1D1DA

Nmr solution structure of the capsid protein from rous sarcoma virus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
220
structure length
220
Chain Sequence
WTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLDRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADITQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRAAPSTLTTPGEIIKYVLDRQKIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the Rous sarcoma virus capsid protein and comparison with capsid proteins of other retroviruses.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords PROTEIN (CAPSID PROTEIN)
total genus 58
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1999-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1d1dA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1d1dA02
4U0AA 4WYMA 1G03A 1AUMA 3DS0A 4U0DA 2XDEA 2V4XA 2PXRC 3DS2A 4PH0A 2BUOA 2X2DD 4U0BA 3DS5A 5HGKA 3G1IA 5I4TG 1P7NA 4IPYA 4XRQA 2GOLB 5HGOA 1BAJA 2WLVB 1A8OA 2WLVA 3DS1A 4HTWA 3LRYA 1GWPA 2Y4ZA 1M9FC 4U0EA 1E6JP 3P05A 2LF4A 3G26A 5JPAA 5DCKA 3G28A 3G29A 2M8NA 1EM9A 1EIAA 3DTJA 2GONA 1U7KA 2XGVA 2JO0A 1D1DA 1L6NA 2XXMA 3G1GA 4NX4C 5HGMA 4DGAC 2XT1A 4QNBA 3DS4A 2EIAA 4E91A 1A43A 2PWMA 2X82A 1M9YC 1M9CC 1M9XC 1AK4C 4DGEC 2X83A 2JYLA 3H4EA 2JPRA 2L6EA 4B4NA 3VRLC 3BP9A 1QRJA 4PH3A 4M0IA 2JYGA 1M9EC 4U0CA 4PH1A 4E92A 3G0VA 2KGFA 2KODA 2M8PA 4LQWC 5HGNA 3NTEA 2XGYA 1AFVA 4INBA 3G21A 4COPA 4XROA 4PH2A 1M9DC 1EOQA 2XGUA 2M8LA 4U0FA 3DPHA 4XFZA 3H47A 4COCA 2ONTA 3MGEA 5HGLA 4XFXA 4XFYA 2XV6A 3DS3A 2PWOA 4J93A
chains in the Genus database with same CATH superfamily
3EJBA 2AF8A 4NEOA 2KOPA 2PNGA 1KC8Q 3DS2A 2NO8A 2WPTA 2X2DD 1YI2P 2CQ8A 2N6YA 3CC7P 1M6EX 4GR2A 2MD9A 2CWOA 3CE7A 5I4TG 4BPHA 4IPYA 1X3OA 3CCLP 2LPKA 2K93A 4XRQA 5HGOA 4IZ6A 5EW5E 3M1MA 2LOLA 2K0XA 1OR5A 2WLVA 3DS1A 4PXHB 2ROQA 3CCMP 2Y4ZA 1EMVA 1M9FC 2ERHA 2FQ0A 2MY5A 3Q20A 3EJEA 1VQKP 2LMLA 2MVVA 2M8NA 1Z6MA 1EIAA 3DTJA 5BS2A 1VQPP 1D1DA 1L6NA 2JB0A 5F2OA 1QVFO 1K8AQ 1M9CC 2DGYA 2PEQA 2MR8A 2KW2A 2X83A 1MZ8A 1VHNA 2FVFA 4CA3A 2VLPA 1E0HA 4GR6A 4PH1A 4E92A 2KGFA 2KODA 2N98A 2EHSA 2M8PA 3NTEA 2MVUA 2L4BA 2JU2A 1RO0A 2M5RA 2M8LA 4U0FA 3CC4P 3GZMA 5F2NA 4H2YC 2XV6A 2DNWA 3GJNA 1F80D 4U0AA 4WYMA 1G03A 1AUMA 2QA4P 3CXCO 2GZEA 4MRTC 4BPFA 2JGPA 2XDEA 2VSQA 4PH0A 2BUOA 3CCSP 4U0BA 3DS5A 1T8KA 2FVAA 3CD6P 1K9MQ 3B4QA 2N5HA 4UHPB 2GOLB 2LIWA 5EJDA 2WLVB 1A8OA 4HTWA 1GWPA 2K92A 3E2DA 3U43A 2GDXA 3P05A 2LF4A 3G26A 3H0DA 5DCKA 1K73Q 3G28A 2PY8A 2N50A 1EM9A 2L9FA 2PEMA 3B5IA 1DNYA 2GZIA 2Z45A 4BPGA 5KP8B 2LL8A 3CMAP 3G1GA 1KD1Q 2PEIA 2EIAA 4E91A 1L0HA 2E1MA 3G4SP 1M9XC 1AK4C 2OARA 2EG5A 1HQBA 1KQSO 1VQLP 1QRJA 2QNWA 5HVCA 4PH3A 2KWLA 1RO2A 2VLQA 1IMPA 4U0CA 2AFDA 3G0VA 1VQOP 3I56P 1W2BO 2XZ1C 5HGNA 1ACPA 2XGYA 1YJNP 4PWVB 3G21A 1NJIQ 2L22A 1M9DC 2XGUA 2PEKA 3DPHA 2X2BA 1VQMP 2GDWA 3CC2P 2ONTA 3G71P 3MGEA 2FAEA 1RNIA 2GZGA 2GZFA 2KGCA 1KLPA 2KG9A 1M1KQ 2EHTA 5CZDB 4U0DA 2KGEA 2MF4A 4DG9A 2V4XA 1VQ6P 5HGKA 7CEIA 2CGQA 3G1IA 3CCJP 2BHVA 1VQ5P 3LMOA 1YJ9P 2JAZA 1GXGA 1ZMBA 1BAJA 1VQ9P 2FADA 1GPJA 1E6JP 2K5XA 5JPAA 3CCQP 2KR5A 2GONA 2XGVA 1FR2A 2JQ4A 5KP6B 3I55P 1Q7YQ 4QKOA 1BXIA 3CMEP 4NX4C 5HGMA 2L0QA 2XT1A 3DS4A 2AVAA 2FQ1A 2K0DX 1AF8A 1IMQA 1UNKA 3GZLA 4DGEC 2GZJA 1K30A 2JYLA 2L6EA 4B4NA 3VRLC 3BP9A 2GDYA 2KGDA 1Q86Q 2EFJA 4M0IA 2JYGA 1M9EC 2CG5B 2KOSA 1AFVA 2KORA 1M74A 1GXHA 4PH2A 1UJZA 2N6ZA 2KOQA 1EOQA 2LTEA 2FQ2A 4XFZA 1VQNP 3H47A 1NQ4A 2OTJP 3OW2O 1M6NA 2KG8A 4F37A 2KGAA 3HZQA 4XFXA 4XFYA 5HV8A 5F2KA 3DS3A 1ZNVA 1AYIA 2QEXP 3DS0A 4H2WC 1M90Q 2PXRC 2OTLP 2MR7A 2K0YA 3WBHA 1VQ7P 1YITP 2PEJA 1P7NA 1JJ2O 3CCEP 2K94A 2FHSC 1VKUA 1CEIA 2CNRA 2XZ0D 3RG6C 5BS1A 3LRYA 4U0EA 2PEOA 1YIJP 3G29A 3RG2A 2Z46A 3GKLC 1Q81Q 1U7KA 2JO0A 1IUQA 2KOOA 1L0IA 2JBGA 1N8RQ 4R0MA 2N5IA 2LKIA 2XXMA 4DGAC 2PENA 4QNBA 2LIUA 1A43A 2PWMA 2X82A 2K2QA 2VLOA 3CCRP 1M9YC 2FVEA 1VQ8P 2AFEA 1VQ4P 3H4EA 2JPRA 2P9XA 1S72P 2KG6A 3G6EP 1YJWP 2JU1A 3EJDA 1HY8A 3NY7B 3CCVP 4LQWC 3CPWO 1Q82Q 1QVGO 3CCUP 2Z44A 4COPA 4INBA 4XROA 2FACA 5KP7B 4HKGA 1YHQP 4H2XC 4COCA 5HGLA 1DV5A 2GYKA 3HYBA 2PWOA 4J93A 2VLNA
chains in the Genus database with same CATH topology
4U0AA 4WYMA 1G03A 1AUMA 2QA4P 3CXCO 2QEXP 1M1KQ 3DS0A 4U0DA 2XDEA 1KC8Q 2V4XA 2PXRC 3DS2A 4PH0A 1M90Q 2OTLP 2BUOA 2X2DD 3CCSP 4U0BA 3WBHA 3DS5A 1YI2P 1VQ7P 1VQ6P 5HGKA 3CC7P 1M6EX 3G1IA 3CCJP 2BHVA 4GR2A 1YITP 1VQ5P 2CWOA 2PEJA 5I4TG 1P7NA 1JJ2O 4IPYA 3CCEP 3CD6P 1K9MQ 3CCLP 1YJ9P 4XRQA 2GOLB 5HGOA 3M1MA 1ZMBA 1BAJA 3RG6C 1VQ9P 2WLVB 1A8OA 5BS1A 2WLVA 3DS1A 4HTWA 3LRYA 1GWPA 3CCMP 2Y4ZA 3E2DA 1M9FC 4U0EA 1E6JP 3P05A 2LF4A 3G26A 2PEOA 3H0DA 3Q20A 1YIJP 5JPAA 5DCKA 1K73Q 3G28A 3G29A 3CCQP 1VQKP 2PY8A 2Z46A 2M8NA 1EM9A 2PEMA 1EIAA 3DTJA 3B5IA 1Q81Q 2GONA 1U7KA 2XGVA 2JO0A 1IUQA 2Z45A 5BS2A 1VQPP 1N8RQ 3I55P 1Q7YQ 1D1DA 3CMAP 3CMEP 1L6NA 2XXMA 3G1GA 4NX4C 5HGMA 5F2OA 4DGAC 2PENA 2XT1A 1KD1Q 2PEIA 4QNBA 3DS4A 1QVFO 2EIAA 4E91A 1A43A 2PWMA 2X82A 2E1MA 3CCRP 1M9YC 3G4SP 1K8AQ 1M9CC 1M9XC 1AK4C 2DGYA 2OARA 2PEQA 4DGEC 1VQ8P 2EG5A 2X83A 1VQ4P 1K30A 2JYLA 3H4EA 1KQSO 2JPRA 2L6EA 4B4NA 2P9XA 3VRLC 3BP9A 1VQLP 1QRJA 1S72P 1Q86Q 4PH3A 2EFJA 4M0IA 2JYGA 1RO2A 1M9EC 4GR6A 3G6EP 1YJWP 4U0CA 4PH1A 4E92A 3G0VA 1VQOP 2KGFA 3I56P 2KODA 1W2BO 3CCVP 2M8PA 4LQWC 5HGNA 3CPWO 1Q82Q 1QVGO 3NTEA 2XGYA 3CCUP 1YJNP 2Z44A 1AFVA 4INBA 3G21A 4COPA 1NJIQ 1RO0A 4XROA 1M74A 4PH2A 1M9DC 1EOQA 2XGUA 2M8LA 2PEKA 4U0FA 3DPHA 3CC4P 4XFZA 1VQNP 3H47A 1VQMP 2OTJP 1YHQP 5F2NA 3OW2O 3CC2P 1M6NA 4COCA 2ONTA 3G71P 3MGEA 3HZQA 1RNIA 5HGLA 4XFXA 4XFYA 2XV6A 5F2KA 3DS3A 3HYBA 2PWOA 4J93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0A A;  4WYM A;  1G03 A;  1AUM A;  3DS0 A;  4U0D A;  2XDE A;  2V4X A;  2PXR C;  3DS2 A;  4PH0 A;  2BUO A;  2X2D D;  4U0B A;  3DS5 A;  5HGK A;  3G1I A;  5I4T G;  1P7N A;  4IPY A;  4XRQ A;  2GOL B;  5HGO A;  1BAJ A;  2WLV B;  1A8O A;  2WLV A;  3DS1 A;  4HTW A;  3LRY A;  1GWP A;  2Y4Z A;  1M9F C;  4U0E A;  1E6J P;  3P05 A;  2LF4 A;  3G26 A;  5JPA A;  5DCK A;  3G28 A;  3G29 A;  2M8N A;  1EM9 A;  1EIA A;  3DTJ A;  2GON A;  1U7K A;  2XGV A;  2JO0 A;  1D1D A;  1L6N A;  2XXM A;  3G1G A;  4NX4 C;  5HGM A;  4DGA C;  2XT1 A;  4QNB A;  3DS4 A;  2EIA A;  4E91 A;  1A43 A;  2PWM A;  2X82 A;  1M9Y C;  1M9C C;  1M9X C;  1AK4 C;  4DGE C;  2X83 A;  2JYL A;  3H4E A;  2JPR A;  2L6E A;  4B4N A;  3VRL C;  3BP9 A;  1QRJ A;  4PH3 A;  4M0I A;  2JYG A;  1M9E C;  4U0C A;  4PH1 A;  4E92 A;  3G0V A;  2KGF A;  2KOD A;  2M8P A;  4LQW C;  5HGN A;  3NTE A;  2XGY A;  1AFV A;  4INB A;  3G21 A;  4COP A;  4XRO A;  4PH2 A;  1M9D C;  1EOQ A;  2XGU A;  2M8L A;  4U0F A;  3DPH A;  4XFZ A;  3H47 A;  4COC A;  2ONT A;  3MGE A;  5HGL A;  4XFX A;  4XFY A;  2XV6 A;  3DS3 A;  2PWO A;  4J93 A; 
#chains in the Genus database with same CATH topology
 3EJB A;  2AF8 A;  4NEO A;  2KOP A;  2PNG A;  1KC8 Q;  3DS2 A;  2NO8 A;  2WPT A;  2X2D D;  1YI2 P;  2CQ8 A;  2N6Y A;  3CC7 P;  1M6E X;  4GR2 A;  2MD9 A;  2CWO A;  3CE7 A;  5I4T G;  4BPH A;  4IPY A;  1X3O A;  3CCL P;  2LPK A;  2K93 A;  4XRQ A;  5HGO A;  4IZ6 A;  5EW5 E;  3M1M A;  2LOL A;  2K0X A;  1OR5 A;  2WLV A;  3DS1 A;  4PXH B;  2ROQ A;  3CCM P;  2Y4Z A;  1EMV A;  1M9F C;  2ERH A;  2FQ0 A;  2MY5 A;  3Q20 A;  3EJE A;  1VQK P;  2LML A;  2MVV A;  2M8N A;  1Z6M A;  1EIA A;  3DTJ A;  5BS2 A;  1VQP P;  1D1D A;  1L6N A;  2JB0 A;  5F2O A;  1QVF O;  1K8A Q;  1M9C C;  2DGY A;  2PEQ A;  2MR8 A;  2KW2 A;  2X83 A;  1MZ8 A;  1VHN A;  2FVF A;  4CA3 A;  2VLP A;  1E0H A;  4GR6 A;  4PH1 A;  4E92 A;  2KGF A;  2KOD A;  2N98 A;  2EHS A;  2M8P A;  3NTE A;  2MVU A;  2L4B A;  2JU2 A;  1RO0 A;  2M5R A;  2M8L A;  4U0F A;  3CC4 P;  3GZM A;  5F2N A;  4H2Y C;  2XV6 A;  2DNW A;  3GJN A;  1F80 D;  4U0A A;  4WYM A;  1G03 A;  1AUM A;  2QA4 P;  3CXC O;  2GZE A;  4MRT C;  4BPF A;  2JGP A;  2XDE A;  2VSQ A;  4PH0 A;  2BUO A;  3CCS P;  4U0B A;  3DS5 A;  1T8K A;  2FVA A;  3CD6 P;  1K9M Q;  3B4Q A;  2N5H A;  4UHP B;  2GOL B;  2LIW A;  5EJD A;  2WLV B;  1A8O A;  4HTW A;  1GWP A;  2K92 A;  3E2D A;  3U43 A;  2GDX A;  3P05 A;  2LF4 A;  3G26 A;  3H0D A;  5DCK A;  1K73 Q;  3G28 A;  2PY8 A;  2N50 A;  1EM9 A;  2L9F A;  2PEM A;  3B5I A;  1DNY A;  2GZI A;  2Z45 A;  4BPG A;  5KP8 B;  2LL8 A;  3CMA P;  3G1G A;  1KD1 Q;  2PEI A;  2EIA A;  4E91 A;  1L0H A;  2E1M A;  3G4S P;  1M9X C;  1AK4 C;  2OAR A;  2EG5 A;  1HQB A;  1KQS O;  1VQL P;  1QRJ A;  2QNW A;  5HVC A;  4PH3 A;  2KWL A;  1RO2 A;  2VLQ A;  1IMP A;  4U0C A;  2AFD A;  3G0V A;  1VQO P;  3I56 P;  1W2B O;  2XZ1 C;  5HGN A;  1ACP A;  2XGY A;  1YJN P;  4PWV B;  3G21 A;  1NJI Q;  2L22 A;  1M9D C;  2XGU A;  2PEK A;  3DPH A;  2X2B A;  1VQM P;  2GDW A;  3CC2 P;  2ONT A;  3G71 P;  3MGE A;  2FAE A;  1RNI A;  2GZG A;  2GZF A;  2KGC A;  1KLP A;  2KG9 A;  1M1K Q;  2EHT A;  5CZD B;  4U0D A;  2KGE A;  2MF4 A;  4DG9 A;  2V4X A;  1VQ6 P;  5HGK A;  7CEI A;  2CGQ A;  3G1I A;  3CCJ P;  2BHV A;  1VQ5 P;  3LMO A;  1YJ9 P;  2JAZ A;  1GXG A;  1ZMB A;  1BAJ A;  1VQ9 P;  2FAD A;  1GPJ A;  1E6J P;  2K5X A;  5JPA A;  3CCQ P;  2KR5 A;  2GON A;  2XGV A;  1FR2 A;  2JQ4 A;  5KP6 B;  3I55 P;  1Q7Y Q;  4QKO A;  1BXI A;  3CME P;  4NX4 C;  5HGM A;  2L0Q A;  2XT1 A;  3DS4 A;  2AVA A;  2FQ1 A;  2K0D X;  1AF8 A;  1IMQ A;  1UNK A;  3GZL A;  4DGE C;  2GZJ A;  1K30 A;  2JYL A;  2L6E A;  4B4N A;  3VRL C;  3BP9 A;  2GDY A;  2KGD A;  1Q86 Q;  2EFJ A;  4M0I A;  2JYG A;  1M9E C;  2CG5 B;  2KOS A;  1AFV A;  2KOR A;  1M74 A;  1GXH A;  4PH2 A;  1UJZ A;  2N6Z A;  2KOQ A;  1EOQ A;  2LTE A;  2FQ2 A;  4XFZ A;  1VQN P;  3H47 A;  1NQ4 A;  2OTJ P;  3OW2 O;  1M6N A;  2KG8 A;  4F37 A;  2KGA A;  3HZQ A;  4XFX A;  4XFY A;  5HV8 A;  5F2K A;  3DS3 A;  1ZNV A;  1AYI A;  2QEX P;  3DS0 A;  4H2W C;  1M90 Q;  2PXR C;  2OTL P;  2MR7 A;  2K0Y A;  3WBH A;  1VQ7 P;  1YIT P;  2PEJ A;  1P7N A;  1JJ2 O;  3CCE P;  2K94 A;  2FHS C;  1VKU A;  1CEI A;  2CNR A;  2XZ0 D;  3RG6 C;  5BS1 A;  3LRY A;  4U0E A;  2PEO A;  1YIJ P;  3G29 A;  3RG2 A;  2Z46 A;  3GKL C;  1Q81 Q;  1U7K A;  2JO0 A;  1IUQ A;  2KOO A;  1L0I A;  2JBG A;  1N8R Q;  4R0M A;  2N5I A;  2LKI A;  2XXM A;  4DGA C;  2PEN A;  4QNB A;  2LIU A;  1A43 A;  2PWM A;  2X82 A;  2K2Q A;  2VLO A;  3CCR P;  1M9Y C;  2FVE A;  1VQ8 P;  2AFE A;  1VQ4 P;  3H4E A;  2JPR A;  2P9X A;  1S72 P;  2KG6 A;  3G6E P;  1YJW P;  2JU1 A;  3EJD A;  1HY8 A;  3NY7 B;  3CCV P;  4LQW C;  3CPW O;  1Q82 Q;  1QVG O;  3CCU P;  2Z44 A;  4COP A;  4INB A;  4XRO A;  2FAC A;  5KP7 B;  4HKG A;  1YHQ P;  4H2X C;  4COC A;  5HGL A;  1DV5 A;  2GYK A;  3HYB A;  2PWO A;  4J93 A;  2VLN A; 
#chains in the Genus database with same CATH homology
 4U0A A;  4WYM A;  1G03 A;  1AUM A;  2QA4 P;  3CXC O;  2QEX P;  1M1K Q;  3DS0 A;  4U0D A;  2XDE A;  1KC8 Q;  2V4X A;  2PXR C;  3DS2 A;  4PH0 A;  1M90 Q;  2OTL P;  2BUO A;  2X2D D;  3CCS P;  4U0B A;  3WBH A;  3DS5 A;  1YI2 P;  1VQ7 P;  1VQ6 P;  5HGK A;  3CC7 P;  1M6E X;  3G1I A;  3CCJ P;  2BHV A;  4GR2 A;  1YIT P;  1VQ5 P;  2CWO A;  2PEJ A;  5I4T G;  1P7N A;  1JJ2 O;  4IPY A;  3CCE P;  3CD6 P;  1K9M Q;  3CCL P;  1YJ9 P;  4XRQ A;  2GOL B;  5HGO A;  3M1M A;  1ZMB A;  1BAJ A;  3RG6 C;  1VQ9 P;  2WLV B;  1A8O A;  5BS1 A;  2WLV A;  3DS1 A;  4HTW A;  3LRY A;  1GWP A;  3CCM P;  2Y4Z A;  3E2D A;  1M9F C;  4U0E A;  1E6J P;  3P05 A;  2LF4 A;  3G26 A;  2PEO A;  3H0D A;  3Q20 A;  1YIJ P;  5JPA A;  5DCK A;  1K73 Q;  3G28 A;  3G29 A;  3CCQ P;  1VQK P;  2PY8 A;  2Z46 A;  2M8N A;  1EM9 A;  2PEM A;  1EIA A;  3DTJ A;  3B5I A;  1Q81 Q;  2GON A;  1U7K A;  2XGV A;  2JO0 A;  1IUQ A;  2Z45 A;  5BS2 A;  1VQP P;  1N8R Q;  3I55 P;  1Q7Y Q;  1D1D A;  3CMA P;  3CME P;  1L6N A;  2XXM A;  3G1G A;  4NX4 C;  5HGM A;  5F2O A;  4DGA C;  2PEN A;  2XT1 A;  1KD1 Q;  2PEI A;  4QNB A;  3DS4 A;  1QVF O;  2EIA A;  4E91 A;  1A43 A;  2PWM A;  2X82 A;  2E1M A;  3CCR P;  1M9Y C;  3G4S P;  1K8A Q;  1M9C C;  1M9X C;  1AK4 C;  2DGY A;  2OAR A;  2PEQ A;  4DGE C;  1VQ8 P;  2EG5 A;  2X83 A;  1VQ4 P;  1K30 A;  2JYL A;  3H4E A;  1KQS O;  2JPR A;  2L6E A;  4B4N A;  2P9X A;  3VRL C;  3BP9 A;  1VQL P;  1QRJ A;  1S72 P;  1Q86 Q;  4PH3 A;  2EFJ A;  4M0I A;  2JYG A;  1RO2 A;  1M9E C;  4GR6 A;  3G6E P;  1YJW P;  4U0C A;  4PH1 A;  4E92 A;  3G0V A;  1VQO P;  2KGF A;  3I56 P;  2KOD A;  1W2B O;  3CCV P;  2M8P A;  4LQW C;  5HGN A;  3CPW O;  1Q82 Q;  1QVG O;  3NTE A;  2XGY A;  3CCU P;  1YJN P;  2Z44 A;  1AFV A;  4INB A;  3G21 A;  4COP A;  1NJI Q;  1RO0 A;  4XRO A;  1M74 A;  4PH2 A;  1M9D C;  1EOQ A;  2XGU A;  2M8L A;  2PEK A;  4U0F A;  3DPH A;  3CC4 P;  4XFZ A;  1VQN P;  3H47 A;  1VQM P;  2OTJ P;  1YHQ P;  5F2N A;  3OW2 O;  3CC2 P;  1M6N A;  4COC A;  2ONT A;  3G71 P;  3MGE A;  3HZQ A;  1RNI A;  5HGL A;  4XFX A;  4XFY A;  2XV6 A;  5F2K A;  3DS3 A;  3HYB A;  2PWO A;  4J93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...