1D1DA

Nmr solution structure of the capsid protein from rous sarcoma virus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
220
structure length
220
Chain Sequence
WTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLDRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADITQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRAAPSTLTTPGEIIKYVLDRQKIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CAPSID PROTEIN)
publication title Solution structure and dynamics of the Rous sarcoma virus capsid protein and comparison with capsid proteins of other retroviruses.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 58
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1999-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1d1dA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1d1dA02
2BUOA 4PH1A 2X83A 4U0BA 4PH0A 4WYMA 2XV6A 3H47A 4DGEC 2WLVA 2WLVB 4IPYA 2XDEA 4J93A 4LQWC 4U0AA 5JPAA 1AK4C 4M0IA 2JYLA 2KODA 3NTEA 4B4NA 4COPA 1D1DA 2PWOA 4U0EA 1M9EC 4NX4C 4XFZA 3G29A 3DS3A 5HGOA 2ONTA 3G1IA 3LRYA 4HTWA 3DPHA 3P05A 3G1GA 1U7KA 3G0VA 3VRLC 1EOQA 2XT1A 1M9FC 2PXRC 2M8PA 1L6NA 4INBA 1P7NA 2EIAA 3DS4A 5HGNA 4U0DA 2XGYA 3DTJA 4COCA 2GONA 4E92A 3G21A 1QRJA 4XFXA 2Y4ZA 1EIAA 1M9XC 1GWPA 2LF4A 1E6JP 1M9YC 4PH2A 1AUMA 4U0CA 1A43A 2JYGA 3G28A 1G03A 2GOLB 2X2DD 1BAJA 5I4TG 3MGEA 2XGUA 5HGKA 3BP9A 4DGAC 2M8NA 1M9CC 2JO0A 1EM9A 4XRQA 2X82A 2V4XA 2PWMA 1A8OA 3G26A 3H4EA 3DS0A 4U0FA 3DS5A 3DS1A 1M9DC 2XGVA 5HGLA 2KGFA 1AFVA 5HGMA 4XFYA 2M8LA 5DCKA 2XXMA 4PH3A 4XROA 4E91A 2JPRA 3DS2A 4QNBA 2L6EA
chains in the Genus database with same CATH superfamily
2BUOA 3CCRP 2X83A 1RNIA 2GDWA 7CEIA 4IPYA 5JPAA 1AK4C 3CCUP 2PY8A 1M9EC 1ACPA 2K94A 4HKGA 3DS3A 2K0DX 5HGOA 3CXCO 2LIUA 2PNGA 1Q81Q 4HTWA 5HVCA 3G1GA 2GDYA 3M1MA 1VQOP 2EHTA 2E1MA 2M8PA 2JB0A 2GYKA 2EFJA 2N5HA 2EIAA 1M6NA 2KGCA 2XGYA 3DTJA 3EJBA 5BS2A 2MVVA 1QRJA 4XFXA 3CMAP 2KOSA 2JYGA 5BS1A 1VQ6P 5EW5E 4PWVB 2AF8A 2QNWA 1BAJA 5I4TG 3CCMP 3MGEA 3CC7P 5HGKA 1GXHA 2KOOA 2AFDA 1K9MQ 1VHNA 2KOQA 3CCVP 2V4XA 1K8AQ 2PENA 5CZDB 3B4QA 2N6YA 1VQMP 1ZNVA 1HY8A 3CCLP 2OTJP 2KG6A 2KGFA 2N5IA 2OTLP 2N6ZA 2GZEA 2XXMA 2Z44A 4BPFA 1GXGA 2MF4A 2MR8A 1KD1Q 1E0HA 1DNYA 4E91A 4GR2A 2FQ0A 2QEXP 1GPJA 1VKUA 4WYMA 2XV6A 2LPKA 3H47A 1FR2A 4DGEC 2VLQA 3CC4P 2WLVB 1Z6MA 4M0IA 3G71P 4B4NA 2PEMA 2KR5A 1YJNP 3GZMA 2EG5A 1VQ7P 2FVEA 2PEKA 3WBHA 1OR5A 2JBGA 1NJIQ 3G1IA 3LRYA 3I56P 2LL8A 1IUQA 2MD9A 2AFEA 3CCJP 3VRLC 1M9FC 1Q82Q 2L0QA 3DS4A 5KP6B 1L0IA 3NY7B 4COCA 2GONA 4E92A 2VSQA 1NQ4A 3G6EP 4H2YC 1GWPA 2LF4A 1M1KQ 3RG2A 2XZ1C 3G28A 1VQ4P 2KG9A 1HQBA 2JGPA 1VQKP 2VLNA 2KWLA 2JAZA 2M8NA 1T8KA 3EJDA 2JO0A 1X3OA 4XRQA 1CEIA 1VQNP 2X82A 2N98A 3CMEP 2KG8A 1RO2A 2PWMA 3H4EA 4MRTC 3DS0A 2FQ2A 1L0HA 2MY5A 2KGEA 3HYBA 4NEOA 1Q7YQ 2XGVA 2FACA 3CD6P 5KP8B 4XFYA 2GZJA 2PEOA 4XROA 3CCSP 2L6EA 2K0XA 2P9XA 1W2BO 4PH1A 1YITP 4PH0A 5EJDA 1M90Q 2WLVA 2BHVA 1ZMBA 2PEIA 2XDEA 1UNKA 4LQWC 2K5XA 5KP7B 4H2WC 1YHQP 2JYLA 3NTEA 1M6EX 2WPTA 2FAEA 1D1DA 4U0EA 2LTEA 4NX4C 1EMVA 2MR7A 3G29A 4QKOA 3Q20A 3U43A 2FVFA 2ONTA 1IMQA 2NO8A 4R0MA 3CCEP 3CE7A 2LKIA 3G0VA 1Q86Q 2XT1A 1DV5A 5F2OA 2GZFA 2PXRC 1YIJP 2FHSC 2FADA 1VQ8P 4U0DA 2N50A 1KQSO 3G21A 2CNRA 2Y4ZA 3HZQA 3H0DA 1EIAA 1M9XC 1QVGO 2K93A 2DGYA 4UHPB 1E6JP 4U0CA 1G03A 2CG5B 1IMPA 2DNWA 2GZGA 1RO0A 2K2QA 3GKLC 2PEQA 3CCQP 3CC2P 1EM9A 1K73Q 5F2KA 2K0YA 1JJ2O 2KGDA 3CPWO 1KC8Q 1A8OA 4U0FA 3DS1A 2JU1A 1VQPP 3DS2A 4H2XC 2X2BA 2VLPA 2LMLA 4U0BA 2Z45A 1AYIA 2L9FA 4J93A 4U0AA 5F2NA 2L22A 2AVAA 3OW2O 2KODA 2JQ4A 2M5RA 4COPA 2KW2A 2PWOA 2EHSA 4XFZA 2FQ1A 1MZ8A 2JU2A 4DG9A 1S72P 3DPHA 3P05A 2L4BA 4IZ6A 4GR6A 1U7KA 1EOQA 3I55P 4PXHB 2CGQA 1YJ9P 1L6NA 2LIWA 2CWOA 4INBA 1M74A 1P7NA 4BPGA 5HGNA 3LMOA 3GJNA 2K92A 2KORA 2ROQA 2GZIA 1YJWP 1F80D 1KLPA 2KOPA 1M9YC 4PH2A 4BPHA 1AUMA 2QA4P 1A43A 3G4SP 2GOLB 2PEJA 2X2DD 1N8RQ 2Z46A 2MVUA 1K30A 2XGUA 2XZ0D 3BP9A 4DGAC 1M9CC 2KGAA 3B5IA 2GDXA 1UJZA 5HV8A 1BXIA 1QVFO 3RG6C 2CQ8A 3G26A 3EJEA 3E2DA 3DS5A 3GZLA 1M9DC 5HGLA 1AFVA 2M8LA 5HGMA 2OARA 1VQ5P 2FVAA 5DCKA 1YI2P 4F37A 2ERHA 1VQ9P 4PH3A 2VLOA 1VQLP 1AF8A 2LOLA 2JPRA 4QNBA 4CA3A
chains in the Genus database with same CATH topology
2P9XA 2BUOA 4PH1A 3CCRP 1W2BO 1YITP 2X83A 4U0BA 4PH0A 1RNIA 2Z45A 4WYMA 2XV6A 1M90Q 3H47A 4DGEC 2WLVA 2BHVA 1ZMBA 2PEIA 2WLVB 4IPYA 2XDEA 3CC4P 4J93A 4LQWC 4U0AA 5F2NA 5JPAA 1YHQP 1AK4C 4M0IA 2JYLA 3OW2O 2KODA 3NTEA 1M6EX 3G71P 3CCUP 4B4NA 4COPA 2PY8A 1D1DA 2PWOA 4U0EA 1M9EC 4NX4C 2PEMA 1YJNP 4XFZA 2EG5A 3G29A 3Q20A 1VQ7P 2PEKA 3WBHA 3DS3A 5HGOA 2ONTA 3CXCO 1NJIQ 3G1IA 3LRYA 3CCEP 3I56P 1Q81Q 4HTWA 1S72P 3DPHA 1IUQA 3P05A 3G1GA 3CCJP 3M1MA 4GR6A 1VQOP 1U7KA 3G0VA 3VRLC 1EOQA 2XT1A 3I55P 1Q86Q 2E1MA 5F2OA 1M9FC 1Q82Q 2PXRC 1YJ9P 2M8PA 1L6NA 2CWOA 1YIJP 4INBA 1M74A 1P7NA 2EFJA 2EIAA 3DS4A 1M6NA 1VQ8P 5HGNA 4U0DA 2XGYA 3DTJA 4COCA 5BS2A 1KQSO 2GONA 4E92A 3G21A 1QRJA 4XFXA 2Y4ZA 3HZQA 3G6EP 3CMAP 3H0DA 1YJWP 1EIAA 1M9XC 1QVGO 1GWPA 2DGYA 2LF4A 1E6JP 1M9YC 1M1KQ 4PH2A 1AUMA 2QA4P 4U0CA 1A43A 2JYGA 3G28A 5BS1A 1G03A 1VQ4P 1VQ6P 3G4SP 2GOLB 2PEJA 2X2DD 1N8RQ 1BAJA 1RO0A 5I4TG 2Z46A 3MGEA 3CCMP 3CC7P 1K30A 2XGUA 1VQKP 2PEQA 3CCQP 5HGKA 3CC2P 3BP9A 4DGAC 2M8NA 1K9MQ 1M9CC 2JO0A 3B5IA 1EM9A 3CCVP 4XRQA 1K73Q 5F2KA 1VQNP 1QVFO 1JJ2O 2X82A 2V4XA 1K8AQ 2PENA 3CPWO 3CMEP 3RG6C 1RO2A 2PWMA 1KC8Q 1A8OA 3G26A 3H4EA 1VQMP 3DS0A 4U0FA 3E2DA 3DS5A 3DS1A 3CCLP 3HYBA 1M9DC 1Q7YQ 2XGVA 5HGLA 2OTJP 2KGFA 1AFVA 5HGMA 4XFYA 2M8LA 2OARA 5DCKA 1VQ5P 3CD6P 2OTLP 1VQPP 1YI2P 2PEOA 2XXMA 2Z44A 1VQ9P 4PH3A 1KD1Q 1VQLP 4XROA 4E91A 4GR2A 3CCSP 2JPRA 3DS2A 4QNBA 2L6EA 2QEXP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUO A;  4PH1 A;  2X83 A;  4U0B A;  4PH0 A;  4WYM A;  2XV6 A;  3H47 A;  4DGE C;  2WLV A;  2WLV B;  4IPY A;  2XDE A;  4J93 A;  4LQW C;  4U0A A;  5JPA A;  1AK4 C;  4M0I A;  2JYL A;  2KOD A;  3NTE A;  4B4N A;  4COP A;  1D1D A;  2PWO A;  4U0E A;  1M9E C;  4NX4 C;  4XFZ A;  3G29 A;  3DS3 A;  5HGO A;  2ONT A;  3G1I A;  3LRY A;  4HTW A;  3DPH A;  3P05 A;  3G1G A;  1U7K A;  3G0V A;  3VRL C;  1EOQ A;  2XT1 A;  1M9F C;  2PXR C;  2M8P A;  1L6N A;  4INB A;  1P7N A;  2EIA A;  3DS4 A;  5HGN A;  4U0D A;  2XGY A;  3DTJ A;  4COC A;  2GON A;  4E92 A;  3G21 A;  1QRJ A;  4XFX A;  2Y4Z A;  1EIA A;  1M9X C;  1GWP A;  2LF4 A;  1E6J P;  1M9Y C;  4PH2 A;  1AUM A;  4U0C A;  1A43 A;  2JYG A;  3G28 A;  1G03 A;  2GOL B;  2X2D D;  1BAJ A;  5I4T G;  3MGE A;  2XGU A;  5HGK A;  3BP9 A;  4DGA C;  2M8N A;  1M9C C;  2JO0 A;  1EM9 A;  4XRQ A;  2X82 A;  2V4X A;  2PWM A;  1A8O A;  3G26 A;  3H4E A;  3DS0 A;  4U0F A;  3DS5 A;  3DS1 A;  1M9D C;  2XGV A;  5HGL A;  2KGF A;  1AFV A;  5HGM A;  4XFY A;  2M8L A;  5DCK A;  2XXM A;  4PH3 A;  4XRO A;  4E91 A;  2JPR A;  3DS2 A;  4QNB A;  2L6E A; 
#chains in the Genus database with same CATH topology
 2BUO A;  3CCR P;  2X83 A;  1RNI A;  2GDW A;  7CEI A;  4IPY A;  5JPA A;  1AK4 C;  3CCU P;  2PY8 A;  1M9E C;  1ACP A;  2K94 A;  4HKG A;  3DS3 A;  2K0D X;  5HGO A;  3CXC O;  2LIU A;  2PNG A;  1Q81 Q;  4HTW A;  5HVC A;  3G1G A;  2GDY A;  3M1M A;  1VQO P;  2EHT A;  2E1M A;  2M8P A;  2JB0 A;  2GYK A;  2EFJ A;  2N5H A;  2EIA A;  1M6N A;  2KGC A;  2XGY A;  3DTJ A;  3EJB A;  5BS2 A;  2MVV A;  1QRJ A;  4XFX A;  3CMA P;  2KOS A;  2JYG A;  5BS1 A;  1VQ6 P;  5EW5 E;  4PWV B;  2AF8 A;  2QNW A;  1BAJ A;  5I4T G;  3CCM P;  3MGE A;  3CC7 P;  5HGK A;  1GXH A;  2KOO A;  2AFD A;  1K9M Q;  1VHN A;  2KOQ A;  3CCV P;  2V4X A;  1K8A Q;  2PEN A;  5CZD B;  3B4Q A;  2N6Y A;  1VQM P;  1ZNV A;  1HY8 A;  3CCL P;  2OTJ P;  2KG6 A;  2KGF A;  2N5I A;  2OTL P;  2N6Z A;  2GZE A;  2XXM A;  2Z44 A;  4BPF A;  1GXG A;  2MF4 A;  2MR8 A;  1KD1 Q;  1E0H A;  1DNY A;  4E91 A;  4GR2 A;  2FQ0 A;  2QEX P;  1GPJ A;  1VKU A;  4WYM A;  2XV6 A;  2LPK A;  3H47 A;  1FR2 A;  4DGE C;  2VLQ A;  3CC4 P;  2WLV B;  1Z6M A;  4M0I A;  3G71 P;  4B4N A;  2PEM A;  2KR5 A;  1YJN P;  3GZM A;  2EG5 A;  1VQ7 P;  2FVE A;  2PEK A;  3WBH A;  1OR5 A;  2JBG A;  1NJI Q;  3G1I A;  3LRY A;  3I56 P;  2LL8 A;  1IUQ A;  2MD9 A;  2AFE A;  3CCJ P;  3VRL C;  1M9F C;  1Q82 Q;  2L0Q A;  3DS4 A;  5KP6 B;  1L0I A;  3NY7 B;  4COC A;  2GON A;  4E92 A;  2VSQ A;  1NQ4 A;  3G6E P;  4H2Y C;  1GWP A;  2LF4 A;  1M1K Q;  3RG2 A;  2XZ1 C;  3G28 A;  1VQ4 P;  2KG9 A;  1HQB A;  2JGP A;  1VQK P;  2VLN A;  2KWL A;  2JAZ A;  2M8N A;  1T8K A;  3EJD A;  2JO0 A;  1X3O A;  4XRQ A;  1CEI A;  1VQN P;  2X82 A;  2N98 A;  3CME P;  2KG8 A;  1RO2 A;  2PWM A;  3H4E A;  4MRT C;  3DS0 A;  2FQ2 A;  1L0H A;  2MY5 A;  2KGE A;  3HYB A;  4NEO A;  1Q7Y Q;  2XGV A;  2FAC A;  3CD6 P;  5KP8 B;  4XFY A;  2GZJ A;  2PEO A;  4XRO A;  3CCS P;  2L6E A;  2K0X A;  2P9X A;  1W2B O;  4PH1 A;  1YIT P;  4PH0 A;  5EJD A;  1M90 Q;  2WLV A;  2BHV A;  1ZMB A;  2PEI A;  2XDE A;  1UNK A;  4LQW C;  2K5X A;  5KP7 B;  4H2W C;  1YHQ P;  2JYL A;  3NTE A;  1M6E X;  2WPT A;  2FAE A;  1D1D A;  4U0E A;  2LTE A;  4NX4 C;  1EMV A;  2MR7 A;  3G29 A;  4QKO A;  3Q20 A;  3U43 A;  2FVF A;  2ONT A;  1IMQ A;  2NO8 A;  4R0M A;  3CCE P;  3CE7 A;  2LKI A;  3G0V A;  1Q86 Q;  2XT1 A;  1DV5 A;  5F2O A;  2GZF A;  2PXR C;  1YIJ P;  2FHS C;  2FAD A;  1VQ8 P;  4U0D A;  2N50 A;  1KQS O;  3G21 A;  2CNR A;  2Y4Z A;  3HZQ A;  3H0D A;  1EIA A;  1M9X C;  1QVG O;  2K93 A;  2DGY A;  4UHP B;  1E6J P;  4U0C A;  1G03 A;  2CG5 B;  1IMP A;  2DNW A;  2GZG A;  1RO0 A;  2K2Q A;  3GKL C;  2PEQ A;  3CCQ P;  3CC2 P;  1EM9 A;  1K73 Q;  5F2K A;  2K0Y A;  1JJ2 O;  2KGD A;  3CPW O;  1KC8 Q;  1A8O A;  4U0F A;  3DS1 A;  2JU1 A;  1VQP P;  3DS2 A;  4H2X C;  2X2B A;  2VLP A;  2LML A;  4U0B A;  2Z45 A;  1AYI A;  2L9F A;  4J93 A;  4U0A A;  5F2N A;  2L22 A;  2AVA A;  3OW2 O;  2KOD A;  2JQ4 A;  2M5R A;  4COP A;  2KW2 A;  2PWO A;  2EHS A;  4XFZ A;  2FQ1 A;  1MZ8 A;  2JU2 A;  4DG9 A;  1S72 P;  3DPH A;  3P05 A;  2L4B A;  4IZ6 A;  4GR6 A;  1U7K A;  1EOQ A;  3I55 P;  4PXH B;  2CGQ A;  1YJ9 P;  1L6N A;  2LIW A;  2CWO A;  4INB A;  1M74 A;  1P7N A;  4BPG A;  5HGN A;  3LMO A;  3GJN A;  2K92 A;  2KOR A;  2ROQ A;  2GZI A;  1YJW P;  1F80 D;  1KLP A;  2KOP A;  1M9Y C;  4PH2 A;  4BPH A;  1AUM A;  2QA4 P;  1A43 A;  3G4S P;  2GOL B;  2PEJ A;  2X2D D;  1N8R Q;  2Z46 A;  2MVU A;  1K30 A;  2XGU A;  2XZ0 D;  3BP9 A;  4DGA C;  1M9C C;  2KGA A;  3B5I A;  2GDX A;  1UJZ A;  5HV8 A;  1BXI A;  1QVF O;  3RG6 C;  2CQ8 A;  3G26 A;  3EJE A;  3E2D A;  3DS5 A;  3GZL A;  1M9D C;  5HGL A;  1AFV A;  2M8L A;  5HGM A;  2OAR A;  1VQ5 P;  2FVA A;  5DCK A;  1YI2 P;  4F37 A;  2ERH A;  1VQ9 P;  4PH3 A;  2VLO A;  1VQL P;  1AF8 A;  2LOL A;  2JPR A;  4QNB A;  4CA3 A; 
#chains in the Genus database with same CATH homology
 2P9X A;  2BUO A;  4PH1 A;  3CCR P;  1W2B O;  1YIT P;  2X83 A;  4U0B A;  4PH0 A;  1RNI A;  2Z45 A;  4WYM A;  2XV6 A;  1M90 Q;  3H47 A;  4DGE C;  2WLV A;  2BHV A;  1ZMB A;  2PEI A;  2WLV B;  4IPY A;  2XDE A;  3CC4 P;  4J93 A;  4LQW C;  4U0A A;  5F2N A;  5JPA A;  1YHQ P;  1AK4 C;  4M0I A;  2JYL A;  3OW2 O;  2KOD A;  3NTE A;  1M6E X;  3G71 P;  3CCU P;  4B4N A;  4COP A;  2PY8 A;  1D1D A;  2PWO A;  4U0E A;  1M9E C;  4NX4 C;  2PEM A;  1YJN P;  4XFZ A;  2EG5 A;  3G29 A;  3Q20 A;  1VQ7 P;  2PEK A;  3WBH A;  3DS3 A;  5HGO A;  2ONT A;  3CXC O;  1NJI Q;  3G1I A;  3LRY A;  3CCE P;  3I56 P;  1Q81 Q;  4HTW A;  1S72 P;  3DPH A;  1IUQ A;  3P05 A;  3G1G A;  3CCJ P;  3M1M A;  4GR6 A;  1VQO P;  1U7K A;  3G0V A;  3VRL C;  1EOQ A;  2XT1 A;  3I55 P;  1Q86 Q;  2E1M A;  5F2O A;  1M9F C;  1Q82 Q;  2PXR C;  1YJ9 P;  2M8P A;  1L6N A;  2CWO A;  1YIJ P;  4INB A;  1M74 A;  1P7N A;  2EFJ A;  2EIA A;  3DS4 A;  1M6N A;  1VQ8 P;  5HGN A;  4U0D A;  2XGY A;  3DTJ A;  4COC A;  5BS2 A;  1KQS O;  2GON A;  4E92 A;  3G21 A;  1QRJ A;  4XFX A;  2Y4Z A;  3HZQ A;  3G6E P;  3CMA P;  3H0D A;  1YJW P;  1EIA A;  1M9X C;  1QVG O;  1GWP A;  2DGY A;  2LF4 A;  1E6J P;  1M9Y C;  1M1K Q;  4PH2 A;  1AUM A;  2QA4 P;  4U0C A;  1A43 A;  2JYG A;  3G28 A;  5BS1 A;  1G03 A;  1VQ4 P;  1VQ6 P;  3G4S P;  2GOL B;  2PEJ A;  2X2D D;  1N8R Q;  1BAJ A;  1RO0 A;  5I4T G;  2Z46 A;  3MGE A;  3CCM P;  3CC7 P;  1K30 A;  2XGU A;  1VQK P;  2PEQ A;  3CCQ P;  5HGK A;  3CC2 P;  3BP9 A;  4DGA C;  2M8N A;  1K9M Q;  1M9C C;  2JO0 A;  3B5I A;  1EM9 A;  3CCV P;  4XRQ A;  1K73 Q;  5F2K A;  1VQN P;  1QVF O;  1JJ2 O;  2X82 A;  2V4X A;  1K8A Q;  2PEN A;  3CPW O;  3CME P;  3RG6 C;  1RO2 A;  2PWM A;  1KC8 Q;  1A8O A;  3G26 A;  3H4E A;  1VQM P;  3DS0 A;  4U0F A;  3E2D A;  3DS5 A;  3DS1 A;  3CCL P;  3HYB A;  1M9D C;  1Q7Y Q;  2XGV A;  5HGL A;  2OTJ P;  2KGF A;  1AFV A;  5HGM A;  4XFY A;  2M8L A;  2OAR A;  5DCK A;  1VQ5 P;  3CD6 P;  2OTL P;  1VQP P;  1YI2 P;  2PEO A;  2XXM A;  2Z44 A;  1VQ9 P;  4PH3 A;  1KD1 Q;  1VQL P;  4XRO A;  4E91 A;  4GR2 A;  3CCS P;  2JPR A;  3DS2 A;  4QNB A;  2L6E A;  2QEX P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...