5HGOA

Hexameric hiv-1 ca r18g mutant
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
219
structure length
205
Chain Sequence
PIVQNLQGQMVHQCISPGTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 75
structure length 205
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgoA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgoA02
1BAJA 3DS4A 4QNBA 4COPA 3DS0A 3BP9A 3H4EA 4XFXA 1EM9A 2KODA 3MGEA 3LRYA 3G28A 1GWPA 2JYGA 2XGYA 3G1GA 4U0DA 1QRJA 4WYMA 5HGKA 1M9DC 4M0IA 4LQWC 2L6EA 1M9CC 2X82A 4U0FA 3NTEA 1U7KA 2XDEA 1AK4C 2PWOA 4PH1A 4DGAC 4PH3A 2BUOA 4XRQA 3G26A 2EIAA 4XFZA 2XT1A 2PXRC 1A43A 1A8OA 3DTJA 4U0AA 1D1DA 1M9FC 2XXMA 2LF4A 4XFYA 2PWMA 3P05A 3DS3A 4U0BA 4XROA 5JPAA 4HTWA 2XV6A 2Y4ZA 5DCKA 3G0VA 4NX4C 2V4XA 3G21A 3G1IA 2XGUA 4J93A 4DGEC 5I4TG 1G03A 4U0CA 4B4NA 2WLVA 1EOQA 4IPYA 1M9YC 1AUMA 4PH2A 2JPRA 1M9XC 4PH0A 3VRLC 2M8LA 2ONTA 4U0EA 3H47A 1EIAA 5HGNA 2GONA 2M8NA 2GOLB 2JO0A 5HGLA 2X83A 2JYLA 2WLVB 5HGOA 4E91A 3DPHA 3DS2A 3G29A 2KGFA 2XGVA 4E92A 2X2DD 4INBA 3DS5A 1AFVA 1L6NA 4COCA 1M9EC 1E6JP 3DS1A 1P7NA 2M8PA 5HGMA
chains in the Genus database with same CATH superfamily
2FVFA 2N6ZA 1K8AQ 1YJWP 2BHVA 1F80D 1ACPA 1VQNP 1EM9A 4CA3A 3LRYA 3EJDA 2P9XA 2L0QA 2QNWA 4H2XC 3G1GA 1VQMP 5HGKA 4LQWC 2L6EA 1GXHA 4U0FA 1U7KA 3CCJP 1IMQA 3CC2P 2BUOA 5HV8A 2EIAA 2KR5A 2GDXA 4IZ6A 2QEXP 2PXRC 5EJDA 1A8OA 1VQ5P 1DV5A 1D1DA 5KP8B 2LF4A 2PWMA 3P05A 3G4SP 2EHSA 5BS1A 1X3OA 1RO0A 2GZIA 3G71P 3G21A 3G1IA 2XGUA 4F37A 5I4TG 2LPKA 4U0CA 2KG9A 4B4NA 1VQPP 3CCVP 5BS2A 2GDYA 1HY8A 2MY5A 2ONTA 1EIAA 1Q82Q 7CEIA 2KOSA 3Q20A 2LOLA 2GZEA 3GKLC 2WPTA 4GR2A 3LMOA 3DPHA 2OARA 2PENA 1VQ4P 3H0DA 1M9EC 1NQ4A 4H2WC 3CCUP 1E0HA 3DS4A 3EJBA 2FACA 4QNBA 3RG6C 3DS0A 4XFXA 2FQ2A 3MGEA 2GZGA 2GDWA 3G28A 1KLPA 1S72P 1Q81Q 2XGYA 2L4BA 1QRJA 1T8KA 4DG9A 3I56P 1M9DC 2PEKA 1YITP 1OR5A 2Z44A 1VQ9P 1YI2P 1M9CC 3CCLP 2X2BA 1AK4C 3CMEP 4PH1A 2K0DX 2KOPA 2LIUA 4GR6A 4XFZA 2XT1A 2PEJA 2M5RA 2DNWA 2Z46A 4XFYA 4U0BA 4XROA 3G0VA 5HVCA 2VSQA 2V4XA 1AF8A 4DGEC 4UHPB 1M1KQ 1ZNVA 2WLVA 1Z6MA 2MVVA 1L0IA 1EOQA 1ZMBA 1K30A 4PH0A 4U0EA 3H47A 2GONA 1L0HA 2MVUA 4R0MA 2GOLB 2JAZA 2JO0A 5HGLA 2X83A 2N98A 2MR8A 2WLVB 2K93A 1BXIA 4QKOA 2FADA 2OTJP 2KGDA 2XGVA 3GJNA 2Z45A 2X2DD 1MZ8A 4BPHA 1E6JP 3DS1A 1JJ2O 2FAEA 2AFDA 1UNKA 1BAJA 2GZFA 2JU1A 2XZ0D 1M90Q 2JB0A 1GWPA 2JYGA 2AVAA 4H2YC 4MRTC 1VHNA 2N50A 2VLOA 3CE7A 2EHTA 2PNGA 3NY7B 3CCMP 5F2OA 1RNIA 1QVGO 2X82A 4BPGA 1IUQA 3E2DA 2KGAA 2L22A 2N5HA 2KWLA 2PWOA 2NO8A 4DGAC 2JGPA 3G26A 2KOOA 1A43A 1GXGA 1VQ8P 3GZLA 4U0AA 1M9FC 2FVAA 2E1MA 2PEOA 3CCEP 2PY8A 4HTWA 3M1MA 1CEIA 2XV6A 2Y4ZA 4NX4C 5KP7B 2K0XA 1G03A 2PEIA 3RG2A 1VQLP 4IPYA 1M9YC 2GYKA 3B4QA 1W2BO 3CC7P 2M8LA 2PEMA 1Q86Q 3B5IA 1M6EX 2AF8A 1Q7YQ 2ERHA 2M8NA 2K0YA 2VLPA 3GZMA 4PXHB 1VQ6P 3CCRP 3CXCO 3I55P 3G6EP 2LMLA 5HGOA 2FVEA 4E91A 5CZDB 2AFEA 2KGFA 2JU2A 1K73Q 2K94A 3WBHA 2MD9A 4E92A 2CNRA 2LL8A 1IMPA 4PWVB 1AYIA 4INBA 2KORA 1AFVA 4HKGA 1VQ7P 1L6NA 1P7NA 2QA4P 2M8PA 5HGMA 2JBGA 5F2KA 2N5IA 4COPA 3CMAP 3BP9A 3H4EA 2KODA 2EG5A 2KGCA 1K9MQ 1YHQP 1M74A 3CPWO 2N6YA 1UJZA 2DGYA 1VQOP 4U0DA 2L9FA 1FR2A 4WYMA 2XZ1C 2CWOA 3EJEA 3HYBA 2PEQA 1DNYA 4M0IA 1QVFO 3HZQA 5EW5E 3CCSP 3NTEA 3U43A 2XDEA 1RO2A 2CQ8A 1VKUA 1VQKP 2K2QA 4PH3A 3OW2O 2MR7A 4XRQA 2K5XA 1YIJP 2ROQA 2EFJA 2VLQA 1YJNP 2CG5B 2XXMA 2OTLP 2FQ1A 3CC4P 3DS3A 5JPAA 1KD1Q 2LKIA 5DCKA 2LIWA 1KQSO 2GZJA 2LTEA 4J93A 1HQBA 2FQ0A 3CCQP 2KG6A 1AUMA 4PH2A 2JPRA 4NEOA 1KC8Q 1YJ9P 1M9XC 3VRLC 1EMVA 2KG8A 5HGNA 2FHSC 2VLNA 1M6NA 5F2NA 2MF4A 4BPFA 2JQ4A 2JYLA 3DS2A 3G29A 5KP6B 1NJIQ 2K92A 1GPJA 2CGQA 2KW2A 3DS5A 1N8RQ 2KOQA 4COCA 3CD6P 2KGEA 3DTJA
chains in the Genus database with same CATH topology
1BAJA 3DS4A 1K8AQ 1YJWP 2BHVA 4QNBA 4COPA 3RG6C 3DS0A 3BP9A 3H4EA 4XFXA 1EM9A 2KODA 3CMAP 2EG5A 3MGEA 1VQNP 1M90Q 3LRYA 3G28A 1GWPA 1K9MQ 2JYGA 2P9XA 1YHQP 1M74A 3CPWO 1S72P 1Q81Q 2XGYA 3G1GA 2DGYA 1VQOP 4U0DA 1QRJA 4WYMA 1QVGO 2CWOA 3HYBA 1VQMP 2PEQA 5HGKA 3I56P 1M9DC 2PEKA 1YITP 4M0IA 3CCMP 2Z44A 5F2OA 1QVFO 1VQ9P 4LQWC 1RNIA 1M9CC 2X82A 4U0FA 1IUQA 2L6EA 3HZQA 3CCSP 3E2DA 3NTEA 3CCLP 1U7KA 2XDEA 1RO2A 1AK4C 3CCJP 3CMEP 2PWOA 4PH1A 4DGAC 3CC2P 4GR6A 1VQKP 4PH3A 2BUOA 3OW2O 4XRQA 3G26A 1YIJP 2EIAA 4XFZA 2XT1A 2EFJA 2QEXP 1YJNP 2PXRC 1A43A 1VQ8P 1A8OA 2PEJA 3DTJA 1VQ5P 4U0AA 1D1DA 1M9FC 2XXMA 2OTLP 2LF4A 3CC4P 2Z46A 4XFYA 2PWMA 3P05A 3DS3A 2E1MA 2PEOA 4U0BA 4XROA 5JPAA 3G4SP 3CCEP 2PY8A 4HTWA 3M1MA 1KD1Q 5BS1A 2XV6A 2Y4ZA 5DCKA 3G0VA 1RO0A 1KQSO 4NX4C 3G71P 2V4XA 3G21A 3G1IA 2XGUA 4J93A 4DGEC 5I4TG 1G03A 2PEIA 4U0CA 1M1KQ 4B4NA 1VQPP 3CCVP 2WLVA 1VQLP 5BS2A 1EOQA 3CCQP 4IPYA 1M9YC 1AUMA 1ZMBA 4PH2A 2JPRA 1KC8Q 1YJ9P 1M9XC 1K30A 4PH0A 1W2BO 3VRLC 3CC7P 2M8LA 2PEMA 1Q86Q 2ONTA 4U0EA 3H47A 3B5IA 1EIAA 1Q82Q 5HGNA 1M6EX 2GONA 1Q7YQ 1M6NA 5F2NA 3Q20A 2M8NA 2GOLB 1VQ6P 2JO0A 5HGLA 3CCRP 3CXCO 2X83A 3I55P 3G6EP 2JYLA 2WLVB 4GR2A 5HGOA 4E91A 3DPHA 3DS2A 3G29A 2KGFA 2OTJP 2OARA 1NJIQ 1K73Q 1YI2P 2XGVA 3WBHA 2PENA 4E92A 1VQ4P 2Z45A 2X2DD 3H0DA 4INBA 3DS5A 1AFVA 1VQ7P 1N8RQ 1L6NA 4COCA 3CD6P 1M9EC 1E6JP 3DS1A 1JJ2O 1P7NA 2QA4P 2M8PA 5HGMA 3CCUP 5F2KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BAJ A;  3DS4 A;  4QNB A;  4COP A;  3DS0 A;  3BP9 A;  3H4E A;  4XFX A;  1EM9 A;  2KOD A;  3MGE A;  3LRY A;  3G28 A;  1GWP A;  2JYG A;  2XGY A;  3G1G A;  4U0D A;  1QRJ A;  4WYM A;  5HGK A;  1M9D C;  4M0I A;  4LQW C;  2L6E A;  1M9C C;  2X82 A;  4U0F A;  3NTE A;  1U7K A;  2XDE A;  1AK4 C;  2PWO A;  4PH1 A;  4DGA C;  4PH3 A;  2BUO A;  4XRQ A;  3G26 A;  2EIA A;  4XFZ A;  2XT1 A;  2PXR C;  1A43 A;  1A8O A;  3DTJ A;  4U0A A;  1D1D A;  1M9F C;  2XXM A;  2LF4 A;  4XFY A;  2PWM A;  3P05 A;  3DS3 A;  4U0B A;  4XRO A;  5JPA A;  4HTW A;  2XV6 A;  2Y4Z A;  5DCK A;  3G0V A;  4NX4 C;  2V4X A;  3G21 A;  3G1I A;  2XGU A;  4J93 A;  4DGE C;  5I4T G;  1G03 A;  4U0C A;  4B4N A;  2WLV A;  1EOQ A;  4IPY A;  1M9Y C;  1AUM A;  4PH2 A;  2JPR A;  1M9X C;  4PH0 A;  3VRL C;  2M8L A;  2ONT A;  4U0E A;  3H47 A;  1EIA A;  5HGN A;  2GON A;  2M8N A;  2GOL B;  2JO0 A;  5HGL A;  2X83 A;  2JYL A;  2WLV B;  5HGO A;  4E91 A;  3DPH A;  3DS2 A;  3G29 A;  2KGF A;  2XGV A;  4E92 A;  2X2D D;  4INB A;  3DS5 A;  1AFV A;  1L6N A;  4COC A;  1M9E C;  1E6J P;  3DS1 A;  1P7N A;  2M8P A;  5HGM A; 
#chains in the Genus database with same CATH topology
 2FVF A;  2N6Z A;  1K8A Q;  1YJW P;  2BHV A;  1F80 D;  1ACP A;  1VQN P;  1EM9 A;  4CA3 A;  3LRY A;  3EJD A;  2P9X A;  2L0Q A;  2QNW A;  4H2X C;  3G1G A;  1VQM P;  5HGK A;  4LQW C;  2L6E A;  1GXH A;  4U0F A;  1U7K A;  3CCJ P;  1IMQ A;  3CC2 P;  2BUO A;  5HV8 A;  2EIA A;  2KR5 A;  2GDX A;  4IZ6 A;  2QEX P;  2PXR C;  5EJD A;  1A8O A;  1VQ5 P;  1DV5 A;  1D1D A;  5KP8 B;  2LF4 A;  2PWM A;  3P05 A;  3G4S P;  2EHS A;  5BS1 A;  1X3O A;  1RO0 A;  2GZI A;  3G71 P;  3G21 A;  3G1I A;  2XGU A;  4F37 A;  5I4T G;  2LPK A;  4U0C A;  2KG9 A;  4B4N A;  1VQP P;  3CCV P;  5BS2 A;  2GDY A;  1HY8 A;  2MY5 A;  2ONT A;  1EIA A;  1Q82 Q;  7CEI A;  2KOS A;  3Q20 A;  2LOL A;  2GZE A;  3GKL C;  2WPT A;  4GR2 A;  3LMO A;  3DPH A;  2OAR A;  2PEN A;  1VQ4 P;  3H0D A;  1M9E C;  1NQ4 A;  4H2W C;  3CCU P;  1E0H A;  3DS4 A;  3EJB A;  2FAC A;  4QNB A;  3RG6 C;  3DS0 A;  4XFX A;  2FQ2 A;  3MGE A;  2GZG A;  2GDW A;  3G28 A;  1KLP A;  1S72 P;  1Q81 Q;  2XGY A;  2L4B A;  1QRJ A;  1T8K A;  4DG9 A;  3I56 P;  1M9D C;  2PEK A;  1YIT P;  1OR5 A;  2Z44 A;  1VQ9 P;  1YI2 P;  1M9C C;  3CCL P;  2X2B A;  1AK4 C;  3CME P;  4PH1 A;  2K0D X;  2KOP A;  2LIU A;  4GR6 A;  4XFZ A;  2XT1 A;  2PEJ A;  2M5R A;  2DNW A;  2Z46 A;  4XFY A;  4U0B A;  4XRO A;  3G0V A;  5HVC A;  2VSQ A;  2V4X A;  1AF8 A;  4DGE C;  4UHP B;  1M1K Q;  1ZNV A;  2WLV A;  1Z6M A;  2MVV A;  1L0I A;  1EOQ A;  1ZMB A;  1K30 A;  4PH0 A;  4U0E A;  3H47 A;  2GON A;  1L0H A;  2MVU A;  4R0M A;  2GOL B;  2JAZ A;  2JO0 A;  5HGL A;  2X83 A;  2N98 A;  2MR8 A;  2WLV B;  2K93 A;  1BXI A;  4QKO A;  2FAD A;  2OTJ P;  2KGD A;  2XGV A;  3GJN A;  2Z45 A;  2X2D D;  1MZ8 A;  4BPH A;  1E6J P;  3DS1 A;  1JJ2 O;  2FAE A;  2AFD A;  1UNK A;  1BAJ A;  2GZF A;  2JU1 A;  2XZ0 D;  1M90 Q;  2JB0 A;  1GWP A;  2JYG A;  2AVA A;  4H2Y C;  4MRT C;  1VHN A;  2N50 A;  2VLO A;  3CE7 A;  2EHT A;  2PNG A;  3NY7 B;  3CCM P;  5F2O A;  1RNI A;  1QVG O;  2X82 A;  4BPG A;  1IUQ A;  3E2D A;  2KGA A;  2L22 A;  2N5H A;  2KWL A;  2PWO A;  2NO8 A;  4DGA C;  2JGP A;  3G26 A;  2KOO A;  1A43 A;  1GXG A;  1VQ8 P;  3GZL A;  4U0A A;  1M9F C;  2FVA A;  2E1M A;  2PEO A;  3CCE P;  2PY8 A;  4HTW A;  3M1M A;  1CEI A;  2XV6 A;  2Y4Z A;  4NX4 C;  5KP7 B;  2K0X A;  1G03 A;  2PEI A;  3RG2 A;  1VQL P;  4IPY A;  1M9Y C;  2GYK A;  3B4Q A;  1W2B O;  3CC7 P;  2M8L A;  2PEM A;  1Q86 Q;  3B5I A;  1M6E X;  2AF8 A;  1Q7Y Q;  2ERH A;  2M8N A;  2K0Y A;  2VLP A;  3GZM A;  4PXH B;  1VQ6 P;  3CCR P;  3CXC O;  3I55 P;  3G6E P;  2LML A;  5HGO A;  2FVE A;  4E91 A;  5CZD B;  2AFE A;  2KGF A;  2JU2 A;  1K73 Q;  2K94 A;  3WBH A;  2MD9 A;  4E92 A;  2CNR A;  2LL8 A;  1IMP A;  4PWV B;  1AYI A;  4INB A;  2KOR A;  1AFV A;  4HKG A;  1VQ7 P;  1L6N A;  1P7N A;  2QA4 P;  2M8P A;  5HGM A;  2JBG A;  5F2K A;  2N5I A;  4COP A;  3CMA P;  3BP9 A;  3H4E A;  2KOD A;  2EG5 A;  2KGC A;  1K9M Q;  1YHQ P;  1M74 A;  3CPW O;  2N6Y A;  1UJZ A;  2DGY A;  1VQO P;  4U0D A;  2L9F A;  1FR2 A;  4WYM A;  2XZ1 C;  2CWO A;  3EJE A;  3HYB A;  2PEQ A;  1DNY A;  4M0I A;  1QVF O;  3HZQ A;  5EW5 E;  3CCS P;  3NTE A;  3U43 A;  2XDE A;  1RO2 A;  2CQ8 A;  1VKU A;  1VQK P;  2K2Q A;  4PH3 A;  3OW2 O;  2MR7 A;  4XRQ A;  2K5X A;  1YIJ P;  2ROQ A;  2EFJ A;  2VLQ A;  1YJN P;  2CG5 B;  2XXM A;  2OTL P;  2FQ1 A;  3CC4 P;  3DS3 A;  5JPA A;  1KD1 Q;  2LKI A;  5DCK A;  2LIW A;  1KQS O;  2GZJ A;  2LTE A;  4J93 A;  1HQB A;  2FQ0 A;  3CCQ P;  2KG6 A;  1AUM A;  4PH2 A;  2JPR A;  4NEO A;  1KC8 Q;  1YJ9 P;  1M9X C;  3VRL C;  1EMV A;  2KG8 A;  5HGN A;  2FHS C;  2VLN A;  1M6N A;  5F2N A;  2MF4 A;  4BPF A;  2JQ4 A;  2JYL A;  3DS2 A;  3G29 A;  5KP6 B;  1NJI Q;  2K92 A;  1GPJ A;  2CGQ A;  2KW2 A;  3DS5 A;  1N8R Q;  2KOQ A;  4COC A;  3CD6 P;  2KGE A;  3DTJ A; 
#chains in the Genus database with same CATH homology
 1BAJ A;  3DS4 A;  1K8A Q;  1YJW P;  2BHV A;  4QNB A;  4COP A;  3RG6 C;  3DS0 A;  3BP9 A;  3H4E A;  4XFX A;  1EM9 A;  2KOD A;  3CMA P;  2EG5 A;  3MGE A;  1VQN P;  1M90 Q;  3LRY A;  3G28 A;  1GWP A;  1K9M Q;  2JYG A;  2P9X A;  1YHQ P;  1M74 A;  3CPW O;  1S72 P;  1Q81 Q;  2XGY A;  3G1G A;  2DGY A;  1VQO P;  4U0D A;  1QRJ A;  4WYM A;  1QVG O;  2CWO A;  3HYB A;  1VQM P;  2PEQ A;  5HGK A;  3I56 P;  1M9D C;  2PEK A;  1YIT P;  4M0I A;  3CCM P;  2Z44 A;  5F2O A;  1QVF O;  1VQ9 P;  4LQW C;  1RNI A;  1M9C C;  2X82 A;  4U0F A;  1IUQ A;  2L6E A;  3HZQ A;  3CCS P;  3E2D A;  3NTE A;  3CCL P;  1U7K A;  2XDE A;  1RO2 A;  1AK4 C;  3CCJ P;  3CME P;  2PWO A;  4PH1 A;  4DGA C;  3CC2 P;  4GR6 A;  1VQK P;  4PH3 A;  2BUO A;  3OW2 O;  4XRQ A;  3G26 A;  1YIJ P;  2EIA A;  4XFZ A;  2XT1 A;  2EFJ A;  2QEX P;  1YJN P;  2PXR C;  1A43 A;  1VQ8 P;  1A8O A;  2PEJ A;  3DTJ A;  1VQ5 P;  4U0A A;  1D1D A;  1M9F C;  2XXM A;  2OTL P;  2LF4 A;  3CC4 P;  2Z46 A;  4XFY A;  2PWM A;  3P05 A;  3DS3 A;  2E1M A;  2PEO A;  4U0B A;  4XRO A;  5JPA A;  3G4S P;  3CCE P;  2PY8 A;  4HTW A;  3M1M A;  1KD1 Q;  5BS1 A;  2XV6 A;  2Y4Z A;  5DCK A;  3G0V A;  1RO0 A;  1KQS O;  4NX4 C;  3G71 P;  2V4X A;  3G21 A;  3G1I A;  2XGU A;  4J93 A;  4DGE C;  5I4T G;  1G03 A;  2PEI A;  4U0C A;  1M1K Q;  4B4N A;  1VQP P;  3CCV P;  2WLV A;  1VQL P;  5BS2 A;  1EOQ A;  3CCQ P;  4IPY A;  1M9Y C;  1AUM A;  1ZMB A;  4PH2 A;  2JPR A;  1KC8 Q;  1YJ9 P;  1M9X C;  1K30 A;  4PH0 A;  1W2B O;  3VRL C;  3CC7 P;  2M8L A;  2PEM A;  1Q86 Q;  2ONT A;  4U0E A;  3H47 A;  3B5I A;  1EIA A;  1Q82 Q;  5HGN A;  1M6E X;  2GON A;  1Q7Y Q;  1M6N A;  5F2N A;  3Q20 A;  2M8N A;  2GOL B;  1VQ6 P;  2JO0 A;  5HGL A;  3CCR P;  3CXC O;  2X83 A;  3I55 P;  3G6E P;  2JYL A;  2WLV B;  4GR2 A;  5HGO A;  4E91 A;  3DPH A;  3DS2 A;  3G29 A;  2KGF A;  2OTJ P;  2OAR A;  1NJI Q;  1K73 Q;  1YI2 P;  2XGV A;  3WBH A;  2PEN A;  4E92 A;  1VQ4 P;  2Z45 A;  2X2D D;  3H0D A;  4INB A;  3DS5 A;  1AFV A;  1VQ7 P;  1N8R Q;  1L6N A;  4COC A;  3CD6 P;  1M9E C;  1E6J P;  3DS1 A;  1JJ2 O;  1P7N A;  2QA4 P;  2M8P A;  5HGM A;  3CCU P;  5F2K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...