1D1DA

Nmr solution structure of the capsid protein from rous sarcoma virus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
220
structure length
220
Chain Sequence
WTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLDRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADITQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRAAPSTLTTPGEIIKYVLDRQKIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CAPSID PROTEIN)
publication title Solution structure and dynamics of the Rous sarcoma virus capsid protein and comparison with capsid proteins of other retroviruses.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 58
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1999-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1d1dA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1d1dA02
1U7KA 2WLVB 4E91A 4U0BA 1A8OA 5HGLA 1M9XC 3BP9A 1AK4C 2XGYA 4XRQA 4U0EA 2L6EA 3DS4A 1M9DC 4NX4C 4XFZA 4U0CA 1GWPA 4B4NA 3DS1A 3G29A 3MGEA 3VRLC 3G0VA 3DS2A 4LQWC 4WYMA 2JYGA 4DGAC 4U0AA 2JO0A 1P7NA 3H4EA 1M9FC 2GONA 2BUOA 2ONTA 1EIAA 2PWOA 4HTWA 2XGUA 2GOLB 2M8NA 5HGOA 1AFVA 4IPYA 2JPRA 4J93A 4PH2A 3LRYA 4QNBA 4INBA 4XFXA 3G21A 1AUMA 1EOQA 1G03A 2KGFA 4PH1A 3G1GA 3DS3A 2XT1A 2X2DD 1D1DA 2JYLA 3NTEA 4COCA 4E92A 1EM9A 1M9CC 2Y4ZA 4XFYA 2X82A 1M9YC 2XDEA 2EIAA 1BAJA 4DGEC 3G1IA 3G26A 5DCKA 2XGVA 3DS0A 5I4TG 3G28A 2X83A 4U0FA 4COPA 1A43A 3DPHA 2M8PA 3H47A 1M9EC 5HGNA 5JPAA 3DTJA 4U0DA 2PWMA 5HGKA 4M0IA 4XROA 2PXRC 2M8LA 4PH3A 2KODA 1L6NA 2XV6A 4PH0A 2XXMA 3P05A 2LF4A 2WLVA 1QRJA 2V4XA 5HGMA 3DS5A 1E6JP
chains in the Genus database with same CATH superfamily
2L0QA 1M74A 1M9XC 2QA4P 1AK4C 1KC8Q 2KG8A 2KORA 2N50A 3CMAP 2K93A 4XFZA 1M6NA 2KG9A 2FAEA 3RG6C 2M5RA 1M90Q 1K30A 3MGEA 3DS2A 2VLPA 2AFDA 2GZFA 2AFEA 2GZEA 2JO0A 2WPTA 2KGCA 4NEOA 4HTWA 3EJBA 2XGUA 2MF4A 4IPYA 2FVFA 4PH2A 2LPKA 2N5IA 2Z44A 2JBGA 4INBA 4R0MA 4XFXA 1X3OA 2ERHA 3DS3A 2X2BA 3GJNA 5KP6B 2OARA 1M9CC 2MY5A 1QVFO 4XFYA 2X82A 3GKLC 1M9YC 2AF8A 2OTLP 3CC4P 4CA3A 2K92A 3G1IA 2K2QA 3G28A 3CCSP 2PEJA 1AYIA 1A43A 3DPHA 1W2BO 5CZDB 2PWMA 3CCVP 5HGKA 3CCRP 1VQMP 3CCUP 2EHTA 2VLOA 2N6ZA 1KQSO 2GZJA 4PH0A 2XXMA 1HQBA 1Z6MA 2KOOA 1NQ4A 2WLVA 1IMQA 2K94A 2KW2A 1Q86Q 3GZMA 4E91A 1YJWP 5F2KA 1AF8A 3RG2A 1DNYA 1M6EX 1ZMBA 1YJNP 5BS1A 3CPWO 1GWPA 4B4NA 2FQ2A 2GDXA 1HY8A 2NO8A 3G0VA 1OR5A 2KOSA 1VQ7P 4WYMA 2FVAA 4DGAC 1GXHA 4H2XC 2K0XA 2GONA 2MR7A 1VQ6P 2M8NA 5HGOA 2CNRA 1UJZA 2JPRA 3E2DA 4UHPB 3U43A 1VQPP 4QNBA 1BXIA 2PENA 2KGEA 4GR6A 3G6EP 1AUMA 1G03A 2KOPA 3CD6P 3M1MA 2KGFA 4PH1A 1YHQP 1QVGO 3G1GA 2XT1A 2EFJA 3LMOA 1VQNP 5F2OA 1EM9A 2KGDA 2VLQA 2L9FA 2L22A 1VHNA 2FVEA 1BAJA 3HYBA 4H2YC 2Z45A 1UNKA 2XGVA 1YJ9P 2JGPA 2X83A 4U0FA 4BPFA 2M8PA 1VQ8P 3G4SP 3CXCO 1VQ4P 2QNWA 2PEQA 4BPGA 1VQOP 1S72P 4MRTC 4PXHB 2LKIA 1IMPA 2KODA 2PEOA 5EJDA 1YITP 2VSQA 2KG6A 3OW2O 5KP7B 2V4XA 5HGMA 2VLNA 1U7KA 2WLVB 1YIJP 4U0BA 3G71P 1A8OA 5HGLA 1K9MQ 4U0EA 2L6EA 1M9DC 3NY7B 1NJIQ 3B5IA 2LMLA 4F37A 3DS1A 3G29A 4PWVB 5BS2A 2MR8A 4LQWC 2N98A 2PNGA 2BHVA 3H4EA 1M9FC 2BUOA 3H0DA 3CCLP 1EIAA 3CC2P 4IZ6A 3WBHA 5EW5E 2PWOA 7CEIA 1FR2A 2GOLB 5KP8B 3LRYA 2KWLA 2KOQA 3G21A 1EOQA 1Q81Q 4BPHA 1D1DA 2JYLA 1K73Q 4COCA 4E92A 1L0IA 2Y4ZA 2GZIA 2CG5B 1M1KQ 2XDEA 1VQ9P 2EIAA 2QEXP 1VKUA 2CQ8A 3DS0A 5I4TG 2XZ1C 5HGNA 1IUQA 2KR5A 5JPAA 1E0HA 3DTJA 4DG9A 2JB0A 4QKOA 4M0IA 2N6YA 2PXRC 2LTEA 2FQ0A 1L0HA 1YI2P 4PH3A 1ACPA 1VQKP 1GPJA 2GZGA 2LF4A 2PEIA 2FACA 2K5XA 3CCMP 1QRJA 1T8KA 1E6JP 2OTJP 3CC7P 2JU1A 3BP9A 1EMVA 2LOLA 2MVVA 2XGYA 4XRQA 2MD9A 5HV8A 3DS4A 2AVAA 4NX4C 1CEIA 1RO2A 3HZQA 4U0CA 3VRLC 2FHSC 3CCQP 2JYGA 1ZNVA 4U0AA 5HVCA 1P7NA 1F80D 2GDWA 2ONTA 1Q7YQ 2DNWA 2FADA 2ROQA 2EG5A 2JQ4A 3GZLA 1AFVA 4J93A 1DV5A 2GDYA 2LIUA 1N8RQ 3Q20A 1MZ8A 2L4BA 2CGQA 3CCJP 2X2DD 3NTEA 1RO0A 2CWOA 2JAZA 2XZ0D 2PEMA 1Q82Q 1RNIA 4H2WC 2KGAA 4GR2A 4DGEC 2LIWA 1KD1Q 3G26A 5DCKA 1VQ5P 1JJ2O 2Z46A 4COPA 3H47A 2DGYA 2JU2A 1M9EC 4HKGA 2PY8A 2EHSA 4U0DA 1K8AQ 2E1MA 5F2NA 2N5HA 3I55P 2PEKA 3EJEA 4XROA 2GYKA 1KLPA 2M8LA 2FQ1A 2MVUA 1L6NA 2XV6A 1GXGA 3CE7A 3I56P 3CCEP 2LL8A 2P9XA 2K0YA 3P05A 3B4QA 1VQLP 3CMEP 2K0DX 3DS5A 3EJDA
chains in the Genus database with same CATH topology
1U7KA 2WLVB 2OTJP 4E91A 1M74A 1YIJP 4U0BA 3G71P 3CC7P 1A8OA 5HGLA 5F2KA 1YJWP 1M9XC 3BP9A 2QA4P 1AK4C 1KC8Q 2XGYA 4XRQA 4U0EA 1K9MQ 2L6EA 3DS4A 3CMAP 1M9DC 1M6EX 4NX4C 1RO2A 3HZQA 1ZMBA 1YJNP 4XFZA 1M6NA 4U0CA 5BS1A 1NJIQ 3B5IA 3CPWO 1GWPA 3RG6C 4B4NA 3DS1A 3G29A 1M90Q 1K30A 3MGEA 5BS2A 3VRLC 3G0VA 3DS2A 4LQWC 3CCQP 1VQ7P 4WYMA 2JYGA 4DGAC 4U0AA 2JO0A 1P7NA 2BHVA 3H4EA 1M9FC 2GONA 2BUOA 3H0DA 2ONTA 1EIAA 1Q7YQ 3CC2P 3WBHA 3CCLP 2PWOA 4HTWA 2XGUA 2GOLB 2EG5A 1VQ6P 2M8NA 5HGOA 1AFVA 4IPYA 2JPRA 3E2DA 4J93A 4PH2A 3LRYA 1VQPP 4QNBA 2Z44A 2PENA 4INBA 4GR6A 4XFXA 3G6EP 3G21A 1N8RQ 1AUMA 1EOQA 3Q20A 1Q81Q 1G03A 3CD6P 3M1MA 2KGFA 4PH1A 1YHQP 1QVGO 3G1GA 3DS3A 2XT1A 2X2DD 1D1DA 2EFJA 2JYLA 3CCJP 3NTEA 1VQNP 1RO0A 2CWOA 5F2OA 1K73Q 4COCA 4E92A 1EM9A 2OARA 2PEMA 1M9CC 2Y4ZA 1Q82Q 1RNIA 1QVFO 1M1KQ 4XFYA 2X82A 1M9YC 2XDEA 1VQ9P 2EIAA 2OTLP 4GR2A 1BAJA 4DGEC 2QEXP 1KD1Q 3CC4P 3HYBA 3G1IA 3G26A 2Z45A 5DCKA 1VQ5P 2XGVA 3DS0A 5I4TG 1YJ9P 1JJ2O 3G28A 2X83A 4U0FA 2Z46A 3CCSP 2PEJA 4COPA 1A43A 3DPHA 1W2BO 2M8PA 3H47A 2DGYA 1M9EC 5HGNA 1IUQA 1VQ8P 5JPAA 3G4SP 3CXCO 2PY8A 3DTJA 4U0DA 1K8AQ 2E1MA 5F2NA 1VQ4P 2PWMA 3CCVP 5HGKA 3I55P 3CCRP 2PEKA 4M0IA 4XROA 2PEQA 2PXRC 1VQMP 3CCUP 1VQOP 1S72P 2M8LA 1YI2P 4PH3A 2KODA 1KQSO 1VQKP 1L6NA 2XV6A 3I56P 3CCEP 4PH0A 2XXMA 2P9XA 3P05A 1VQLP 2LF4A 2PEOA 2PEIA 1YITP 2WLVA 3CMEP 3OW2O 3CCMP 1QRJA 2V4XA 5HGMA 3DS5A 1E6JP 1Q86Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7K A;  2WLV B;  4E91 A;  4U0B A;  1A8O A;  5HGL A;  1M9X C;  3BP9 A;  1AK4 C;  2XGY A;  4XRQ A;  4U0E A;  2L6E A;  3DS4 A;  1M9D C;  4NX4 C;  4XFZ A;  4U0C A;  1GWP A;  4B4N A;  3DS1 A;  3G29 A;  3MGE A;  3VRL C;  3G0V A;  3DS2 A;  4LQW C;  4WYM A;  2JYG A;  4DGA C;  4U0A A;  2JO0 A;  1P7N A;  3H4E A;  1M9F C;  2GON A;  2BUO A;  2ONT A;  1EIA A;  2PWO A;  4HTW A;  2XGU A;  2GOL B;  2M8N A;  5HGO A;  1AFV A;  4IPY A;  2JPR A;  4J93 A;  4PH2 A;  3LRY A;  4QNB A;  4INB A;  4XFX A;  3G21 A;  1AUM A;  1EOQ A;  1G03 A;  2KGF A;  4PH1 A;  3G1G A;  3DS3 A;  2XT1 A;  2X2D D;  1D1D A;  2JYL A;  3NTE A;  4COC A;  4E92 A;  1EM9 A;  1M9C C;  2Y4Z A;  4XFY A;  2X82 A;  1M9Y C;  2XDE A;  2EIA A;  1BAJ A;  4DGE C;  3G1I A;  3G26 A;  5DCK A;  2XGV A;  3DS0 A;  5I4T G;  3G28 A;  2X83 A;  4U0F A;  4COP A;  1A43 A;  3DPH A;  2M8P A;  3H47 A;  1M9E C;  5HGN A;  5JPA A;  3DTJ A;  4U0D A;  2PWM A;  5HGK A;  4M0I A;  4XRO A;  2PXR C;  2M8L A;  4PH3 A;  2KOD A;  1L6N A;  2XV6 A;  4PH0 A;  2XXM A;  3P05 A;  2LF4 A;  2WLV A;  1QRJ A;  2V4X A;  5HGM A;  3DS5 A;  1E6J P; 
#chains in the Genus database with same CATH topology
 2L0Q A;  1M74 A;  1M9X C;  2QA4 P;  1AK4 C;  1KC8 Q;  2KG8 A;  2KOR A;  2N50 A;  3CMA P;  2K93 A;  4XFZ A;  1M6N A;  2KG9 A;  2FAE A;  3RG6 C;  2M5R A;  1M90 Q;  1K30 A;  3MGE A;  3DS2 A;  2VLP A;  2AFD A;  2GZF A;  2AFE A;  2GZE A;  2JO0 A;  2WPT A;  2KGC A;  4NEO A;  4HTW A;  3EJB A;  2XGU A;  2MF4 A;  4IPY A;  2FVF A;  4PH2 A;  2LPK A;  2N5I A;  2Z44 A;  2JBG A;  4INB A;  4R0M A;  4XFX A;  1X3O A;  2ERH A;  3DS3 A;  2X2B A;  3GJN A;  5KP6 B;  2OAR A;  1M9C C;  2MY5 A;  1QVF O;  4XFY A;  2X82 A;  3GKL C;  1M9Y C;  2AF8 A;  2OTL P;  3CC4 P;  4CA3 A;  2K92 A;  3G1I A;  2K2Q A;  3G28 A;  3CCS P;  2PEJ A;  1AYI A;  1A43 A;  3DPH A;  1W2B O;  5CZD B;  2PWM A;  3CCV P;  5HGK A;  3CCR P;  1VQM P;  3CCU P;  2EHT A;  2VLO A;  2N6Z A;  1KQS O;  2GZJ A;  4PH0 A;  2XXM A;  1HQB A;  1Z6M A;  2KOO A;  1NQ4 A;  2WLV A;  1IMQ A;  2K94 A;  2KW2 A;  1Q86 Q;  3GZM A;  4E91 A;  1YJW P;  5F2K A;  1AF8 A;  3RG2 A;  1DNY A;  1M6E X;  1ZMB A;  1YJN P;  5BS1 A;  3CPW O;  1GWP A;  4B4N A;  2FQ2 A;  2GDX A;  1HY8 A;  2NO8 A;  3G0V A;  1OR5 A;  2KOS A;  1VQ7 P;  4WYM A;  2FVA A;  4DGA C;  1GXH A;  4H2X C;  2K0X A;  2GON A;  2MR7 A;  1VQ6 P;  2M8N A;  5HGO A;  2CNR A;  1UJZ A;  2JPR A;  3E2D A;  4UHP B;  3U43 A;  1VQP P;  4QNB A;  1BXI A;  2PEN A;  2KGE A;  4GR6 A;  3G6E P;  1AUM A;  1G03 A;  2KOP A;  3CD6 P;  3M1M A;  2KGF A;  4PH1 A;  1YHQ P;  1QVG O;  3G1G A;  2XT1 A;  2EFJ A;  3LMO A;  1VQN P;  5F2O A;  1EM9 A;  2KGD A;  2VLQ A;  2L9F A;  2L22 A;  1VHN A;  2FVE A;  1BAJ A;  3HYB A;  4H2Y C;  2Z45 A;  1UNK A;  2XGV A;  1YJ9 P;  2JGP A;  2X83 A;  4U0F A;  4BPF A;  2M8P A;  1VQ8 P;  3G4S P;  3CXC O;  1VQ4 P;  2QNW A;  2PEQ A;  4BPG A;  1VQO P;  1S72 P;  4MRT C;  4PXH B;  2LKI A;  1IMP A;  2KOD A;  2PEO A;  5EJD A;  1YIT P;  2VSQ A;  2KG6 A;  3OW2 O;  5KP7 B;  2V4X A;  5HGM A;  2VLN A;  1U7K A;  2WLV B;  1YIJ P;  4U0B A;  3G71 P;  1A8O A;  5HGL A;  1K9M Q;  4U0E A;  2L6E A;  1M9D C;  3NY7 B;  1NJI Q;  3B5I A;  2LML A;  4F37 A;  3DS1 A;  3G29 A;  4PWV B;  5BS2 A;  2MR8 A;  4LQW C;  2N98 A;  2PNG A;  2BHV A;  3H4E A;  1M9F C;  2BUO A;  3H0D A;  3CCL P;  1EIA A;  3CC2 P;  4IZ6 A;  3WBH A;  5EW5 E;  2PWO A;  7CEI A;  1FR2 A;  2GOL B;  5KP8 B;  3LRY A;  2KWL A;  2KOQ A;  3G21 A;  1EOQ A;  1Q81 Q;  4BPH A;  1D1D A;  2JYL A;  1K73 Q;  4COC A;  4E92 A;  1L0I A;  2Y4Z A;  2GZI A;  2CG5 B;  1M1K Q;  2XDE A;  1VQ9 P;  2EIA A;  2QEX P;  1VKU A;  2CQ8 A;  3DS0 A;  5I4T G;  2XZ1 C;  5HGN A;  1IUQ A;  2KR5 A;  5JPA A;  1E0H A;  3DTJ A;  4DG9 A;  2JB0 A;  4QKO A;  4M0I A;  2N6Y A;  2PXR C;  2LTE A;  2FQ0 A;  1L0H A;  1YI2 P;  4PH3 A;  1ACP A;  1VQK P;  1GPJ A;  2GZG A;  2LF4 A;  2PEI A;  2FAC A;  2K5X A;  3CCM P;  1QRJ A;  1T8K A;  1E6J P;  2OTJ P;  3CC7 P;  2JU1 A;  3BP9 A;  1EMV A;  2LOL A;  2MVV A;  2XGY A;  4XRQ A;  2MD9 A;  5HV8 A;  3DS4 A;  2AVA A;  4NX4 C;  1CEI A;  1RO2 A;  3HZQ A;  4U0C A;  3VRL C;  2FHS C;  3CCQ P;  2JYG A;  1ZNV A;  4U0A A;  5HVC A;  1P7N A;  1F80 D;  2GDW A;  2ONT A;  1Q7Y Q;  2DNW A;  2FAD A;  2ROQ A;  2EG5 A;  2JQ4 A;  3GZL A;  1AFV A;  4J93 A;  1DV5 A;  2GDY A;  2LIU A;  1N8R Q;  3Q20 A;  1MZ8 A;  2L4B A;  2CGQ A;  3CCJ P;  2X2D D;  3NTE A;  1RO0 A;  2CWO A;  2JAZ A;  2XZ0 D;  2PEM A;  1Q82 Q;  1RNI A;  4H2W C;  2KGA A;  4GR2 A;  4DGE C;  2LIW A;  1KD1 Q;  3G26 A;  5DCK A;  1VQ5 P;  1JJ2 O;  2Z46 A;  4COP A;  3H47 A;  2DGY A;  2JU2 A;  1M9E C;  4HKG A;  2PY8 A;  2EHS A;  4U0D A;  1K8A Q;  2E1M A;  5F2N A;  2N5H A;  3I55 P;  2PEK A;  3EJE A;  4XRO A;  2GYK A;  1KLP A;  2M8L A;  2FQ1 A;  2MVU A;  1L6N A;  2XV6 A;  1GXG A;  3CE7 A;  3I56 P;  3CCE P;  2LL8 A;  2P9X A;  2K0Y A;  3P05 A;  3B4Q A;  1VQL P;  3CME P;  2K0D X;  3DS5 A;  3EJD A; 
#chains in the Genus database with same CATH homology
 1U7K A;  2WLV B;  2OTJ P;  4E91 A;  1M74 A;  1YIJ P;  4U0B A;  3G71 P;  3CC7 P;  1A8O A;  5HGL A;  5F2K A;  1YJW P;  1M9X C;  3BP9 A;  2QA4 P;  1AK4 C;  1KC8 Q;  2XGY A;  4XRQ A;  4U0E A;  1K9M Q;  2L6E A;  3DS4 A;  3CMA P;  1M9D C;  1M6E X;  4NX4 C;  1RO2 A;  3HZQ A;  1ZMB A;  1YJN P;  4XFZ A;  1M6N A;  4U0C A;  5BS1 A;  1NJI Q;  3B5I A;  3CPW O;  1GWP A;  3RG6 C;  4B4N A;  3DS1 A;  3G29 A;  1M90 Q;  1K30 A;  3MGE A;  5BS2 A;  3VRL C;  3G0V A;  3DS2 A;  4LQW C;  3CCQ P;  1VQ7 P;  4WYM A;  2JYG A;  4DGA C;  4U0A A;  2JO0 A;  1P7N A;  2BHV A;  3H4E A;  1M9F C;  2GON A;  2BUO A;  3H0D A;  2ONT A;  1EIA A;  1Q7Y Q;  3CC2 P;  3WBH A;  3CCL P;  2PWO A;  4HTW A;  2XGU A;  2GOL B;  2EG5 A;  1VQ6 P;  2M8N A;  5HGO A;  1AFV A;  4IPY A;  2JPR A;  3E2D A;  4J93 A;  4PH2 A;  3LRY A;  1VQP P;  4QNB A;  2Z44 A;  2PEN A;  4INB A;  4GR6 A;  4XFX A;  3G6E P;  3G21 A;  1N8R Q;  1AUM A;  1EOQ A;  3Q20 A;  1Q81 Q;  1G03 A;  3CD6 P;  3M1M A;  2KGF A;  4PH1 A;  1YHQ P;  1QVG O;  3G1G A;  3DS3 A;  2XT1 A;  2X2D D;  1D1D A;  2EFJ A;  2JYL A;  3CCJ P;  3NTE A;  1VQN P;  1RO0 A;  2CWO A;  5F2O A;  1K73 Q;  4COC A;  4E92 A;  1EM9 A;  2OAR A;  2PEM A;  1M9C C;  2Y4Z A;  1Q82 Q;  1RNI A;  1QVF O;  1M1K Q;  4XFY A;  2X82 A;  1M9Y C;  2XDE A;  1VQ9 P;  2EIA A;  2OTL P;  4GR2 A;  1BAJ A;  4DGE C;  2QEX P;  1KD1 Q;  3CC4 P;  3HYB A;  3G1I A;  3G26 A;  2Z45 A;  5DCK A;  1VQ5 P;  2XGV A;  3DS0 A;  5I4T G;  1YJ9 P;  1JJ2 O;  3G28 A;  2X83 A;  4U0F A;  2Z46 A;  3CCS P;  2PEJ A;  4COP A;  1A43 A;  3DPH A;  1W2B O;  2M8P A;  3H47 A;  2DGY A;  1M9E C;  5HGN A;  1IUQ A;  1VQ8 P;  5JPA A;  3G4S P;  3CXC O;  2PY8 A;  3DTJ A;  4U0D A;  1K8A Q;  2E1M A;  5F2N A;  1VQ4 P;  2PWM A;  3CCV P;  5HGK A;  3I55 P;  3CCR P;  2PEK A;  4M0I A;  4XRO A;  2PEQ A;  2PXR C;  1VQM P;  3CCU P;  1VQO P;  1S72 P;  2M8L A;  1YI2 P;  4PH3 A;  2KOD A;  1KQS O;  1VQK P;  1L6N A;  2XV6 A;  3I56 P;  3CCE P;  4PH0 A;  2XXM A;  2P9X A;  3P05 A;  1VQL P;  2LF4 A;  2PEO A;  2PEI A;  1YIT P;  2WLV A;  3CME P;  3OW2 O;  3CCM P;  1QRJ A;  2V4X A;  5HGM A;  3DS5 A;  1E6J P;  1Q86 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...