5HGOA

Hexameric hiv-1 ca r18g mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
219
structure length
205
Chain Sequence
PIVQNLQGQMVHQCISPGTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein P24
total genus 75
structure length 205
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgoA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgoA02
1G03A 3DS2A 3G26A 2X83A 2GONA 5HGMA 4E91A 3DTJA 4PH1A 4PH3A 4XROA 1AK4C 4XFXA 4E92A 4COCA 4WYMA 2KGFA 2M8LA 2XGYA 4U0FA 3NTEA 5HGNA 2M8NA 3DS5A 1P7NA 1M9DC 3MGEA 2PWMA 1QRJA 2X2DD 2EIAA 1GWPA 4INBA 4QNBA 2WLVB 1M9CC 1M9XC 4U0DA 1AFVA 4M0IA 4DGAC 5I4TG 2XGVA 2PWOA 2XDEA 3P05A 3H4EA 1A8OA 2JYLA 4PH0A 2M8PA 1L6NA 3BP9A 2JYGA 1E6JP 1EM9A 4U0BA 4LQWC 4U0AA 5HGLA 2XT1A 3H47A 4COPA 2BUOA 3G0VA 2V4XA 1M9YC 2JO0A 2WLVA 2X82A 2PXRC 1M9EC 3G1GA 3VRLC 1AUMA 3DS1A 2JPRA 1EIAA 4IPYA 4B4NA 3G1IA 4XFZA 2Y4ZA 3G21A 5DCKA 1M9FC 1BAJA 5JPAA 2L6EA 3G29A 4XFYA 5HGKA 3DS0A 3G28A 4PH2A 2KODA 4U0CA 3DPHA 1EOQA 4U0EA 2XGUA 5HGOA 3DS3A 1A43A 1D1DA 3LRYA 3DS4A 4NX4C 4J93A 4XRQA 4DGEC 2LF4A 2XV6A 4HTWA 2GOLB 2ONTA 2XXMA 1U7KA
chains in the Genus database with same CATH superfamily
3HYBA 2E1MA 2Z46A 2GZGA 4E91A 7CEIA 1L0IA 4XROA 1UJZA 4XFXA 4WYMA 1VHNA 5HV8A 4HKGA 1UNKA 2JAZA 2WPTA 5HGNA 3G71P 1P7NA 1ZMBA 1YHQP 3I56P 2PWMA 1QRJA 2PEKA 3M1MA 2L4BA 1X3OA 3RG2A 1M9XC 1AFVA 4R0MA 1N8RQ 2GZFA 2KG9A 2KGEA 2PEOA 2LPKA 2XGVA 2L9FA 2PNGA 1VQNP 2LKIA 2L0QA 3OW2O 2JYLA 3BP9A 2JYGA 2KGCA 1AYIA 1EM9A 4U0BA 2AF8A 2CG5B 2BUOA 1ZNVA 2CNRA 2K0DX 1T8KA 3H0DA 1VQ9P 1YJNP 2X82A 2GZIA 3VRLC 3CCQP 1AUMA 4IPYA 4B4NA 3G1IA 3GJNA 4MRTC 2GDYA 1M9FC 5JPAA 2L6EA 3NY7B 2AFEA 2BHVA 2PEQA 5HVCA 1K30A 3G28A 4PH2A 2EHSA 2LIUA 2ROQA 4J93A 3CC4P 4XRQA 1VQLP 3EJEA 4BPGA 2GOLB 4GR2A 2K92A 1U7KA 1MZ8A 3CCMP 3DS2A 1W2BO 1KD1Q 4PH3A 2KGDA 4COCA 4E92A 2KGFA 1VQPP 2CGQA 4U0FA 4H2XC 2LOLA 3DS5A 4IZ6A 2VLQA 3HZQA 3GZLA 4INBA 4QNBA 1M90Q 1GXGA 4F37A 2LTEA 2MVVA 2KOSA 1VQMP 1YJ9P 3CMEP 2FQ1A 2K0XA 2GDXA 2N5IA 3H4EA 1VQ5P 4PH0A 2N5HA 5KP8B 1L6NA 1K9MQ 2JGPA 4LQWC 2N98A 2XT1A 4BPFA 2XZ1C 2JQ4A 5CZDB 2N50A 2VLNA 1Q82Q 2JO0A 1DNYA 2MY5A 2ERHA 2JB0A 2KGAA 3G1GA 1M9EC 2KG8A 3DS1A 5EJDA 1VQKP 2VLOA 1L0HA 4XFZA 3CCUP 3G21A 2LMLA 1KC8Q 3DS0A 2FVFA 2KODA 4U0CA 2K93A 2XGUA 2GYKA 3DS3A 4H2WC 2PENA 3G4SP 3LMOA 2FQ0A 4NX4C 2FACA 2JBGA 1VQ7P 2K5XA 2FAEA 2LF4A 4HTWA 2L22A 2PY8A 1RO0A 2JU1A 1HQBA 2KOOA 1Z6MA 4PXHB 3G26A 2GONA 3CPWO 2X2BA 1IUQA 2K0YA 4H2YC 2FADA 1VQ6P 1KLPA 3NTEA 4BPHA 1M6EX 2M8NA 2PEMA 3RG6C 2Z44A 2N6ZA 3MGEA 2MR8A 2QA4P 1VQ8P 2X2DD 2EIAA 1GWPA 4U0DA 1M9CC 2DNWA 2OTJP 4CA3A 5BS1A 2LIWA 2P9XA 4DGAC 5I4TG 1QVGO 2MVUA 3EJBA 1ACPA 3WBHA 1E6JP 4U0AA 3CCRP 3CC7P 5HGLA 2XZ0D 1K73Q 4COPA 1FR2A 3CCEP 2Z45A 3CD6P 1YI2P 3G0VA 2V4XA 1M9YC 3GZMA 1EIAA 2FVAA 3CCLP 2GZEA 1BXIA 1VKUA 5DCKA 1YITP 1BAJA 3G29A 5F2NA 1RO2A 1Q7YQ 5HGKA 4GR6A 1IMPA 2OARA 3CC2P 1EOQA 4U0EA 3B4QA 3CMAP 1A43A 2KORA 5F2KA 3CCJP 3LRYA 2PEIA 1M6NA 2FQ2A 1KQSO 1M1KQ 4DG9A 1OR5A 2XV6A 2ONTA 2XXMA 1VQ4P 1NJIQ 3EJDA 2KW2A 1G03A 2N6YA 1RNIA 3CE7A 2DGYA 3CCSP 1M74A 5BS2A 2X83A 5HGMA 3DTJA 4PH1A 2MF4A 1CEIA 1AK4C 1QVFO 1Q81Q 1IMQA 1Q86Q 2M8LA 2XGYA 3CCVP 1EMVA 2QNWA 1M9DC 4NEOA 3E2DA 2CQ8A 3GKLC 2KOQA 2WLVB 4M0IA 2KWLA 1E0HA 2GZJA 1JJ2O 1YJWP 2MR7A 2KR5A 2FHSC 2AVAA 1YIJP 2EHTA 1HY8A 2PWOA 2NO8A 5KP7B 3CXCO 1VQOP 2XDEA 2VSQA 3P05A 1A8OA 2M8PA 2QEXP 5KP6B 2MD9A 5F2OA 3H47A 1AF8A 2VLPA 2FVEA 2CWOA 2OTLP 2WLVA 5EW5E 2PXRC 2K2QA 2JPRA 1GXHA 3I55P 2Y4ZA 4PWVB 3G6EP 2EFJA 2GDWA 4XFYA 1GPJA 2AFDA 2K94A 1F80D 2KG6A 2PEJA 3DPHA 4QKOA 5HGOA 3U43A 1D1DA 4UHPB 1S72P 3DS4A 3B5IA 2KOPA 1DV5A 3Q20A 4DGEC 2LL8A 2M5RA 2EG5A 1K8AQ 1NQ4A 2JU2A
chains in the Genus database with same CATH topology
1G03A 3HYBA 2E1MA 2Z46A 1RNIA 3CCMP 2DGYA 3DS2A 1M74A 3G26A 3CCSP 5BS2A 2X83A 2GONA 3CPWO 5HGMA 4E91A 1IUQA 3DTJA 4PH3A 4PH1A 1W2BO 1KD1Q 4XROA 1AK4C 4XFXA 4E92A 4COCA 4WYMA 1QVFO 1Q81Q 2KGFA 1VQPP 1Q86Q 2M8LA 2XGYA 4U0FA 1VQ6P 3NTEA 1M6EX 5HGNA 3G71P 2M8NA 3CCVP 3DS5A 2PEMA 1P7NA 1ZMBA 3RG6C 1YHQP 2Z44A 1M9DC 3MGEA 2PWMA 1QRJA 3I56P 2QA4P 2PEKA 3M1MA 3E2DA 1VQ8P 3HZQA 2X2DD 2EIAA 1GWPA 4INBA 4QNBA 2WLVB 1M9CC 1M9XC 4U0DA 1AFVA 4M0IA 1M90Q 2OTJP 5BS1A 1N8RQ 1JJ2O 1YJWP 2P9XA 4DGAC 5I4TG 1YIJP 2PEOA 1VQMP 1YJ9P 2XGVA 1QVGO 3CMEP 2PWOA 1VQNP 3CXCO 1VQOP 2XDEA 3P05A 3OW2O 3H4EA 1A8OA 2JYLA 4PH0A 1VQ5P 2M8PA 1L6NA 3BP9A 2JYGA 3WBHA 2QEXP 1K9MQ 1E6JP 1EM9A 5F2OA 4U0BA 4LQWC 4U0AA 3CCRP 3CC7P 5HGLA 2XT1A 1K73Q 3H47A 4COPA 2BUOA 3CCEP 2Z45A 3CD6P 1YI2P 3G0VA 3H0DA 2CWOA 1VQ9P 1YJNP 1Q82Q 2V4XA 1M9YC 2JO0A 2OTLP 2WLVA 2X82A 2PXRC 1M9EC 3G1GA 3VRLC 1AUMA 3CCQP 3DS1A 2JPRA 1VQKP 1EIAA 4IPYA 3CCLP 4B4NA 3G1IA 4XFZA 3CCUP 3I55P 2Y4ZA 3G21A 3G6EP 5DCKA 1M9FC 1YITP 1BAJA 5JPAA 2EFJA 2L6EA 4XFYA 3G29A 5F2NA 1RO2A 2BHVA 2PEQA 5HGKA 1Q7YQ 1K30A 4GR6A 1KC8Q 3DS0A 3G28A 4PH2A 2KODA 2OARA 2PEJA 4U0CA 3CC2P 3DPHA 1EOQA 4U0EA 2XGUA 5HGOA 3DS3A 3CMAP 1A43A 1D1DA 5F2KA 2PENA 1S72P 3G4SP 3CCJP 3LRYA 3DS4A 2PEIA 1M6NA 3B5IA 4NX4C 4J93A 3Q20A 1KQSO 3CC4P 4XRQA 1VQ7P 4DGEC 1M1KQ 1VQLP 2LF4A 2XV6A 4HTWA 2GOLB 2EG5A 4GR2A 2PY8A 1RO0A 2ONTA 1K8AQ 2XXMA 1VQ4P 1NJIQ 1U7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G03 A;  3DS2 A;  3G26 A;  2X83 A;  2GON A;  5HGM A;  4E91 A;  3DTJ A;  4PH1 A;  4PH3 A;  4XRO A;  1AK4 C;  4XFX A;  4E92 A;  4COC A;  4WYM A;  2KGF A;  2M8L A;  2XGY A;  4U0F A;  3NTE A;  5HGN A;  2M8N A;  3DS5 A;  1P7N A;  1M9D C;  3MGE A;  2PWM A;  1QRJ A;  2X2D D;  2EIA A;  1GWP A;  4INB A;  4QNB A;  2WLV B;  1M9C C;  1M9X C;  4U0D A;  1AFV A;  4M0I A;  4DGA C;  5I4T G;  2XGV A;  2PWO A;  2XDE A;  3P05 A;  3H4E A;  1A8O A;  2JYL A;  4PH0 A;  2M8P A;  1L6N A;  3BP9 A;  2JYG A;  1E6J P;  1EM9 A;  4U0B A;  4LQW C;  4U0A A;  5HGL A;  2XT1 A;  3H47 A;  4COP A;  2BUO A;  3G0V A;  2V4X A;  1M9Y C;  2JO0 A;  2WLV A;  2X82 A;  2PXR C;  1M9E C;  3G1G A;  3VRL C;  1AUM A;  3DS1 A;  2JPR A;  1EIA A;  4IPY A;  4B4N A;  3G1I A;  4XFZ A;  2Y4Z A;  3G21 A;  5DCK A;  1M9F C;  1BAJ A;  5JPA A;  2L6E A;  3G29 A;  4XFY A;  5HGK A;  3DS0 A;  3G28 A;  4PH2 A;  2KOD A;  4U0C A;  3DPH A;  1EOQ A;  4U0E A;  2XGU A;  5HGO A;  3DS3 A;  1A43 A;  1D1D A;  3LRY A;  3DS4 A;  4NX4 C;  4J93 A;  4XRQ A;  4DGE C;  2LF4 A;  2XV6 A;  4HTW A;  2GOL B;  2ONT A;  2XXM A;  1U7K A; 
#chains in the Genus database with same CATH topology
 3HYB A;  2E1M A;  2Z46 A;  2GZG A;  4E91 A;  7CEI A;  1L0I A;  4XRO A;  1UJZ A;  4XFX A;  4WYM A;  1VHN A;  5HV8 A;  4HKG A;  1UNK A;  2JAZ A;  2WPT A;  5HGN A;  3G71 P;  1P7N A;  1ZMB A;  1YHQ P;  3I56 P;  2PWM A;  1QRJ A;  2PEK A;  3M1M A;  2L4B A;  1X3O A;  3RG2 A;  1M9X C;  1AFV A;  4R0M A;  1N8R Q;  2GZF A;  2KG9 A;  2KGE A;  2PEO A;  2LPK A;  2XGV A;  2L9F A;  2PNG A;  1VQN P;  2LKI A;  2L0Q A;  3OW2 O;  2JYL A;  3BP9 A;  2JYG A;  2KGC A;  1AYI A;  1EM9 A;  4U0B A;  2AF8 A;  2CG5 B;  2BUO A;  1ZNV A;  2CNR A;  2K0D X;  1T8K A;  3H0D A;  1VQ9 P;  1YJN P;  2X82 A;  2GZI A;  3VRL C;  3CCQ P;  1AUM A;  4IPY A;  4B4N A;  3G1I A;  3GJN A;  4MRT C;  2GDY A;  1M9F C;  5JPA A;  2L6E A;  3NY7 B;  2AFE A;  2BHV A;  2PEQ A;  5HVC A;  1K30 A;  3G28 A;  4PH2 A;  2EHS A;  2LIU A;  2ROQ A;  4J93 A;  3CC4 P;  4XRQ A;  1VQL P;  3EJE A;  4BPG A;  2GOL B;  4GR2 A;  2K92 A;  1U7K A;  1MZ8 A;  3CCM P;  3DS2 A;  1W2B O;  1KD1 Q;  4PH3 A;  2KGD A;  4COC A;  4E92 A;  2KGF A;  1VQP P;  2CGQ A;  4U0F A;  4H2X C;  2LOL A;  3DS5 A;  4IZ6 A;  2VLQ A;  3HZQ A;  3GZL A;  4INB A;  4QNB A;  1M90 Q;  1GXG A;  4F37 A;  2LTE A;  2MVV A;  2KOS A;  1VQM P;  1YJ9 P;  3CME P;  2FQ1 A;  2K0X A;  2GDX A;  2N5I A;  3H4E A;  1VQ5 P;  4PH0 A;  2N5H A;  5KP8 B;  1L6N A;  1K9M Q;  2JGP A;  4LQW C;  2N98 A;  2XT1 A;  4BPF A;  2XZ1 C;  2JQ4 A;  5CZD B;  2N50 A;  2VLN A;  1Q82 Q;  2JO0 A;  1DNY A;  2MY5 A;  2ERH A;  2JB0 A;  2KGA A;  3G1G A;  1M9E C;  2KG8 A;  3DS1 A;  5EJD A;  1VQK P;  2VLO A;  1L0H A;  4XFZ A;  3CCU P;  3G21 A;  2LML A;  1KC8 Q;  3DS0 A;  2FVF A;  2KOD A;  4U0C A;  2K93 A;  2XGU A;  2GYK A;  3DS3 A;  4H2W C;  2PEN A;  3G4S P;  3LMO A;  2FQ0 A;  4NX4 C;  2FAC A;  2JBG A;  1VQ7 P;  2K5X A;  2FAE A;  2LF4 A;  4HTW A;  2L22 A;  2PY8 A;  1RO0 A;  2JU1 A;  1HQB A;  2KOO A;  1Z6M A;  4PXH B;  3G26 A;  2GON A;  3CPW O;  2X2B A;  1IUQ A;  2K0Y A;  4H2Y C;  2FAD A;  1VQ6 P;  1KLP A;  3NTE A;  4BPH A;  1M6E X;  2M8N A;  2PEM A;  3RG6 C;  2Z44 A;  2N6Z A;  3MGE A;  2MR8 A;  2QA4 P;  1VQ8 P;  2X2D D;  2EIA A;  1GWP A;  4U0D A;  1M9C C;  2DNW A;  2OTJ P;  4CA3 A;  5BS1 A;  2LIW A;  2P9X A;  4DGA C;  5I4T G;  1QVG O;  2MVU A;  3EJB A;  1ACP A;  3WBH A;  1E6J P;  4U0A A;  3CCR P;  3CC7 P;  5HGL A;  2XZ0 D;  1K73 Q;  4COP A;  1FR2 A;  3CCE P;  2Z45 A;  3CD6 P;  1YI2 P;  3G0V A;  2V4X A;  1M9Y C;  3GZM A;  1EIA A;  2FVA A;  3CCL P;  2GZE A;  1BXI A;  1VKU A;  5DCK A;  1YIT P;  1BAJ A;  3G29 A;  5F2N A;  1RO2 A;  1Q7Y Q;  5HGK A;  4GR6 A;  1IMP A;  2OAR A;  3CC2 P;  1EOQ A;  4U0E A;  3B4Q A;  3CMA P;  1A43 A;  2KOR A;  5F2K A;  3CCJ P;  3LRY A;  2PEI A;  1M6N A;  2FQ2 A;  1KQS O;  1M1K Q;  4DG9 A;  1OR5 A;  2XV6 A;  2ONT A;  2XXM A;  1VQ4 P;  1NJI Q;  3EJD A;  2KW2 A;  1G03 A;  2N6Y A;  1RNI A;  3CE7 A;  2DGY A;  3CCS P;  1M74 A;  5BS2 A;  2X83 A;  5HGM A;  3DTJ A;  4PH1 A;  2MF4 A;  1CEI A;  1AK4 C;  1QVF O;  1Q81 Q;  1IMQ A;  1Q86 Q;  2M8L A;  2XGY A;  3CCV P;  1EMV A;  2QNW A;  1M9D C;  4NEO A;  3E2D A;  2CQ8 A;  3GKL C;  2KOQ A;  2WLV B;  4M0I A;  2KWL A;  1E0H A;  2GZJ A;  1JJ2 O;  1YJW P;  2MR7 A;  2KR5 A;  2FHS C;  2AVA A;  1YIJ P;  2EHT A;  1HY8 A;  2PWO A;  2NO8 A;  5KP7 B;  3CXC O;  1VQO P;  2XDE A;  2VSQ A;  3P05 A;  1A8O A;  2M8P A;  2QEX P;  5KP6 B;  2MD9 A;  5F2O A;  3H47 A;  1AF8 A;  2VLP A;  2FVE A;  2CWO A;  2OTL P;  2WLV A;  5EW5 E;  2PXR C;  2K2Q A;  2JPR A;  1GXH A;  3I55 P;  2Y4Z A;  4PWV B;  3G6E P;  2EFJ A;  2GDW A;  4XFY A;  1GPJ A;  2AFD A;  2K94 A;  1F80 D;  2KG6 A;  2PEJ A;  3DPH A;  4QKO A;  5HGO A;  3U43 A;  1D1D A;  4UHP B;  1S72 P;  3DS4 A;  3B5I A;  2KOP A;  1DV5 A;  3Q20 A;  4DGE C;  2LL8 A;  2M5R A;  2EG5 A;  1K8A Q;  1NQ4 A;  2JU2 A; 
#chains in the Genus database with same CATH homology
 1G03 A;  3HYB A;  2E1M A;  2Z46 A;  1RNI A;  3CCM P;  2DGY A;  3DS2 A;  1M74 A;  3G26 A;  3CCS P;  5BS2 A;  2X83 A;  2GON A;  3CPW O;  5HGM A;  4E91 A;  1IUQ A;  3DTJ A;  4PH3 A;  4PH1 A;  1W2B O;  1KD1 Q;  4XRO A;  1AK4 C;  4XFX A;  4E92 A;  4COC A;  4WYM A;  1QVF O;  1Q81 Q;  2KGF A;  1VQP P;  1Q86 Q;  2M8L A;  2XGY A;  4U0F A;  1VQ6 P;  3NTE A;  1M6E X;  5HGN A;  3G71 P;  2M8N A;  3CCV P;  3DS5 A;  2PEM A;  1P7N A;  1ZMB A;  3RG6 C;  1YHQ P;  2Z44 A;  1M9D C;  3MGE A;  2PWM A;  1QRJ A;  3I56 P;  2QA4 P;  2PEK A;  3M1M A;  3E2D A;  1VQ8 P;  3HZQ A;  2X2D D;  2EIA A;  1GWP A;  4INB A;  4QNB A;  2WLV B;  1M9C C;  1M9X C;  4U0D A;  1AFV A;  4M0I A;  1M90 Q;  2OTJ P;  5BS1 A;  1N8R Q;  1JJ2 O;  1YJW P;  2P9X A;  4DGA C;  5I4T G;  1YIJ P;  2PEO A;  1VQM P;  1YJ9 P;  2XGV A;  1QVG O;  3CME P;  2PWO A;  1VQN P;  3CXC O;  1VQO P;  2XDE A;  3P05 A;  3OW2 O;  3H4E A;  1A8O A;  2JYL A;  4PH0 A;  1VQ5 P;  2M8P A;  1L6N A;  3BP9 A;  2JYG A;  3WBH A;  2QEX P;  1K9M Q;  1E6J P;  1EM9 A;  5F2O A;  4U0B A;  4LQW C;  4U0A A;  3CCR P;  3CC7 P;  5HGL A;  2XT1 A;  1K73 Q;  3H47 A;  4COP A;  2BUO A;  3CCE P;  2Z45 A;  3CD6 P;  1YI2 P;  3G0V A;  3H0D A;  2CWO A;  1VQ9 P;  1YJN P;  1Q82 Q;  2V4X A;  1M9Y C;  2JO0 A;  2OTL P;  2WLV A;  2X82 A;  2PXR C;  1M9E C;  3G1G A;  3VRL C;  1AUM A;  3CCQ P;  3DS1 A;  2JPR A;  1VQK P;  1EIA A;  4IPY A;  3CCL P;  4B4N A;  3G1I A;  4XFZ A;  3CCU P;  3I55 P;  2Y4Z A;  3G21 A;  3G6E P;  5DCK A;  1M9F C;  1YIT P;  1BAJ A;  5JPA A;  2EFJ A;  2L6E A;  4XFY A;  3G29 A;  5F2N A;  1RO2 A;  2BHV A;  2PEQ A;  5HGK A;  1Q7Y Q;  1K30 A;  4GR6 A;  1KC8 Q;  3DS0 A;  3G28 A;  4PH2 A;  2KOD A;  2OAR A;  2PEJ A;  4U0C A;  3CC2 P;  3DPH A;  1EOQ A;  4U0E A;  2XGU A;  5HGO A;  3DS3 A;  3CMA P;  1A43 A;  1D1D A;  5F2K A;  2PEN A;  1S72 P;  3G4S P;  3CCJ P;  3LRY A;  3DS4 A;  2PEI A;  1M6N A;  3B5I A;  4NX4 C;  4J93 A;  3Q20 A;  1KQS O;  3CC4 P;  4XRQ A;  1VQ7 P;  4DGE C;  1M1K Q;  1VQL P;  2LF4 A;  2XV6 A;  4HTW A;  2GOL B;  2EG5 A;  4GR2 A;  2PY8 A;  1RO0 A;  2ONT A;  1K8A Q;  2XXM A;  1VQ4 P;  1NJI Q;  1U7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...