1D1DA

Nmr solution structure of the capsid protein from rous sarcoma virus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
220
structure length
220
Chain Sequence
WTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLDRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADITQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRAAPSTLTTPGEIIKYVLDRQKIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the Rous sarcoma virus capsid protein and comparison with capsid proteins of other retroviruses.
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords PROTEIN (CAPSID PROTEIN)
total genus 58
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1999-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1d1dA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1d1dA02
1EOQA 3G21A 2JYLA 1D1DA 1M9YC 1EM9A 1M9EC 4XRQA 2X83A 5HGMA 2GONA 3G1IA 2L6EA 3MGEA 4M0IA 2JYGA 1AK4C 1P7NA 2XGYA 5HGOA 1QRJA 2JPRA 4COPA 3G26A 1M9DC 3DS1A 4B4NA 2KGFA 2V4XA 4IPYA 4U0EA 1M9CC 5HGLA 1BAJA 2PWMA 3VRLC 2JO0A 4PH1A 3LRYA 1AUMA 2KODA 2X82A 2PWOA 4U0AA 1M9XC 2PXRC 2XXMA 3DS4A 4QNBA 5DCKA 1EIAA 2Y4ZA 4COCA 2WLVB 4DGAC 1A8OA 4U0DA 4PH2A 2M8PA 3P05A 3DS5A 3G29A 5JPAA 2EIAA 4INBA 5I4TG 4U0BA 4NX4C 2XGUA 2XGVA 4PH0A 1G03A 4E92A 3NTEA 2ONTA 4U0FA 4XFYA 3DS3A 2WLVA 3DS2A 3DS0A 2M8NA 4XFXA 4U0CA 4WYMA 4XFZA 3DPHA 1AFVA 1M9FC 4E91A 3G0VA 3G28A 2GOLB 3DTJA 4DGEC 4PH3A 1U7KA 3G1GA 4XROA 3H4EA 2XT1A 2M8LA 1L6NA 2XDEA 2BUOA 4LQWC 1A43A 4HTWA 5HGNA 1GWPA 2XV6A 1E6JP 3BP9A 4J93A 2X2DD 2LF4A 5HGKA 3H47A
chains in the Genus database with same CATH superfamily
1ZNVA 2JYLA 1D1DA 1RO2A 1QVFO 2K93A 5HGMA 3E2DA 4M0IA 2JU1A 3CMAP 2BHVA 2CQ8A 2LMLA 3HYBA 1QRJA 1AF8A 3G26A 3GJNA 4F37A 2V4XA 4NEOA 3CCUP 4PWVB 1BAJA 1MZ8A 2PEJA 3VRLC 3CCLP 2X2BA 3RG6C 2OTJP 2FACA 2K0DX 1UJZA 2GZGA 4GR2A 4HKGA 2PEIA 3B5IA 1A8OA 1VKUA 2KWLA 3I55P 3G29A 3NY7B 2GDXA 5I4TG 2EIAA 2K94A 3GZLA 3OW2O 2N5IA 2XGVA 4BPHA 4U0FA 3DS3A 2K92A 4XFXA 3I56P 2OARA 5KP7B 2LIWA 2EG5A 2VSQA 2EFJA 2N6ZA 1X3OA 4UHPB 2GDWA 2MF4A 3G0VA 2GOLB 1U7KA 1RO0A 1KC8Q 3H4EA 2XT1A 2M8LA 2MD9A 3G6EP 1VQ5P 2BUOA 2FQ0A 3CCQP 2KOQA 2VLOA 1L0HA 2KG8A 2KORA 1UNKA 2Z46A 1ACPA 2N98A 1EM9A 3G4SP 1VQ9P 2LIUA 2X83A 1YIJP 2GONA 2L6EA 1OR5A 2PEKA 2CG5B 1VQ8P 2XGYA 2GDYA 2NO8A 2L0QA 2JPRA 4COPA 3CCEP 3DS1A 2JB0A 4IPYA 2JQ4A 2P9XA 2PEOA 2FVFA 2JAZA 1KD1Q 5HV8A 2MY5A 2E1MA 2GZIA 2Z44A 7CEIA 2KOSA 1VQ7P 2X82A 2PWOA 4U0AA 2AFDA 1HY8A 2AFEA 4DGAC 4PH2A 2M8PA 3EJEA 2XZ0D 2FVEA 4H2WC 2GYKA 2LOLA 1YI2P 5JPAA 1DNYA 3CCRP 2N5HA 2XGUA 5EW5E 4PH0A 4H2YC 1IMPA 3NTEA 2K0YA 2CGQA 2L22A 1VQ6P 2PNGA 2JGPA 4XFYA 4QKOA 3DS0A 2M8NA 1M74A 2PENA 2WPTA 2LPKA 4BPGA 2VLPA 2QA4P 4PXHB 4R0MA 1GPJA 1K30A 1M6NA 2MVVA 2MVUA 3G28A 2GZFA 1L6NA 2KGDA 3B4QA 2JU2A 2KGAA 3LMOA 1M6EX 1W2BO 3BP9A 5CZDB 2QEXP 5KP6B 1YJNP 3H47A 2MR8A 1HQBA 3G21A 4H2XC 4BPFA 2GZEA 5HVCA 1VQKP 2GZJA 1K8AQ 1M9EC 3HZQA 1VQNP 3WBHA 2KOPA 1CEIA 1K9MQ 2JYGA 4CA3A 3CC7P 1DV5A 3RG2A 5HGOA 1M9DC 4B4NA 1Q86Q 2PY8A 2KGFA 1Q82Q 4U0EA 3EJBA 2KOOA 2PEMA 1YJ9P 1M9CC 2ROQA 3U43A 5HGLA 2M5RA 1IMQA 4PH1A 1AUMA 2FVAA 1GXHA 3CPWO 4MRTC 5EJDA 3M1MA 2KW2A 2XXMA 4IZ6A 3DS4A 3GZMA 4COCA 2N6YA 2XZ1C 1VQPP 2L4BA 2K5XA 4U0DA 2QNWA 1VQLP 2Z45A 2ERHA 2MR7A 3P05A 1KLPA 2CWOA 3Q20A 1Q7YQ 1GXGA 1VQ4P 2ONTA 1VQOP 1IUQA 3CCVP 2WLVA 1YITP 1N8RQ 4U0CA 4WYMA 4XFZA 1F80D 2OTLP 2AF8A 1Z6MA 3CE7A 4DGEC 4DG9A 2PEQA 2XDEA 2KGEA 3G71P 2LL8A 3EJDA 3CMEP 4HTWA 5HGNA 1GWPA 2FQ1A 3CCMP 2KG6A 5F2NA 3LRYA 1EOQA 1JJ2O 2CNRA 1M9YC 1KQSO 4XRQA 3G1IA 3MGEA 2DGYA 1AK4C 1P7NA 1E0HA 1K73Q 3CC2P 2JBGA 4GR6A 2KG9A 2FAEA 1RNIA 2K0XA 1L0IA 1YJWP 2PWMA 2JO0A 1VQMP 5F2KA 2KODA 5BS1A 1NJIQ 1M9XC 2PXRC 3CC4P 3CCSP 4QNBA 2DNWA 5DCKA 1EIAA 2Y4ZA 1QVGO 2KGCA 1S72P 2N50A 2WLVB 2L9FA 2FHSC 1T8KA 2VLQA 1NQ4A 1VHNA 3CD6P 3DS5A 3CCJP 2EHTA 1M1KQ 1M90Q 4INBA 4U0BA 5BS2A 4NX4C 1ZMBA 3H0DA 5F2OA 1G03A 4E92A 3CXCO 1EMVA 1BXIA 1FR2A 3DS2A 2KR5A 1Q81Q 2FADA 2EHSA 3GKLC 2K2QA 3DPHA 1AFVA 1M9FC 4E91A 2AVAA 2LTEA 5KP8B 3DTJA 4PH3A 3G1GA 1AYIA 4XROA 1YHQP 2FQ2A 4LQWC 1A43A 2LKIA 2VLNA 2XV6A 1E6JP 4J93A 2X2DD 2LF4A 5HGKA
chains in the Genus database with same CATH topology
1EOQA 3G21A 2Z46A 1JJ2O 2JYLA 1D1DA 1VQKP 1M9YC 1EM9A 1K8AQ 3G4SP 1RO2A 1KQSO 1M9EC 1VQ9P 1QVFO 3HZQA 4XRQA 2X83A 1VQNP 3WBHA 1YIJP 5HGMA 2GONA 3E2DA 3G1IA 2L6EA 3MGEA 4M0IA 2QEXP 2JYGA 1K9MQ 2DGYA 1AK4C 1P7NA 2PEKA 3CC7P 1VQ8P 2XGYA 3CMAP 1K73Q 3CC2P 5HGOA 2BHVA 4GR6A 3HYBA 1QRJA 2JPRA 4COPA 3CCEP 3G26A 1M9DC 3DS1A 4B4NA 1Q86Q 2PY8A 2KGFA 2V4XA 4IPYA 1RNIA 1Q82Q 4U0EA 3CCUP 2P9XA 2PEMA 2PEOA 1M9CC 1YJ9P 1KD1Q 5HGLA 1BAJA 2PEJA 1YJWP 2PWMA 3VRLC 2E1MA 2JO0A 4PH1A 3CCLP 2Z44A 3LRYA 1AUMA 3RG6C 1VQMP 2OTJP 3CPWO 1VQ7P 5F2KA 2KODA 2X82A 2PWOA 5BS1A 1NJIQ 4U0AA 1M9XC 3M1MA 2PXRC 3CC4P 2XXMA 3DS4A 4QNBA 3CCSP 5DCKA 1EIAA 2Y4ZA 4COCA 1QVGO 4GR2A 2PEIA 1S72P 2WLVB 4DGAC 1VQPP 3B5IA 1A8OA 4U0DA 4PH2A 1VQLP 2Z45A 2M8PA 3P05A 3CD6P 3DS5A 3CCJP 1M1KQ 1M90Q 3I55P 3G29A 1YI2P 5JPAA 2EIAA 4INBA 2CWOA 3Q20A 5I4TG 3CCRP 1Q7YQ 4U0BA 5BS2A 4NX4C 3OW2O 2XGUA 1ZMBA 3H0DA 1VQ4P 5F2OA 2XGVA 4PH0A 1G03A 4E92A 3NTEA 2ONTA 3CXCO 1VQ6P 4U0FA 1VQOP 1IUQA 4XFYA 3DS3A 3CCVP 2WLVA 1YITP 3DS2A 3DS0A 1N8RQ 2M8NA 1M74A 2PENA 4XFXA 4U0CA 3I56P 4WYMA 2OARA 2QA4P 4XFZA 1Q81Q 2EG5A 2EFJA 2OTLP 1K30A 1M6NA 3DPHA 1AFVA 1M9FC 4E91A 3G0VA 3G28A 2GOLB 3DTJA 4DGEC 4PH3A 1U7KA 3G1GA 1RO0A 1KC8Q 4XROA 2PEQA 3H4EA 2XT1A 2M8LA 1YHQP 3G6EP 1L6NA 2XDEA 1VQ5P 3G71P 2BUOA 4LQWC 3CCQP 1A43A 3CMEP 4HTWA 1M6EX 5HGNA 1W2BO 1GWPA 2XV6A 1E6JP 3CCMP 3BP9A 4J93A 2X2DD 5F2NA 2LF4A 1YJNP 5HGKA 3H47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EOQ A;  3G21 A;  2JYL A;  1D1D A;  1M9Y C;  1EM9 A;  1M9E C;  4XRQ A;  2X83 A;  5HGM A;  2GON A;  3G1I A;  2L6E A;  3MGE A;  4M0I A;  2JYG A;  1AK4 C;  1P7N A;  2XGY A;  5HGO A;  1QRJ A;  2JPR A;  4COP A;  3G26 A;  1M9D C;  3DS1 A;  4B4N A;  2KGF A;  2V4X A;  4IPY A;  4U0E A;  1M9C C;  5HGL A;  1BAJ A;  2PWM A;  3VRL C;  2JO0 A;  4PH1 A;  3LRY A;  1AUM A;  2KOD A;  2X82 A;  2PWO A;  4U0A A;  1M9X C;  2PXR C;  2XXM A;  3DS4 A;  4QNB A;  5DCK A;  1EIA A;  2Y4Z A;  4COC A;  2WLV B;  4DGA C;  1A8O A;  4U0D A;  4PH2 A;  2M8P A;  3P05 A;  3DS5 A;  3G29 A;  5JPA A;  2EIA A;  4INB A;  5I4T G;  4U0B A;  4NX4 C;  2XGU A;  2XGV A;  4PH0 A;  1G03 A;  4E92 A;  3NTE A;  2ONT A;  4U0F A;  4XFY A;  3DS3 A;  2WLV A;  3DS2 A;  3DS0 A;  2M8N A;  4XFX A;  4U0C A;  4WYM A;  4XFZ A;  3DPH A;  1AFV A;  1M9F C;  4E91 A;  3G0V A;  3G28 A;  2GOL B;  3DTJ A;  4DGE C;  4PH3 A;  1U7K A;  3G1G A;  4XRO A;  3H4E A;  2XT1 A;  2M8L A;  1L6N A;  2XDE A;  2BUO A;  4LQW C;  1A43 A;  4HTW A;  5HGN A;  1GWP A;  2XV6 A;  1E6J P;  3BP9 A;  4J93 A;  2X2D D;  2LF4 A;  5HGK A;  3H47 A; 
#chains in the Genus database with same CATH topology
 1ZNV A;  2JYL A;  1D1D A;  1RO2 A;  1QVF O;  2K93 A;  5HGM A;  3E2D A;  4M0I A;  2JU1 A;  3CMA P;  2BHV A;  2CQ8 A;  2LML A;  3HYB A;  1QRJ A;  1AF8 A;  3G26 A;  3GJN A;  4F37 A;  2V4X A;  4NEO A;  3CCU P;  4PWV B;  1BAJ A;  1MZ8 A;  2PEJ A;  3VRL C;  3CCL P;  2X2B A;  3RG6 C;  2OTJ P;  2FAC A;  2K0D X;  1UJZ A;  2GZG A;  4GR2 A;  4HKG A;  2PEI A;  3B5I A;  1A8O A;  1VKU A;  2KWL A;  3I55 P;  3G29 A;  3NY7 B;  2GDX A;  5I4T G;  2EIA A;  2K94 A;  3GZL A;  3OW2 O;  2N5I A;  2XGV A;  4BPH A;  4U0F A;  3DS3 A;  2K92 A;  4XFX A;  3I56 P;  2OAR A;  5KP7 B;  2LIW A;  2EG5 A;  2VSQ A;  2EFJ A;  2N6Z A;  1X3O A;  4UHP B;  2GDW A;  2MF4 A;  3G0V A;  2GOL B;  1U7K A;  1RO0 A;  1KC8 Q;  3H4E A;  2XT1 A;  2M8L A;  2MD9 A;  3G6E P;  1VQ5 P;  2BUO A;  2FQ0 A;  3CCQ P;  2KOQ A;  2VLO A;  1L0H A;  2KG8 A;  2KOR A;  1UNK A;  2Z46 A;  1ACP A;  2N98 A;  1EM9 A;  3G4S P;  1VQ9 P;  2LIU A;  2X83 A;  1YIJ P;  2GON A;  2L6E A;  1OR5 A;  2PEK A;  2CG5 B;  1VQ8 P;  2XGY A;  2GDY A;  2NO8 A;  2L0Q A;  2JPR A;  4COP A;  3CCE P;  3DS1 A;  2JB0 A;  4IPY A;  2JQ4 A;  2P9X A;  2PEO A;  2FVF A;  2JAZ A;  1KD1 Q;  5HV8 A;  2MY5 A;  2E1M A;  2GZI A;  2Z44 A;  7CEI A;  2KOS A;  1VQ7 P;  2X82 A;  2PWO A;  4U0A A;  2AFD A;  1HY8 A;  2AFE A;  4DGA C;  4PH2 A;  2M8P A;  3EJE A;  2XZ0 D;  2FVE A;  4H2W C;  2GYK A;  2LOL A;  1YI2 P;  5JPA A;  1DNY A;  3CCR P;  2N5H A;  2XGU A;  5EW5 E;  4PH0 A;  4H2Y C;  1IMP A;  3NTE A;  2K0Y A;  2CGQ A;  2L22 A;  1VQ6 P;  2PNG A;  2JGP A;  4XFY A;  4QKO A;  3DS0 A;  2M8N A;  1M74 A;  2PEN A;  2WPT A;  2LPK A;  4BPG A;  2VLP A;  2QA4 P;  4PXH B;  4R0M A;  1GPJ A;  1K30 A;  1M6N A;  2MVV A;  2MVU A;  3G28 A;  2GZF A;  1L6N A;  2KGD A;  3B4Q A;  2JU2 A;  2KGA A;  3LMO A;  1M6E X;  1W2B O;  3BP9 A;  5CZD B;  2QEX P;  5KP6 B;  1YJN P;  3H47 A;  2MR8 A;  1HQB A;  3G21 A;  4H2X C;  4BPF A;  2GZE A;  5HVC A;  1VQK P;  2GZJ A;  1K8A Q;  1M9E C;  3HZQ A;  1VQN P;  3WBH A;  2KOP A;  1CEI A;  1K9M Q;  2JYG A;  4CA3 A;  3CC7 P;  1DV5 A;  3RG2 A;  5HGO A;  1M9D C;  4B4N A;  1Q86 Q;  2PY8 A;  2KGF A;  1Q82 Q;  4U0E A;  3EJB A;  2KOO A;  2PEM A;  1YJ9 P;  1M9C C;  2ROQ A;  3U43 A;  5HGL A;  2M5R A;  1IMQ A;  4PH1 A;  1AUM A;  2FVA A;  1GXH A;  3CPW O;  4MRT C;  5EJD A;  3M1M A;  2KW2 A;  2XXM A;  4IZ6 A;  3DS4 A;  3GZM A;  4COC A;  2N6Y A;  2XZ1 C;  1VQP P;  2L4B A;  2K5X A;  4U0D A;  2QNW A;  1VQL P;  2Z45 A;  2ERH A;  2MR7 A;  3P05 A;  1KLP A;  2CWO A;  3Q20 A;  1Q7Y Q;  1GXG A;  1VQ4 P;  2ONT A;  1VQO P;  1IUQ A;  3CCV P;  2WLV A;  1YIT P;  1N8R Q;  4U0C A;  4WYM A;  4XFZ A;  1F80 D;  2OTL P;  2AF8 A;  1Z6M A;  3CE7 A;  4DGE C;  4DG9 A;  2PEQ A;  2XDE A;  2KGE A;  3G71 P;  2LL8 A;  3EJD A;  3CME P;  4HTW A;  5HGN A;  1GWP A;  2FQ1 A;  3CCM P;  2KG6 A;  5F2N A;  3LRY A;  1EOQ A;  1JJ2 O;  2CNR A;  1M9Y C;  1KQS O;  4XRQ A;  3G1I A;  3MGE A;  2DGY A;  1AK4 C;  1P7N A;  1E0H A;  1K73 Q;  3CC2 P;  2JBG A;  4GR6 A;  2KG9 A;  2FAE A;  1RNI A;  2K0X A;  1L0I A;  1YJW P;  2PWM A;  2JO0 A;  1VQM P;  5F2K A;  2KOD A;  5BS1 A;  1NJI Q;  1M9X C;  2PXR C;  3CC4 P;  3CCS P;  4QNB A;  2DNW A;  5DCK A;  1EIA A;  2Y4Z A;  1QVG O;  2KGC A;  1S72 P;  2N50 A;  2WLV B;  2L9F A;  2FHS C;  1T8K A;  2VLQ A;  1NQ4 A;  1VHN A;  3CD6 P;  3DS5 A;  3CCJ P;  2EHT A;  1M1K Q;  1M90 Q;  4INB A;  4U0B A;  5BS2 A;  4NX4 C;  1ZMB A;  3H0D A;  5F2O A;  1G03 A;  4E92 A;  3CXC O;  1EMV A;  1BXI A;  1FR2 A;  3DS2 A;  2KR5 A;  1Q81 Q;  2FAD A;  2EHS A;  3GKL C;  2K2Q A;  3DPH A;  1AFV A;  1M9F C;  4E91 A;  2AVA A;  2LTE A;  5KP8 B;  3DTJ A;  4PH3 A;  3G1G A;  1AYI A;  4XRO A;  1YHQ P;  2FQ2 A;  4LQW C;  1A43 A;  2LKI A;  2VLN A;  2XV6 A;  1E6J P;  4J93 A;  2X2D D;  2LF4 A;  5HGK A; 
#chains in the Genus database with same CATH homology
 1EOQ A;  3G21 A;  2Z46 A;  1JJ2 O;  2JYL A;  1D1D A;  1VQK P;  1M9Y C;  1EM9 A;  1K8A Q;  3G4S P;  1RO2 A;  1KQS O;  1M9E C;  1VQ9 P;  1QVF O;  3HZQ A;  4XRQ A;  2X83 A;  1VQN P;  3WBH A;  1YIJ P;  5HGM A;  2GON A;  3E2D A;  3G1I A;  2L6E A;  3MGE A;  4M0I A;  2QEX P;  2JYG A;  1K9M Q;  2DGY A;  1AK4 C;  1P7N A;  2PEK A;  3CC7 P;  1VQ8 P;  2XGY A;  3CMA P;  1K73 Q;  3CC2 P;  5HGO A;  2BHV A;  4GR6 A;  3HYB A;  1QRJ A;  2JPR A;  4COP A;  3CCE P;  3G26 A;  1M9D C;  3DS1 A;  4B4N A;  1Q86 Q;  2PY8 A;  2KGF A;  2V4X A;  4IPY A;  1RNI A;  1Q82 Q;  4U0E A;  3CCU P;  2P9X A;  2PEM A;  2PEO A;  1M9C C;  1YJ9 P;  1KD1 Q;  5HGL A;  1BAJ A;  2PEJ A;  1YJW P;  2PWM A;  3VRL C;  2E1M A;  2JO0 A;  4PH1 A;  3CCL P;  2Z44 A;  3LRY A;  1AUM A;  3RG6 C;  1VQM P;  2OTJ P;  3CPW O;  1VQ7 P;  5F2K A;  2KOD A;  2X82 A;  2PWO A;  5BS1 A;  1NJI Q;  4U0A A;  1M9X C;  3M1M A;  2PXR C;  3CC4 P;  2XXM A;  3DS4 A;  4QNB A;  3CCS P;  5DCK A;  1EIA A;  2Y4Z A;  4COC A;  1QVG O;  4GR2 A;  2PEI A;  1S72 P;  2WLV B;  4DGA C;  1VQP P;  3B5I A;  1A8O A;  4U0D A;  4PH2 A;  1VQL P;  2Z45 A;  2M8P A;  3P05 A;  3CD6 P;  3DS5 A;  3CCJ P;  1M1K Q;  1M90 Q;  3I55 P;  3G29 A;  1YI2 P;  5JPA A;  2EIA A;  4INB A;  2CWO A;  3Q20 A;  5I4T G;  3CCR P;  1Q7Y Q;  4U0B A;  5BS2 A;  4NX4 C;  3OW2 O;  2XGU A;  1ZMB A;  3H0D A;  1VQ4 P;  5F2O A;  2XGV A;  4PH0 A;  1G03 A;  4E92 A;  3NTE A;  2ONT A;  3CXC O;  1VQ6 P;  4U0F A;  1VQO P;  1IUQ A;  4XFY A;  3DS3 A;  3CCV P;  2WLV A;  1YIT P;  3DS2 A;  3DS0 A;  1N8R Q;  2M8N A;  1M74 A;  2PEN A;  4XFX A;  4U0C A;  3I56 P;  4WYM A;  2OAR A;  2QA4 P;  4XFZ A;  1Q81 Q;  2EG5 A;  2EFJ A;  2OTL P;  1K30 A;  1M6N A;  3DPH A;  1AFV A;  1M9F C;  4E91 A;  3G0V A;  3G28 A;  2GOL B;  3DTJ A;  4DGE C;  4PH3 A;  1U7K A;  3G1G A;  1RO0 A;  1KC8 Q;  4XRO A;  2PEQ A;  3H4E A;  2XT1 A;  2M8L A;  1YHQ P;  3G6E P;  1L6N A;  2XDE A;  1VQ5 P;  3G71 P;  2BUO A;  4LQW C;  3CCQ P;  1A43 A;  3CME P;  4HTW A;  1M6E X;  5HGN A;  1W2B O;  1GWP A;  2XV6 A;  1E6J P;  3CCM P;  3BP9 A;  4J93 A;  2X2D D;  5F2N A;  2LF4 A;  1YJN P;  5HGK A;  3H47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...