1D1DA

Nmr solution structure of the capsid protein from rous sarcoma virus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
220
structure length
220
Chain Sequence
b'WTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLDRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADITQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRAAPSTLTTPGEIIKYVLDRQKIAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CAPSID PROTEIN)
publication title Solution structure and dynamics of the Rous sarcoma virus capsid protein and comparison with capsid proteins of other retroviruses.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 58
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1999-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1d1dA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1d1dA02
2L6EA 4COCA 1AFVA 3G1GA 1AUMA 4U0EA 3BP9A 2KGFA 2BUOA 3H4EA 2LF4A 5JPAA 2GONA 3VRLC 4U0CA 3G28A 4PH3A 1GWPA 4HTWA 5HGMA 4M0IA 1QRJA 2WLVB 4IPYA 4XFXA 1M9EC 2ONTA 1P7NA 5DCKA 2Y4ZA 2PWMA 2KODA 2M8LA 4PH0A 2XT1A 2GOLB 2V4XA 3H47A 1G03A 1E6JP 3G26A 1AK4C 4U0AA 4WYMA 4XRQA 2EIAA 2JYLA 4QNBA 4U0FA 4DGAC 2X82A 3DS5A 1U7KA 3G21A 3DS3A 4B4NA 4LQWC 4U0DA 3DPHA 5HGNA 1EIAA 3P05A 3MGEA 3DS2A 3G1IA 4PH1A 1EM9A 3G29A 1D1DA 2XGUA 4PH2A 2XV6A 3LRYA 2XGVA 2PWOA 5HGKA 1L6NA 4XROA 1M9YC 1M9CC 4J93A 1A8OA 3DS0A 2XGYA 3DS4A 1BAJA 4COPA 1M9XC 3DTJA 1EOQA 4E92A 3DS1A 1M9DC 4INBA 2X83A 3NTEA 4DGEC 4XFYA 1M9FC 2M8PA 2JYGA 2WLVA 4XFZA 5HGLA 4NX4C 2XDEA 2X2DD 2PXRC 4U0BA 2JO0A 5HGOA 2XXMA 3G0VA 5I4TG 2M8NA 4E91A 2JPRA 1A43A
chains in the Genus database with same CATH superfamily
1VQPP 2BHVA 4COCA 3G1GA 2KW2A 3CCRP 2MD9A 2NO8A 3E2DA 5JPAA 3G28A 1KQSO 4H2WC 2Z46A 5HGMA 2LL8A 2N5IA 3CPWO 4XFXA 2GZEA 2KGEA 1T8KA 1Z6MA 4GR2A 2V4XA 1KD1Q 3CCEP 1G03A 2AFDA 1E6JP 4PWVB 3CD6P 3I56P 2K93A 1K9MQ 4DGAC 4CA3A 1U7KA 3DPHA 1EIAA 2MY5A 2X2BA 1Q86Q 1YIJP 2KGAA 2LKIA 3G1IA 5BS2A 2N6YA 2FQ0A 2VLQA 1X3OA 1VQKP 2CNRA 3G71P 3U43A 1M90Q 2N6ZA 3NY7B 1HQBA 2XGVA 4GR6A 4J93A 2JGPA 5KP6B 4UHPB 2XGYA 3DS4A 4DG9A 1QVGO 2GDWA 3DTJA 1GXHA 2GDYA 1IUQA 2X83A 3NTEA 4XFYA 1M9FC 2JYGA 2QA4P 3GJNA 3EJBA 1GPJA 2X2DD 2PXRC 2JO0A 2XXMA 3G0VA 2LMLA 2MR7A 1A43A 2P9XA 1RO2A 2GZFA 2EG5A 1FR2A 4BPHA 1UJZA 2XZ0D 2EHTA 3OW2O 4H2YC 4HTWA 1QRJA 1M9EC 2K94A 1S72P 2K0XA 2Y4ZA 7CEIA 4PH0A 2PEOA 3G4SP 4QKOA 4NEOA 2XT1A 1L0HA 3G26A 2DGYA 4U0AA 1K30A 1AF8A 3G6EP 3G21A 2DNWA 3CC2P 2KOQA 1KLPA 3P05A 3WBHA 3DS2A 3HZQA 3G29A 2JU2A 2LPKA 2KR5A 1VQ7P 4HKGA 2XV6A 2PEJA 4BPGA 5F2OA 2PWOA 5HGKA 3M1MA 3CCSP 1VQ5P 1M9CC 3CCJP 3DS0A 2GZIA 2K2QA 1BAJA 1EOQA 5F2KA 2KGCA 1HY8A 2FQ1A 2JBGA 4DGEC 2ERHA 4XFZA 5HGLA 4NX4C 2GZGA 2PEKA 1VQ6P 5HGOA 5CZDB 2M8NA 4E91A 1QVFO 1YI2P 2L6EA 1Q81Q 2GDXA 3I55P 2K5XA 2KGFA 3B5IA 1OR5A 3CMEP 2BUOA 5KP7B 1ACPA 3B4QA 3H4EA 2LF4A 2XZ1C 2GONA 2L22A 3Q20A 4IZ6A 1IMQA 1KC8Q 2MR8A 1GWPA 1YJNP 2OTLP 1L0IA 2ONTA 1P7NA 5DCKA 1DV5A 1E0HA 2GOLB 2CQ8A 1VQMP 1NJIQ 2JQ4A 1YJ9P 3EJEA 1VQOP 3H47A 1M74A 1VQ9P 2PY8A 1Q82Q 3CCMP 4WYMA 2K92A 1W2BO 4QNBA 4U0FA 2VLNA 2X82A 3DS3A 4B4NA 4U0DA 2N98A 2Z45A 2N5HA 2LTEA 3MGEA 1YJWP 1BXIA 1IMPA 3HYBA 1F80D 2LIWA 2CGQA 1M1KQ 5HV8A 1VQ8P 3LRYA 5KP8B 5BS1A 1YITP 1N8RQ 1L6NA 4XROA 3GZLA 2QNWA 2FAEA 1K8AQ 2JU1A 1MZ8A 3CCVP 2Z44A 2GYKA 4MRTC 1M9DC 2EFJA 3CC4P 1VHNA 2M8PA 4F37A 1UNKA 2FVFA 2L4BA 2MF4A 4R0MA 2FHSC 5I4TG 1VQ4P 2CG5B 2KOSA 2CWOA 2PEIA 3CXCO 1AFVA 3CC7P 2FVAA 1AUMA 2MVUA 4U0EA 3BP9A 4H2XC 1NQ4A 2AFEA 1YHQP 2KG6A 1JJ2O 2JB0A 2GZJA 3VRLC 4U0CA 2AF8A 1RO0A 2KG9A 2L9FA 2LIUA 1VKUA 4PH3A 2FVEA 2JAZA 4M0IA 2KGDA 2WLVB 4IPYA 2L0QA 2FACA 2PWMA 2KODA 2M8LA 1AYIA 4BPFA 2PEQA 2K0YA 2ROQA 1AK4C 4XRQA 1CEIA 2EIAA 2EHSA 2N50A 2OARA 2JYLA 2FQ2A 1Q7YQ 3RG6C 3DS5A 3CCUP 2KG8A 2QEXP 4LQWC 1DNYA 2PEMA 2M5RA 5HGNA 1VQLP 2WPTA 3GZMA 3CMAP 4PH1A 1ZNVA 1EM9A 1D1DA 2VSQA 5HVCA 2XGUA 4PH2A 2KOPA 2PNGA 2VLOA 5EJDA 3CCLP 1M9YC 2MVVA 1A8OA 2E1MA 1VQNP 4COPA 2K0DX 1M9XC 2FADA 3CCQP 4E92A 3DS1A 4INBA 2KWLA 1GXGA 1RNIA 2AVAA 5EW5E 1ZMBA 5F2NA 2LOLA 3LMOA 2WLVA 2KORA 1M6NA 2PENA 3GKLC 2XDEA 3CE7A 3RG2A 3EJDA 4U0BA 4PXHB 3H0DA 1EMVA 2VLPA 1K73Q 2JPRA 1M6EX 2KOOA 2OTJP
chains in the Genus database with same CATH topology
1VQPP 2CWOA 2BHVA 2L6EA 2PEIA 2P9XA 4COCA 3I55P 3CXCO 1AFVA 1RO2A 3G1GA 3CC7P 1AUMA 4U0EA 3BP9A 2EG5A 2KGFA 3B5IA 3CMEP 1YHQP 2BUOA 3CCRP 3H4EA 2LF4A 3E2DA 1JJ2O 5JPAA 3OW2O 2GONA 3VRLC 3Q20A 4U0CA 1RO0A 3G28A 1KC8Q 1KQSO 4PH3A 1GWPA 4HTWA 5HGMA 2Z46A 1YJNP 4M0IA 1QRJA 3CPWO 2WLVB 4IPYA 4XFXA 2OTLP 1M9EC 2ONTA 1S72P 1P7NA 5DCKA 2Y4ZA 2PWMA 2KODA 2M8LA 4PH0A 2PEOA 3G4SP 2XT1A 4GR2A 2GOLB 2V4XA 1VQMP 1NJIQ 2PEQA 1YJ9P 1KD1Q 1VQ9P 1VQOP 3H47A 1M74A 3CCEP 1Q81Q 1G03A 1E6JP 2PY8A 3G26A 1Q82Q 1AK4C 4U0AA 2DGYA 1K30A 3CCMP 3CD6P 4WYMA 4XRQA 2EIAA 3I56P 1W2BO 2OARA 2JYLA 4QNBA 1Q7YQ 1K9MQ 4U0FA 4DGAC 2X82A 3DS5A 3RG6C 3G6EP 3CCUP 1U7KA 3G21A 2QEXP 3DS3A 3CC2P 4B4NA 4LQWC 4U0DA 2PEMA 3DPHA 5HGNA 1EIAA 3P05A 2Z45A 1VQLP 3WBHA 3MGEA 3DS2A 3CMAP 1YJWP 1Q86Q 1YIJP 5BS2A 3G1IA 3HYBA 3HZQA 4PH1A 1EM9A 3G29A 1D1DA 2XGUA 1VQ7P 1VQKP 1M1KQ 4PH2A 3G71P 1M90Q 2XV6A 1YI2P 3LRYA 1VQ8P 5BS1A 2PEJA 3CCLP 5F2OA 1YITP 1N8RQ 2XGVA 2PWOA 4GR6A 5HGKA 1L6NA 3M1MA 4XROA 1M9YC 1M9CC 3CCJP 3CCSP 4J93A 1VQ5P 1A8OA 2E1MA 3DS0A 1VQNP 2XGYA 3DS4A 1BAJA 4COPA 1K8AQ 1M9XC 1QVGO 3CCVP 3DTJA 3CCQP 1EOQA 2Z44A 5F2KA 4E92A 3DS1A 1M9DC 4INBA 1RNIA 2EFJA 1IUQA 1ZMBA 2X83A 5F2NA 3NTEA 4DGEC 3CC4P 4XFYA 1M9FC 2M8PA 2JYGA 2WLVA 4XFZA 5HGLA 4NX4C 2QA4P 1M6NA 2PENA 2XDEA 2PEKA 2X2DD 2PXRC 4U0BA 3H0DA 2JO0A 1VQ6P 5HGOA 2XXMA 3G0VA 5I4TG 2M8NA 4E91A 1K73Q 2JPRA 1M6EX 1VQ4P 1QVFO 2OTJP 1A43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L6E A;  4COC A;  1AFV A;  3G1G A;  1AUM A;  4U0E A;  3BP9 A;  2KGF A;  2BUO A;  3H4E A;  2LF4 A;  5JPA A;  2GON A;  3VRL C;  4U0C A;  3G28 A;  4PH3 A;  1GWP A;  4HTW A;  5HGM A;  4M0I A;  1QRJ A;  2WLV B;  4IPY A;  4XFX A;  1M9E C;  2ONT A;  1P7N A;  5DCK A;  2Y4Z A;  2PWM A;  2KOD A;  2M8L A;  4PH0 A;  2XT1 A;  2GOL B;  2V4X A;  3H47 A;  1G03 A;  1E6J P;  3G26 A;  1AK4 C;  4U0A A;  4WYM A;  4XRQ A;  2EIA A;  2JYL A;  4QNB A;  4U0F A;  4DGA C;  2X82 A;  3DS5 A;  1U7K A;  3G21 A;  3DS3 A;  4B4N A;  4LQW C;  4U0D A;  3DPH A;  5HGN A;  1EIA A;  3P05 A;  3MGE A;  3DS2 A;  3G1I A;  4PH1 A;  1EM9 A;  3G29 A;  1D1D A;  2XGU A;  4PH2 A;  2XV6 A;  3LRY A;  2XGV A;  2PWO A;  5HGK A;  1L6N A;  4XRO A;  1M9Y C;  1M9C C;  4J93 A;  1A8O A;  3DS0 A;  2XGY A;  3DS4 A;  1BAJ A;  4COP A;  1M9X C;  3DTJ A;  1EOQ A;  4E92 A;  3DS1 A;  1M9D C;  4INB A;  2X83 A;  3NTE A;  4DGE C;  4XFY A;  1M9F C;  2M8P A;  2JYG A;  2WLV A;  4XFZ A;  5HGL A;  4NX4 C;  2XDE A;  2X2D D;  2PXR C;  4U0B A;  2JO0 A;  5HGO A;  2XXM A;  3G0V A;  5I4T G;  2M8N A;  4E91 A;  2JPR A;  1A43 A; 
#chains in the Genus database with same CATH topology
 1VQP P;  2BHV A;  4COC A;  3G1G A;  2KW2 A;  3CCR P;  2MD9 A;  2NO8 A;  3E2D A;  5JPA A;  3G28 A;  1KQS O;  4H2W C;  2Z46 A;  5HGM A;  2LL8 A;  2N5I A;  3CPW O;  4XFX A;  2GZE A;  2KGE A;  1T8K A;  1Z6M A;  4GR2 A;  2V4X A;  1KD1 Q;  3CCE P;  1G03 A;  2AFD A;  1E6J P;  4PWV B;  3CD6 P;  3I56 P;  2K93 A;  1K9M Q;  4DGA C;  4CA3 A;  1U7K A;  3DPH A;  1EIA A;  2MY5 A;  2X2B A;  1Q86 Q;  1YIJ P;  2KGA A;  2LKI A;  3G1I A;  5BS2 A;  2N6Y A;  2FQ0 A;  2VLQ A;  1X3O A;  1VQK P;  2CNR A;  3G71 P;  3U43 A;  1M90 Q;  2N6Z A;  3NY7 B;  1HQB A;  2XGV A;  4GR6 A;  4J93 A;  2JGP A;  5KP6 B;  4UHP B;  2XGY A;  3DS4 A;  4DG9 A;  1QVG O;  2GDW A;  3DTJ A;  1GXH A;  2GDY A;  1IUQ A;  2X83 A;  3NTE A;  4XFY A;  1M9F C;  2JYG A;  2QA4 P;  3GJN A;  3EJB A;  1GPJ A;  2X2D D;  2PXR C;  2JO0 A;  2XXM A;  3G0V A;  2LML A;  2MR7 A;  1A43 A;  2P9X A;  1RO2 A;  2GZF A;  2EG5 A;  1FR2 A;  4BPH A;  1UJZ A;  2XZ0 D;  2EHT A;  3OW2 O;  4H2Y C;  4HTW A;  1QRJ A;  1M9E C;  2K94 A;  1S72 P;  2K0X A;  2Y4Z A;  7CEI A;  4PH0 A;  2PEO A;  3G4S P;  4QKO A;  4NEO A;  2XT1 A;  1L0H A;  3G26 A;  2DGY A;  4U0A A;  1K30 A;  1AF8 A;  3G6E P;  3G21 A;  2DNW A;  3CC2 P;  2KOQ A;  1KLP A;  3P05 A;  3WBH A;  3DS2 A;  3HZQ A;  3G29 A;  2JU2 A;  2LPK A;  2KR5 A;  1VQ7 P;  4HKG A;  2XV6 A;  2PEJ A;  4BPG A;  5F2O A;  2PWO A;  5HGK A;  3M1M A;  3CCS P;  1VQ5 P;  1M9C C;  3CCJ P;  3DS0 A;  2GZI A;  2K2Q A;  1BAJ A;  1EOQ A;  5F2K A;  2KGC A;  1HY8 A;  2FQ1 A;  2JBG A;  4DGE C;  2ERH A;  4XFZ A;  5HGL A;  4NX4 C;  2GZG A;  2PEK A;  1VQ6 P;  5HGO A;  5CZD B;  2M8N A;  4E91 A;  1QVF O;  1YI2 P;  2L6E A;  1Q81 Q;  2GDX A;  3I55 P;  2K5X A;  2KGF A;  3B5I A;  1OR5 A;  3CME P;  2BUO A;  5KP7 B;  1ACP A;  3B4Q A;  3H4E A;  2LF4 A;  2XZ1 C;  2GON A;  2L22 A;  3Q20 A;  4IZ6 A;  1IMQ A;  1KC8 Q;  2MR8 A;  1GWP A;  1YJN P;  2OTL P;  1L0I A;  2ONT A;  1P7N A;  5DCK A;  1DV5 A;  1E0H A;  2GOL B;  2CQ8 A;  1VQM P;  1NJI Q;  2JQ4 A;  1YJ9 P;  3EJE A;  1VQO P;  3H47 A;  1M74 A;  1VQ9 P;  2PY8 A;  1Q82 Q;  3CCM P;  4WYM A;  2K92 A;  1W2B O;  4QNB A;  4U0F A;  2VLN A;  2X82 A;  3DS3 A;  4B4N A;  4U0D A;  2N98 A;  2Z45 A;  2N5H A;  2LTE A;  3MGE A;  1YJW P;  1BXI A;  1IMP A;  3HYB A;  1F80 D;  2LIW A;  2CGQ A;  1M1K Q;  5HV8 A;  1VQ8 P;  3LRY A;  5KP8 B;  5BS1 A;  1YIT P;  1N8R Q;  1L6N A;  4XRO A;  3GZL A;  2QNW A;  2FAE A;  1K8A Q;  2JU1 A;  1MZ8 A;  3CCV P;  2Z44 A;  2GYK A;  4MRT C;  1M9D C;  2EFJ A;  3CC4 P;  1VHN A;  2M8P A;  4F37 A;  1UNK A;  2FVF A;  2L4B A;  2MF4 A;  4R0M A;  2FHS C;  5I4T G;  1VQ4 P;  2CG5 B;  2KOS A;  2CWO A;  2PEI A;  3CXC O;  1AFV A;  3CC7 P;  2FVA A;  1AUM A;  2MVU A;  4U0E A;  3BP9 A;  4H2X C;  1NQ4 A;  2AFE A;  1YHQ P;  2KG6 A;  1JJ2 O;  2JB0 A;  2GZJ A;  3VRL C;  4U0C A;  2AF8 A;  1RO0 A;  2KG9 A;  2L9F A;  2LIU A;  1VKU A;  4PH3 A;  2FVE A;  2JAZ A;  4M0I A;  2KGD A;  2WLV B;  4IPY A;  2L0Q A;  2FAC A;  2PWM A;  2KOD A;  2M8L A;  1AYI A;  4BPF A;  2PEQ A;  2K0Y A;  2ROQ A;  1AK4 C;  4XRQ A;  1CEI A;  2EIA A;  2EHS A;  2N50 A;  2OAR A;  2JYL A;  2FQ2 A;  1Q7Y Q;  3RG6 C;  3DS5 A;  3CCU P;  2KG8 A;  2QEX P;  4LQW C;  1DNY A;  2PEM A;  2M5R A;  5HGN A;  1VQL P;  2WPT A;  3GZM A;  3CMA P;  4PH1 A;  1ZNV A;  1EM9 A;  1D1D A;  2VSQ A;  5HVC A;  2XGU A;  4PH2 A;  2KOP A;  2PNG A;  2VLO A;  5EJD A;  3CCL P;  1M9Y C;  2MVV A;  1A8O A;  2E1M A;  1VQN P;  4COP A;  2K0D X;  1M9X C;  2FAD A;  3CCQ P;  4E92 A;  3DS1 A;  4INB A;  2KWL A;  1GXG A;  1RNI A;  2AVA A;  5EW5 E;  1ZMB A;  5F2N A;  2LOL A;  3LMO A;  2WLV A;  2KOR A;  1M6N A;  2PEN A;  3GKL C;  2XDE A;  3CE7 A;  3RG2 A;  3EJD A;  4U0B A;  4PXH B;  3H0D A;  1EMV A;  2VLP A;  1K73 Q;  2JPR A;  1M6E X;  2KOO A;  2OTJ P; 
#chains in the Genus database with same CATH homology
 1VQP P;  2CWO A;  2BHV A;  2L6E A;  2PEI A;  2P9X A;  4COC A;  3I55 P;  3CXC O;  1AFV A;  1RO2 A;  3G1G A;  3CC7 P;  1AUM A;  4U0E A;  3BP9 A;  2EG5 A;  2KGF A;  3B5I A;  3CME P;  1YHQ P;  2BUO A;  3CCR P;  3H4E A;  2LF4 A;  3E2D A;  1JJ2 O;  5JPA A;  3OW2 O;  2GON A;  3VRL C;  3Q20 A;  4U0C A;  1RO0 A;  3G28 A;  1KC8 Q;  1KQS O;  4PH3 A;  1GWP A;  4HTW A;  5HGM A;  2Z46 A;  1YJN P;  4M0I A;  1QRJ A;  3CPW O;  2WLV B;  4IPY A;  4XFX A;  2OTL P;  1M9E C;  2ONT A;  1S72 P;  1P7N A;  5DCK A;  2Y4Z A;  2PWM A;  2KOD A;  2M8L A;  4PH0 A;  2PEO A;  3G4S P;  2XT1 A;  4GR2 A;  2GOL B;  2V4X A;  1VQM P;  1NJI Q;  2PEQ A;  1YJ9 P;  1KD1 Q;  1VQ9 P;  1VQO P;  3H47 A;  1M74 A;  3CCE P;  1Q81 Q;  1G03 A;  1E6J P;  2PY8 A;  3G26 A;  1Q82 Q;  1AK4 C;  4U0A A;  2DGY A;  1K30 A;  3CCM P;  3CD6 P;  4WYM A;  4XRQ A;  2EIA A;  3I56 P;  1W2B O;  2OAR A;  2JYL A;  4QNB A;  1Q7Y Q;  1K9M Q;  4U0F A;  4DGA C;  2X82 A;  3DS5 A;  3RG6 C;  3G6E P;  3CCU P;  1U7K A;  3G21 A;  2QEX P;  3DS3 A;  3CC2 P;  4B4N A;  4LQW C;  4U0D A;  2PEM A;  3DPH A;  5HGN A;  1EIA A;  3P05 A;  2Z45 A;  1VQL P;  3WBH A;  3MGE A;  3DS2 A;  3CMA P;  1YJW P;  1Q86 Q;  1YIJ P;  5BS2 A;  3G1I A;  3HYB A;  3HZQ A;  4PH1 A;  1EM9 A;  3G29 A;  1D1D A;  2XGU A;  1VQ7 P;  1VQK P;  1M1K Q;  4PH2 A;  3G71 P;  1M90 Q;  2XV6 A;  1YI2 P;  3LRY A;  1VQ8 P;  5BS1 A;  2PEJ A;  3CCL P;  5F2O A;  1YIT P;  1N8R Q;  2XGV A;  2PWO A;  4GR6 A;  5HGK A;  1L6N A;  3M1M A;  4XRO A;  1M9Y C;  1M9C C;  3CCJ P;  3CCS P;  4J93 A;  1VQ5 P;  1A8O A;  2E1M A;  3DS0 A;  1VQN P;  2XGY A;  3DS4 A;  1BAJ A;  4COP A;  1K8A Q;  1M9X C;  1QVG O;  3CCV P;  3DTJ A;  3CCQ P;  1EOQ A;  2Z44 A;  5F2K A;  4E92 A;  3DS1 A;  1M9D C;  4INB A;  1RNI A;  2EFJ A;  1IUQ A;  1ZMB A;  2X83 A;  5F2N A;  3NTE A;  4DGE C;  3CC4 P;  4XFY A;  1M9F C;  2M8P A;  2JYG A;  2WLV A;  4XFZ A;  5HGL A;  4NX4 C;  2QA4 P;  1M6N A;  2PEN A;  2XDE A;  2PEK A;  2X2D D;  2PXR C;  4U0B A;  3H0D A;  2JO0 A;  1VQ6 P;  5HGO A;  2XXM A;  3G0V A;  5I4T G;  2M8N A;  4E91 A;  1K73 Q;  2JPR A;  1M6E X;  1VQ4 P;  1QVF O;  2OTJ P;  1A43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...