP 2PEJA 1VQPP 3Q20A 1RO0A 2PY8A 7CEIA 1VQOP 3CPWO 1EIAA 2N5IA 3DS4A 4BPHA 2ERHA 2GZEA 4E92A 1QVGO 3DS3A 2LKIA 2FVAA 2VLNA 4PH2A 2PWMA 2M8LA 2K92A 4QNBA 3H47A 1YI2P 1N8RQ 2DGYA 5EJDA 3MGEA 3GKLC 2AFEA 1IMQA 2BUOA 1YJWP 1OR5A 1KD1Q 2KGAA 2EHTA 4H2YC 2FHSC 3G4SP 3G71P 4PH0A 2X2DD 4M0IA 4XFYA 4U0CA 3E2DA 2FADA 3CCVP 2KOQA 2L4BA 2PEMA 4H2WC 3G26A 3G1IA 4PH3A 1VQ5P 1M6NA 3CCEP 5HV8A 3EJBA 2Z46A 2K0XA 2PWOA 2Z44A 1P7NA 3OW2O 4H2XC 5I4TG 2PEQA 1KC8Q 1ZMBA 2QA4P 5F2NA 2GDYA 2XXMA 1IUQA 3CCUP 1VQ4P 5F2OA 4GR2A 5BS1A 1EOQA 2Z45A 3RG2A 2KORA 1K73Q 3CCMP 1L6NA 1AUMA 5KP8B 1VQKP 4COCA 2K0DX 1Q82Q 1M9EC 4IPYA 3WBHA 2PEOA 3RG6C 2JB0A 1M9DC 1GXGA 2X82A 1AF8A 2OTJP 2JGPA 5HGMA 5F2KA 5DCKA 3B4QA 3I56P 1MZ8A 4QKOA 3G6EP 3GZMA 4U0FA 1BAJA 2VLQA 2X83A 2WLVB 1BXIA 2EHSA 1EM9A 5HGKA 1E6JP 1D1DA 3NY7B 4U0EA 1M74A 1VQ6P 1HQBA 2FQ2A 2KGFA 1A43A 1U7KA 2JPRA 4BPGA 2JO0A 3BP9A 3DS0A 4F37A 1YJNP 1EMVA 4UHPB 5JPAA 2JBGA 2N6ZA 3DPHA 2XGVA 3CCJP 2KG6A 1YHQP 5HGLA 2CNRA 3LMOA 2LIWA 2VSQA 5KP6B 2K94A 2PEIA 2FQ0A 4XRQA 1L0HA 2KOPA 2X2BA 2MR7A 1M1KQ 3DS2A 4U0DA 4U0BA 2P9XA 3CC7P 5HGNA 2LMLA 2OARA 3G21A 4BPFA 3H0DA 5KP7B 1A8OA 2MR8A 3CC4P 5HGOA 2KR5A 4NX4C 1UJZA 2KG8A 2BHVA 2XT1A 1AFVA 1KLPA 1Q81Q 1F80D 3VRLC 2KGDA 1DV5A 3G0VA 2K0YA 5CZDB 1AK4C 2V4XA 2N50A 2CG5B 1VQ9P 1T8KA 2LL8A 2PXRC 2KODA 2XDEA 2WLVA 1VQ8P 2CGQA 2XV6A 4XFZA 2JYLA 2KWLA 4IZ6A 4XFXA 2E1MA 2MVVA 2EG5A 1AYIA 2KOSA 4HTWA 5HVCA 2L22A 1CEIA 2LF4A 2KOOA 2L6EA 4DGEC 2GZJA 4CA3A 5BS2A 2K5XA 1M9CC 1QRJA 3G1GA 1ACPA 1IMPA 4B4NA 2LTEA 2JAZA 3CCRP 3G28A 4WYMA 4DGAC 3HYBA 2LPKA 2AVAA 1YITP 1DNYA 1M9XC 2JYGA 2GZGA 1Q86Q 1VHNA 2JU1A 3CMEP 1ZNVA 3CCQP 2K93A 2GYKA 2PNGA 1M6EX 2CWOA 1VQMP 3CD6P 2FVEA 4R0MA 2MD9A 3CC2P 1M9YC 1RO2A 1GPJA 2N6YA 2AF8A 2NO8A 1YJ9P 2LOLA 2ROQA 2GOLB 4U0AA 4XROA 1GXHA 4E91A 2PENA 2FQ1A 2GDWA 2MVUA 2FAEA 2ONTA 4NEOA 2Y4ZA 2QNWA 4INBA 1QVFO 1S72P 2FVFA 2XGUA 4LQWC 4COPA 2PEKA 2VLOA 2GZIA 1VQNP 3CXCO 1K9MQ 4PH1A 1W2BO 4PWVB 1RNIA 2M8NA 1L0IA 3CCSP 4MRTC 3LRYA 2QEXP 1YIJP 2KG9A 1X3OA 1VKUA 4GR6A 1HY8A 2L0QA 4J93A 2XZ0D 2FACA 1M90Q 2LIUA 2JU2A 2XZ1C 2N98A 1JJ2O 2KGEA 2MY5A 4HKGA 4PXHB 2DNWA 2OTLP 2WPTA 3HZQA 2GDXA 1K30A 2M5RA 1M9FC 1G03A 4DG9A 1FR2A 3EJEA 1E0HA 1VQLP 2MF4A 2EIAA 1K8AQ 2VLPA 3CCLP 2GZFA 3CE7A 1NQ4A 1UNKA 3G29A 2L9FA 1KQSO 2KW2A 2KGCA 3DS1A 2JQ4A 3NTEA 3P05A 3M1MA 1Q7YQ 2GONA 3DS5A 3U43A 2XGYA 2CQ8A 2EFJA 3DTJA 3GZLA 5EW5E 3H4EA 2AFDA 2K2QA 1GWPA 3I55P 3B5IA 1NJIQ
chains in the Genus database with same CATH topology
1QVFO 1S72P 2XGUA 1M9EC 1Q82Q 4LQWC 4IPYA 4COPA 2PEKA 1AFVA 2XT1A 3WBHA 1Q81Q 1VQ7P 3VRLC 2PEOA 1VQNP 3RG6C 3CXCO 3G0VA 1K9MQ 4PH1A 1AK4C 1M9DC 2V4XA 2M8PA 1W2BO 1RNIA 2M8NA 2PEJA 2X82A 3CMAP 1VQPP 3Q20A 2OTJP 3CCSP 1YIJP 1RO0A 3LRYA 2QEXP 1VQ9P 5HGMA 2PXRC 2KODA 5F2KA 5DCKA 2XDEA 2PY8A 3I56P 2WLVA 1VQOP 1VQ8P 3CPWO 1EIAA 3DS4A 3G6EP 4U0FA 4E92A 2XV6A 1BAJA 3DS3A 4XFZA 2JYLA 1QVGO 4GR6A 4XFXA 2X83A 2E1MA 2WLVB 4PH2A 4J93A 2EG5A 2PWMA 2M8LA 1EM9A 5HGKA 4QNBA 3H47A 1YI2P 1E6JP 1N8RQ 1D1DA 2DGYA 4HTWA 1M90Q 4U0EA 1M74A 1VQ6P 2LF4A 2KGFA 1A43A 1U7KA 2JPRA 2L6EA 4DGEC 3MGEA 2JO0A 1JJ2O 3BP9A 3DS0A 1YJNP 2BUOA 5BS2A 2OTLP 1YJWP 1M9CC 5JPAA 1KD1Q 3HZQA 1QRJA 1K30A 3G1GA 3G4SP 3G71P 4PH0A 4B4NA 2X2DD 4M0IA 4XFYA 4U0CA 3E2DA 1M9FC 3DPHA 2XGVA 1G03A 3CCJP 3CCVP 1YHQP 1VQLP 3CCRP 3G28A 4WYMA 5HGLA 4DGAC 2PEMA 3HYBA 1YITP 3G26A 2EIAA 1M9XC 1K8AQ 3G1IA 4PH3A 2JYGA 1Q86Q 1VQ5P 3CCLP 1M6NA 3CMEP 3G29A 3CCQP 3CCEP 2PEIA 1KQSO 4XRQA 1M6EX 3DS1A 2CWOA 2Z46A 1VQMP 3NTEA 3CD6P 3P05A 1M1KQ 2PWOA 3M1MA 3DS2A 2Z44A 1M9YC 4U0DA 1P7NA 4U0BA 1RO2A 3OW2O 2P9XA 1Q7YQ 3CC2P 3CC7P 2GONA 5HGNA 2PEQA 2OARA 3G21A 5I4TG 3H0DA 1KC8Q 3DS5A 1YJ9P 1ZMBA 1A8OA 2GOLB 2QA4P 5F2NA 3CC4P 2XGYA 4U0AA 2XXMA 4XROA 1IUQA 2EFJA 3CCUP 1VQ4P 4E91A 3DTJA 5HGOA 2PENA 5F2OA 4NX4C 3H4EA 4GR2A 5BS1A 1EOQA 2Z45A 2ONTA 1GWPA 3I55P 2Y4ZA 1K73Q 3B5IA 3CCMP 1L6NA 1NJIQ 1AUMA 2BHVA 1VQKP 4COCA 4INBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGU A;  1M9E C;  4LQW C;  4IPY A;  4COP A;  2XT1 A;  1AFV A;  3VRL C;  3G0V A;  4PH1 A;  1AK4 C;  1M9D C;  2V4X A;  2M8P A;  2M8N A;  2X82 A;  3LRY A;  5HGM A;  2PXR C;  2KOD A;  5DCK A;  2XDE A;  2WLV A;  1EIA A;  3DS4 A;  4U0F A;  4E92 A;  2XV6 A;  1BAJ A;  3DS3 A;  4XFZ A;  2JYL A;  4XFX A;  2X83 A;  2WLV B;  4PH2 A;  4J93 A;  2PWM A;  2M8L A;  1EM9 A;  5HGK A;  4QNB A;  3H47 A;  1E6J P;  1D1D A;  4HTW A;  4U0E A;  2LF4 A;  2KGF A;  1A43 A;  1U7K A;  2JPR A;  2L6E A;  4DGE C;  3MGE A;  2JO0 A;  3BP9 A;  3DS0 A;  2BUO A;  1M9C C;  5JPA A;  1QRJ A;  3G1G A;  4PH0 A;  4B4N A;  2X2D D;  4M0I A;  4XFY A;  4U0C A;  1M9F C;  3DPH A;  2XGV A;  1G03 A;  3G28 A;  4WYM A;  5HGL A;  4DGA C;  3G26 A;  2EIA A;  1M9X C;  3G1I A;  4PH3 A;  2JYG A;  3G29 A;  4XRQ A;  3DS1 A;  3NTE A;  3P05 A;  2PWO A;  3DS2 A;  1M9Y C;  4U0D A;  1P7N A;  4U0B A;  2GON A;  5HGN A;  5I4T G;  3G21 A;  3DS5 A;  1A8O A;  2GOL B;  2XGY A;  4U0A A;  2XXM A;  4XRO A;  4E91 A;  3DTJ A;  5HGO A;  4NX4 C;  3H4E A;  1EOQ A;  2ONT A;  1GWP A;  2Y4Z A;  1L6N A;  1AUM A;  4COC A;  4INB A; 
#chains in the Genus database with same CATH topology
 2N5H A;  1Z6M A;  3GJN A;  1VQ7 P;  2M8P A;  3EJD A;  3CMA P;  2PEJ A;  1VQP P;  3Q20 A;  1RO0 A;  2PY8 A;  7CEI A;  1VQO P;  3CPW O;  1EIA A;  2N5I A;  3DS4 A;  4BPH A;  2ERH A;  2GZE A;  4E92 A;  1QVG O;  3DS3 A;  2LKI A;  2FVA A;  2VLN A;  4PH2 A;  2PWM A;  2M8L A;  2K92 A;  4QNB A;  3H47 A;  1YI2 P;  1N8R Q;  2DGY A;  5EJD A;  3MGE A;  3GKL C;  2AFE A;  1IMQ A;  2BUO A;  1YJW P;  1OR5 A;  1KD1 Q;  2KGA A;  2EHT A;  4H2Y C;  2FHS C;  3G4S P;  3G71 P;  4PH0 A;  2X2D D;  4M0I A;  4XFY A;  4U0C A;  3E2D A;  2FAD A;  3CCV P;  2KOQ A;  2L4B A;  2PEM A;  4H2W C;  3G26 A;  3G1I A;  4PH3 A;  1VQ5 P;  1M6N A;  3CCE P;  5HV8 A;  3EJB A;  2Z46 A;  2K0X A;  2PWO A;  2Z44 A;  1P7N A;  3OW2 O;  4H2X C;  5I4T G;  2PEQ A;  1KC8 Q;  1ZMB A;  2QA4 P;  5F2N A;  2GDY A;  2XXM A;  1IUQ A;  3CCU P;  1VQ4 P;  5F2O A;  4GR2 A;  5BS1 A;  1EOQ A;  2Z45 A;  3RG2 A;  2KOR A;  1K73 Q;  3CCM P;  1L6N A;  1AUM A;  5KP8 B;  1VQK P;  4COC A;  2K0D X;  1Q82 Q;  1M9E C;  4IPY A;  3WBH A;  2PEO A;  3RG6 C;  2JB0 A;  1M9D C;  1GXG A;  2X82 A;  1AF8 A;  2OTJ P;  2JGP A;  5HGM A;  5F2K A;  5DCK A;  3B4Q A;  3I56 P;  1MZ8 A;  4QKO A;  3G6E P;  3GZM A;  4U0F A;  1BAJ A;  2VLQ A;  2X83 A;  2WLV B;  1BXI A;  2EHS A;  1EM9 A;  5HGK A;  1E6J P;  1D1D A;  3NY7 B;  4U0E A;  1M74 A;  1VQ6 P;  1HQB A;  2FQ2 A;  2KGF A;  1A43 A;  1U7K A;  2JPR A;  4BPG A;  2JO0 A;  3BP9 A;  3DS0 A;  4F37 A;  1YJN P;  1EMV A;  4UHP B;  5JPA A;  2JBG A;  2N6Z A;  3DPH A;  2XGV A;  3CCJ P;  2KG6 A;  1YHQ P;  5HGL A;  2CNR A;  3LMO A;  2LIW A;  2VSQ A;  5KP6 B;  2K94 A;  2PEI A;  2FQ0 A;  4XRQ A;  1L0H A;  2KOP A;  2X2B A;  2MR7 A;  1M1K Q;  3DS2 A;  4U0D A;  4U0B A;  2P9X A;  3CC7 P;  5HGN A;  2LML A;  2OAR A;  3G21 A;  4BPF A;  3H0D A;  5KP7 B;  1A8O A;  2MR8 A;  3CC4 P;  5HGO A;  2KR5 A;  4NX4 C;  1UJZ A;  2KG8 A;  2BHV A;  2XT1 A;  1AFV A;  1KLP A;  1Q81 Q;  1F80 D;  3VRL C;  2KGD A;  1DV5 A;  3G0V A;  2K0Y A;  5CZD B;  1AK4 C;  2V4X A;  2N50 A;  2CG5 B;  1VQ9 P;  1T8K A;  2LL8 A;  2PXR C;  2KOD A;  2XDE A;  2WLV A;  1VQ8 P;  2CGQ A;  2XV6 A;  4XFZ A;  2JYL A;  2KWL A;  4IZ6 A;  4XFX A;  2E1M A;  2MVV A;  2EG5 A;  1AYI A;  2KOS A;  4HTW A;  5HVC A;  2L22 A;  1CEI A;  2LF4 A;  2KOO A;  2L6E A;  4DGE C;  2GZJ A;  4CA3 A;  5BS2 A;  2K5X A;  1M9C C;  1QRJ A;  3G1G A;  1ACP A;  1IMP A;  4B4N A;  2LTE A;  2JAZ A;  3CCR P;  3G28 A;  4WYM A;  4DGA C;  3HYB A;  2LPK A;  2AVA A;  1YIT P;  1DNY A;  1M9X C;  2JYG A;  2GZG A;  1Q86 Q;  1VHN A;  2JU1 A;  3CME P;  1ZNV A;  3CCQ P;  2K93 A;  2GYK A;  2PNG A;  1M6E X;  2CWO A;  1VQM P;  3CD6 P;  2FVE A;  4R0M A;  2MD9 A;  3CC2 P;  1M9Y C;  1RO2 A;  1GPJ A;  2N6Y A;  2AF8 A;  2NO8 A;  1YJ9 P;  2LOL A;  2ROQ A;  2GOL B;  4U0A A;  4XRO A;  1GXH A;  4E91 A;  2PEN A;  2FQ1 A;  2GDW A;  2MVU A;  2FAE A;  2ONT A;  4NEO A;  2Y4Z A;  2QNW A;  4INB A;  1QVF O;  1S72 P;  2FVF A;  2XGU A;  4LQW C;  4COP A;  2PEK A;  2VLO A;  2GZI A;  1VQN P;  3CXC O;  1K9M Q;  4PH1 A;  1W2B O;  4PWV B;  1RNI A;  2M8N A;  1L0I A;  3CCS P;  4MRT C;  3LRY A;  2QEX P;  1YIJ P;  2KG9 A;  1X3O A;  1VKU A;  4GR6 A;  1HY8 A;  2L0Q A;  4J93 A;  2XZ0 D;  2FAC A;  1M90 Q;  2LIU A;  2JU2 A;  2XZ1 C;  2N98 A;  1JJ2 O;  2KGE A;  2MY5 A;  4HKG A;  4PXH B;  2DNW A;  2OTL P;  2WPT A;  3HZQ A;  2GDX A;  1K30 A;  2M5R A;  1M9F C;  1G03 A;  4DG9 A;  1FR2 A;  3EJE A;  1E0H A;  1VQL P;  2MF4 A;  2EIA A;  1K8A Q;  2VLP A;  3CCL P;  2GZF A;  3CE7 A;  1NQ4 A;  1UNK A;  3G29 A;  2L9F A;  1KQS O;  2KW2 A;  2KGC A;  3DS1 A;  2JQ4 A;  3NTE A;  3P05 A;  3M1M A;  1Q7Y Q;  2GON A;  3DS5 A;  3U43 A;  2XGY A;  2CQ8 A;  2EFJ A;  3DTJ A;  3GZL A;  5EW5 E;  3H4E A;  2AFD A;  2K2Q A;  1GWP A;  3I55 P;  3B5I A;  1NJI Q; 
#chains in the Genus database with same CATH homology
 1QVF O;  1S72 P;  2XGU A;  1M9E C;  1Q82 Q;  4LQW C;  4IPY A;  4COP A;  2PEK A;  1AFV A;  2XT1 A;  3WBH A;  1Q81 Q;  1VQ7 P;  3VRL C;  2PEO A;  1VQN P;  3RG6 C;  3CXC O;  3G0V A;  1K9M Q;  4PH1 A;  1AK4 C;  1M9D C;  2V4X A;  2M8P A;  1W2B O;  1RNI A;  2M8N A;  2PEJ A;  2X82 A;  3CMA P;  1VQP P;  3Q20 A;  2OTJ P;  3CCS P;  1YIJ P;  1RO0 A;  3LRY A;  2QEX P;  1VQ9 P;  5HGM A;  2PXR C;  2KOD A;  5F2K A;  5DCK A;  2XDE A;  2PY8 A;  3I56 P;  2WLV A;  1VQO P;  1VQ8 P;  3CPW O;  1EIA A;  3DS4 A;  3G6E P;  4U0F A;  4E92 A;  2XV6 A;  1BAJ A;  3DS3 A;  4XFZ A;  2JYL A;  1QVG O;  4GR6 A;  4XFX A;  2X83 A;  2E1M A;  2WLV B;  4PH2 A;  4J93 A;  2EG5 A;  2PWM A;  2M8L A;  1EM9 A;  5HGK A;  4QNB A;  3H47 A;  1YI2 P;  1E6J P;  1N8R Q;  1D1D A;  2DGY A;  4HTW A;  1M90 Q;  4U0E A;  1M74 A;  1VQ6 P;  2LF4 A;  2KGF A;  1A43 A;  1U7K A;  2JPR A;  2L6E A;  4DGE C;  3MGE A;  2JO0 A;  1JJ2 O;  3BP9 A;  3DS0 A;  1YJN P;  2BUO A;  5BS2 A;  2OTL P;  1YJW P;  1M9C C;  5JPA A;  1KD1 Q;  3HZQ A;  1QRJ A;  1K30 A;  3G1G A;  3G4S P;  3G71 P;  4PH0 A;  4B4N A;  2X2D D;  4M0I A;  4XFY A;  4U0C A;  3E2D A;  1M9F C;  3DPH A;  2XGV A;  1G03 A;  3CCJ P;  3CCV P;  1YHQ P;  1VQL P;  3CCR P;  3G28 A;  4WYM A;  5HGL A;  4DGA C;  2PEM A;  3HYB A;  1YIT P;  3G26 A;  2EIA A;  1M9X C;  1K8A Q;  3G1I A;  4PH3 A;  2JYG A;  1Q86 Q;  1VQ5 P;  3CCL P;  1M6N A;  3CME P;  3G29 A;  3CCQ P;  3CCE P;  2PEI A;  1KQS O;  4XRQ A;  1M6E X;  3DS1 A;  2CWO A;  2Z46 A;  1VQM P;  3NTE A;  3CD6 P;  3P05 A;  1M1K Q;  2PWO A;  3M1M A;  3DS2 A;  2Z44 A;  1M9Y C;  4U0D A;  1P7N A;  4U0B A;  1RO2 A;  3OW2 O;  2P9X A;  1Q7Y Q;  3CC2 P;  3CC7 P;  2GON A;  5HGN A;  2PEQ A;  2OAR A;  3G21 A;  5I4T G;  3H0D A;  1KC8 Q;  3DS5 A;  1YJ9 P;  1ZMB A;  1A8O A;  2GOL B;  2QA4 P;  5F2N A;  3CC4 P;  2XGY A;  4U0A A;  2XXM A;  4XRO A;  1IUQ A;  2EFJ A;  3CCU P;  1VQ4 P;  4E91 A;  3DTJ A;  5HGO A;  2PEN A;  5F2O A;  4NX4 C;  3H4E A;  4GR2 A;  5BS1 A;  1EOQ A;  2Z45 A;  2ONT A;  1GWP A;  3I55 P;  2Y4Z A;  1K73 Q;  3B5I A;  3CCM P;  1L6N A;  1NJI Q;  1AUM A;  2BHV A;  1VQK P;  4COC A;  4INB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...