1D1DA

Nmr solution structure of the capsid protein from rous sarcoma virus
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
220
structure length
220
Chain Sequence
WTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLDRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLAEPAGPWADITQGPSESFVDFANRLIKAVEGSDLPPSARAPVIIDCFRQKSQPDIQQLIRAAPSTLTTPGEIIKYVLDRQKIAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords PROTEIN (CAPSID PROTEIN)
publication title Solution structure and dynamics of the Rous sarcoma virus capsid protein and comparison with capsid proteins of other retroviruses.
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 58
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 1999-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1d1dA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1d1dA02
4XRQA 4IPYA 2XDEA 5HGLA 3G21A 4U0EA 5I4TG 5HGMA 4NX4C 1L6NA 2LF4A 3LRYA 2WLVA 2M8PA 2L6EA 2V4XA 1M9XC 4XFZA 4J93A 4U0DA 3DS5A 2PWOA 2Y4ZA 4U0FA 4U0CA 2JPRA 4XROA 3DS1A 4COPA 2XXMA 2JYGA 1M9FC 2EIAA 4PH0A 1AUMA 1M9DC 1P7NA 2XGVA 4B4NA 2BUOA 3MGEA 5DCKA 4INBA 3DPHA 3G1GA 4XFYA 1D1DA 2PXRC 3DS3A 2M8NA 4M0IA 3DS0A 1AK4C 2X83A 4QNBA 4PH2A 2XGUA 2XGYA 4PH3A 1EOQA 1G03A 2JYLA 3P05A 1M9YC 3G29A 4COCA 1M9EC 5HGOA 3VRLC 2KODA 4PH1A 5JPAA 3DS4A 1A8OA 3G0VA 2GOLB 2JO0A 1EIAA 2X2DD 4LQWC 3G26A 1QRJA 4U0AA 2WLVB 3G28A 3DS2A 3H4EA 2M8LA 1M9CC 2XT1A 3DTJA 5HGNA 5HGKA 1GWPA 2XV6A 2ONTA 4HTWA 2X82A 4DGEC 1BAJA 4E92A 2GONA 2KGFA 3G1IA 1U7KA 4WYMA 4XFXA 2PWMA 4U0BA 4DGAC 1EM9A 3NTEA 1AFVA 3H47A 1E6JP 3BP9A 4E91A 1A43A
chains in the Genus database with same CATH superfamily
2PEQA 4IPYA 5HGLA 4U0EA 1ZNVA 1VQMP 2LF4A 3HYBA 2LPKA 2WLVA 4UHPB 1L0HA 2PEOA 1K73Q 2GYKA 3CCMP 2PENA 2V4XA 1M9XC 2OARA 2KGAA 2PWOA 4PWVB 3CE7A 3CCJP 2XXMA 1M6EX 1UJZA 2FQ2A 1M9FC 2WPTA 1M9DC 1RO0A 1UNKA 5BS2A 1E0HA 5HVCA 1QVFO 2LL8A 1VQ6P 1W2BO 2FACA 4INBA 4XFYA 1D1DA 2FHSC 1YITP 2QNWA 2K92A 3CPWO 2L9FA 3GJNA 1AK4C 2MR7A 3CCUP 3CMEP 2JB0A 4IZ6A 2GDYA 1ZMBA 5CZDB 3WBHA 3G29A 2MVVA 1VKUA 3CCEP 2KODA 2GOLB 2VLPA 1EIAA 2X2DD 3U43A 5KP7B 1OR5A 2MR8A 2N50A 1VQKP 3H4EA 3RG6C 2XT1A 2ROQA 3OW2O 3DTJA 1NJIQ 5HGNA 1X3OA 2K0DX 2OTJP 5HV8A 1YJNP 3Q20A 2ONTA 3CXCO 1Q82Q 4XFXA 4E91A 2K0XA 4XRQA 5I4TG 5HGMA 4BPHA 2EHTA 2KWLA 3GKLC 1RNIA 4GR6A 2QA4P 2M8PA 2L6EA 4J93A 2XZ1C 1N8RQ 2FQ1A 2JPRA 4XROA 4BPFA 3DS1A 1T8KA 2EIAA 4PH0A 1AUMA 2K94A 1P7NA 2JAZA 2FVAA 2Z45A 2K5XA 3CC4P 3MGEA 5DCKA 3LMOA 3DPHA 1Q86Q 1HQBA 4M0IA 1Q81Q 1M6NA 5EJDA 3GZLA 5BS1A 2EG5A 2ERHA 1M1KQ 4PH3A 1EOQA 3HZQA 3P05A 2M5RA 3B5IA 2FQ0A 3DS4A 1A8OA 2CWOA 5EW5E 1YI2P 2LIWA 1KLPA 2LTEA 4LQWC 3G6EP 2LMLA 1VQ7P 2WLVB 3G28A 3DS2A 1M9CC 3GZMA 3I56P 2MD9A 2XV6A 1VQLP 5KP6B 1VQ5P 2CG5B 2CGQA 1BAJA 2GONA 1U7KA 1DNYA 2N6YA 1DV5A 4PXHB 2CNRA 4U0BA 4DGAC 3NTEA 1VQOP 1VQ8P 1E6JP 2L4BA 1L0IA 2LKIA 4QKOA 3G21A 4NEOA 2DNWA 1VQNP 2L0QA 3LRYA 2AFEA 3CC7P 2MF4A 3CCVP 1VQ4P 2FAEA 1AYIA 4XFZA 4DG9A 3DS5A 3M1MA 3G71P 4U0CA 2KOQA 1VQ9P 2AFDA 2GDWA 2GDXA 2GZGA 2JGPA 1YJWP 2BUOA 2FVEA 2L22A 4H2YC 1GXGA 1YJ9P 2EFJA 2GZJA 2PXRC 2JQ4A 3H0DA 3CCQP 3DS3A 4R0MA 2M8NA 5F2NA 2CQ8A 2KGDA 2BHVA 1IMPA 4QNBA 2KORA 3CCLP 2OTLP 4PH2A 2XGUA 2KR5A 2XGYA 4H2WC 4F37A 1M74A 2Z46A 2GZIA 2JYLA 3G4SP 5HGOA 3VRLC 3B4QA 5JPAA 3I55P 3G0VA 7CEIA 4MRTC 2JBGA 1KQSO 1GXHA 1S72P 2K0YA 2MVUA 2M8LA 2MY5A 2E1MA 2JU2A 1GWPA 3RG2A 2GZFA 1K8AQ 4HTWA 2X82A 1JJ2O 4E92A 2KGFA 2Z44A 1F80D 2PWMA 3EJBA 5F2OA 1M90Q 2P9XA 2KG6A 2XDEA 1Q7YQ 2X2BA 4NX4C 1L6NA 1HY8A 3CMAP 1FR2A 2JU1A 2PNGA 2GZEA 2KG9A 2KOPA 2LOLA 1EMVA 1NQ4A 2FVFA 1ACPA 1KC8Q 1CEIA 4U0DA 2NO8A 2VLQA 2Y4ZA 4U0FA 2AVAA 4GR2A 2N5HA 4COPA 2KG8A 1YIJP 3CCSP 1GPJA 2JYGA 1VHNA 2N5IA 2XGVA 2QEXP 4B4NA 3CCRP 2N98A 2PEIA 5F2KA 3G1GA 2PY8A 2PEKA 2VLNA 3CC2P 2K2QA 3EJEA 3CD6P 2N6ZA 4BPGA 3DS0A 2X83A 1K9MQ 2K93A 2VSQA 2XZ0D 1G03A 1IMQA 2KOOA 1M9YC 4COCA 2KGEA 1M9EC 2KOSA 1RO2A 4PH1A 3EJDA 2AF8A 2JO0A 3G26A 1MZ8A 1K30A 1QRJA 4U0AA 2VLOA 3NY7B 3E2DA 2KGCA 2EHSA 2PEJA 1BXIA 2KW2A 5HGKA 4H2XC 1QVGO 1KD1Q 4DGEC 4HKGA 1VQPP 3G1IA 4WYMA 1YHQP 5KP8B 1Z6MA 1EM9A 1AF8A 1AFVA 2LIUA 3H47A 3BP9A 2DGYA 4CA3A 1IUQA 2FADA 2PEMA 1A43A
chains in the Genus database with same CATH topology
4XRQA 2PEQA 4IPYA 2XDEA 5HGLA 3G21A 1Q7YQ 4U0EA 5I4TG 5HGMA 4NX4C 1VQNP 1L6NA 1VQMP 2LF4A 3HYBA 3CMAP 3LRYA 2WLVA 2PEOA 1K73Q 3CC7P 3CCMP 1RNIA 4GR6A 2QA4P 3CCVP 2M8PA 2L6EA 1VQ4P 2PENA 2V4XA 1M9XC 2OARA 4XFZA 1KC8Q 4J93A 4U0DA 3DS5A 3M1MA 1N8RQ 2PWOA 3G71P 2Y4ZA 4U0FA 4U0CA 1VQ9P 2JPRA 4XROA 4GR2A 3CCJP 3DS1A 4COPA 1YIJP 2XXMA 3CCSP 1M6EX 2JYGA 1M9FC 2EIAA 4PH0A 1AUMA 1M9DC 1P7NA 1RO0A 5BS2A 2XGVA 2Z45A 2QEXP 1YJWP 4B4NA 3CC4P 2BUOA 1QVFO 3CCRP 3MGEA 5DCKA 1VQ6P 1W2BO 2PEIA 5F2KA 4INBA 2PY8A 2PEKA 3DPHA 3G1GA 1YJ9P 4XFYA 1D1DA 2EFJA 1YITP 2PXRC 1Q86Q 3CC2P 3CPWO 3H0DA 3CCQP 3CD6P 3DS3A 2M8NA 4M0IA 1Q81Q 1M6NA 3DS0A 1AK4C 2X83A 5F2NA 2BHVA 4QNBA 1K9MQ 3CCLP 2OTLP 4PH2A 5BS1A 2EG5A 2XGUA 3CCUP 2XGYA 1M1KQ 3CMEP 4PH3A 1ZMBA 1M74A 2Z46A 3WBHA 1EOQA 3HZQA 1G03A 2JYLA 3G4SP 3P05A 1M9YC 3G29A 4COCA 1M9EC 5HGOA 3VRLC 3B5IA 3CCEP 1RO2A 2KODA 4PH1A 5JPAA 3DS4A 3I55P 1A8OA 2CWOA 3G0VA 2GOLB 1YI2P 2JO0A 1EIAA 2X2DD 4LQWC 3G26A 1KQSO 3G6EP 1K30A 1QRJA 4U0AA 1VQ7P 2WLVB 3G28A 1S72P 3E2DA 3DS2A 1VQKP 3H4EA 2PEJA 2M8LA 3RG6C 1M9CC 2XT1A 3I56P 2E1MA 3OW2O 3DTJA 1NJIQ 5HGNA 5HGKA 1GWPA 2OTJP 1YJNP 2XV6A 3Q20A 2ONTA 1K8AQ 1VQLP 3CXCO 4HTWA 1Q82Q 1QVGO 2X82A 1VQ5P 1KD1Q 1JJ2O 4DGEC 1BAJA 1VQPP 4E92A 2GONA 2KGFA 3G1IA 1U7KA 4WYMA 1YHQP 2Z44A 4XFXA 2PWMA 4U0BA 4DGAC 1EM9A 3NTEA 1VQOP 5F2OA 1AFVA 1M90Q 3H47A 1VQ8P 1E6JP 3BP9A 4E91A 2DGYA 1IUQA 2P9XA 2PEMA 1A43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRQ A;  4IPY A;  2XDE A;  5HGL A;  3G21 A;  4U0E A;  5I4T G;  5HGM A;  4NX4 C;  1L6N A;  2LF4 A;  3LRY A;  2WLV A;  2M8P A;  2L6E A;  2V4X A;  1M9X C;  4XFZ A;  4J93 A;  4U0D A;  3DS5 A;  2PWO A;  2Y4Z A;  4U0F A;  4U0C A;  2JPR A;  4XRO A;  3DS1 A;  4COP A;  2XXM A;  2JYG A;  1M9F C;  2EIA A;  4PH0 A;  1AUM A;  1M9D C;  1P7N A;  2XGV A;  4B4N A;  2BUO A;  3MGE A;  5DCK A;  4INB A;  3DPH A;  3G1G A;  4XFY A;  1D1D A;  2PXR C;  3DS3 A;  2M8N A;  4M0I A;  3DS0 A;  1AK4 C;  2X83 A;  4QNB A;  4PH2 A;  2XGU A;  2XGY A;  4PH3 A;  1EOQ A;  1G03 A;  2JYL A;  3P05 A;  1M9Y C;  3G29 A;  4COC A;  1M9E C;  5HGO A;  3VRL C;  2KOD A;  4PH1 A;  5JPA A;  3DS4 A;  1A8O A;  3G0V A;  2GOL B;  2JO0 A;  1EIA A;  2X2D D;  4LQW C;  3G26 A;  1QRJ A;  4U0A A;  2WLV B;  3G28 A;  3DS2 A;  3H4E A;  2M8L A;  1M9C C;  2XT1 A;  3DTJ A;  5HGN A;  5HGK A;  1GWP A;  2XV6 A;  2ONT A;  4HTW A;  2X82 A;  4DGE C;  1BAJ A;  4E92 A;  2GON A;  2KGF A;  3G1I A;  1U7K A;  4WYM A;  4XFX A;  2PWM A;  4U0B A;  4DGA C;  1EM9 A;  3NTE A;  1AFV A;  3H47 A;  1E6J P;  3BP9 A;  4E91 A;  1A43 A; 
#chains in the Genus database with same CATH topology
 2PEQ A;  4IPY A;  5HGL A;  4U0E A;  1ZNV A;  1VQM P;  2LF4 A;  3HYB A;  2LPK A;  2WLV A;  4UHP B;  1L0H A;  2PEO A;  1K73 Q;  2GYK A;  3CCM P;  2PEN A;  2V4X A;  1M9X C;  2OAR A;  2KGA A;  2PWO A;  4PWV B;  3CE7 A;  3CCJ P;  2XXM A;  1M6E X;  1UJZ A;  2FQ2 A;  1M9F C;  2WPT A;  1M9D C;  1RO0 A;  1UNK A;  5BS2 A;  1E0H A;  5HVC A;  1QVF O;  2LL8 A;  1VQ6 P;  1W2B O;  2FAC A;  4INB A;  4XFY A;  1D1D A;  2FHS C;  1YIT P;  2QNW A;  2K92 A;  3CPW O;  2L9F A;  3GJN A;  1AK4 C;  2MR7 A;  3CCU P;  3CME P;  2JB0 A;  4IZ6 A;  2GDY A;  1ZMB A;  5CZD B;  3WBH A;  3G29 A;  2MVV A;  1VKU A;  3CCE P;  2KOD A;  2GOL B;  2VLP A;  1EIA A;  2X2D D;  3U43 A;  5KP7 B;  1OR5 A;  2MR8 A;  2N50 A;  1VQK P;  3H4E A;  3RG6 C;  2XT1 A;  2ROQ A;  3OW2 O;  3DTJ A;  1NJI Q;  5HGN A;  1X3O A;  2K0D X;  2OTJ P;  5HV8 A;  1YJN P;  3Q20 A;  2ONT A;  3CXC O;  1Q82 Q;  4XFX A;  4E91 A;  2K0X A;  4XRQ A;  5I4T G;  5HGM A;  4BPH A;  2EHT A;  2KWL A;  3GKL C;  1RNI A;  4GR6 A;  2QA4 P;  2M8P A;  2L6E A;  4J93 A;  2XZ1 C;  1N8R Q;  2FQ1 A;  2JPR A;  4XRO A;  4BPF A;  3DS1 A;  1T8K A;  2EIA A;  4PH0 A;  1AUM A;  2K94 A;  1P7N A;  2JAZ A;  2FVA A;  2Z45 A;  2K5X A;  3CC4 P;  3MGE A;  5DCK A;  3LMO A;  3DPH A;  1Q86 Q;  1HQB A;  4M0I A;  1Q81 Q;  1M6N A;  5EJD A;  3GZL A;  5BS1 A;  2EG5 A;  2ERH A;  1M1K Q;  4PH3 A;  1EOQ A;  3HZQ A;  3P05 A;  2M5R A;  3B5I A;  2FQ0 A;  3DS4 A;  1A8O A;  2CWO A;  5EW5 E;  1YI2 P;  2LIW A;  1KLP A;  2LTE A;  4LQW C;  3G6E P;  2LML A;  1VQ7 P;  2WLV B;  3G28 A;  3DS2 A;  1M9C C;  3GZM A;  3I56 P;  2MD9 A;  2XV6 A;  1VQL P;  5KP6 B;  1VQ5 P;  2CG5 B;  2CGQ A;  1BAJ A;  2GON A;  1U7K A;  1DNY A;  2N6Y A;  1DV5 A;  4PXH B;  2CNR A;  4U0B A;  4DGA C;  3NTE A;  1VQO P;  1VQ8 P;  1E6J P;  2L4B A;  1L0I A;  2LKI A;  4QKO A;  3G21 A;  4NEO A;  2DNW A;  1VQN P;  2L0Q A;  3LRY A;  2AFE A;  3CC7 P;  2MF4 A;  3CCV P;  1VQ4 P;  2FAE A;  1AYI A;  4XFZ A;  4DG9 A;  3DS5 A;  3M1M A;  3G71 P;  4U0C A;  2KOQ A;  1VQ9 P;  2AFD A;  2GDW A;  2GDX A;  2GZG A;  2JGP A;  1YJW P;  2BUO A;  2FVE A;  2L22 A;  4H2Y C;  1GXG A;  1YJ9 P;  2EFJ A;  2GZJ A;  2PXR C;  2JQ4 A;  3H0D A;  3CCQ P;  3DS3 A;  4R0M A;  2M8N A;  5F2N A;  2CQ8 A;  2KGD A;  2BHV A;  1IMP A;  4QNB A;  2KOR A;  3CCL P;  2OTL P;  4PH2 A;  2XGU A;  2KR5 A;  2XGY A;  4H2W C;  4F37 A;  1M74 A;  2Z46 A;  2GZI A;  2JYL A;  3G4S P;  5HGO A;  3VRL C;  3B4Q A;  5JPA A;  3I55 P;  3G0V A;  7CEI A;  4MRT C;  2JBG A;  1KQS O;  1GXH A;  1S72 P;  2K0Y A;  2MVU A;  2M8L A;  2MY5 A;  2E1M A;  2JU2 A;  1GWP A;  3RG2 A;  2GZF A;  1K8A Q;  4HTW A;  2X82 A;  1JJ2 O;  4E92 A;  2KGF A;  2Z44 A;  1F80 D;  2PWM A;  3EJB A;  5F2O A;  1M90 Q;  2P9X A;  2KG6 A;  2XDE A;  1Q7Y Q;  2X2B A;  4NX4 C;  1L6N A;  1HY8 A;  3CMA P;  1FR2 A;  2JU1 A;  2PNG A;  2GZE A;  2KG9 A;  2KOP A;  2LOL A;  1EMV A;  1NQ4 A;  2FVF A;  1ACP A;  1KC8 Q;  1CEI A;  4U0D A;  2NO8 A;  2VLQ A;  2Y4Z A;  4U0F A;  2AVA A;  4GR2 A;  2N5H A;  4COP A;  2KG8 A;  1YIJ P;  3CCS P;  1GPJ A;  2JYG A;  1VHN A;  2N5I A;  2XGV A;  2QEX P;  4B4N A;  3CCR P;  2N98 A;  2PEI A;  5F2K A;  3G1G A;  2PY8 A;  2PEK A;  2VLN A;  3CC2 P;  2K2Q A;  3EJE A;  3CD6 P;  2N6Z A;  4BPG A;  3DS0 A;  2X83 A;  1K9M Q;  2K93 A;  2VSQ A;  2XZ0 D;  1G03 A;  1IMQ A;  2KOO A;  1M9Y C;  4COC A;  2KGE A;  1M9E C;  2KOS A;  1RO2 A;  4PH1 A;  3EJD A;  2AF8 A;  2JO0 A;  3G26 A;  1MZ8 A;  1K30 A;  1QRJ A;  4U0A A;  2VLO A;  3NY7 B;  3E2D A;  2KGC A;  2EHS A;  2PEJ A;  1BXI A;  2KW2 A;  5HGK A;  4H2X C;  1QVG O;  1KD1 Q;  4DGE C;  4HKG A;  1VQP P;  3G1I A;  4WYM A;  1YHQ P;  5KP8 B;  1Z6M A;  1EM9 A;  1AF8 A;  1AFV A;  2LIU A;  3H47 A;  3BP9 A;  2DGY A;  4CA3 A;  1IUQ A;  2FAD A;  2PEM A;  1A43 A; 
#chains in the Genus database with same CATH homology
 4XRQ A;  2PEQ A;  4IPY A;  2XDE A;  5HGL A;  3G21 A;  1Q7Y Q;  4U0E A;  5I4T G;  5HGM A;  4NX4 C;  1VQN P;  1L6N A;  1VQM P;  2LF4 A;  3HYB A;  3CMA P;  3LRY A;  2WLV A;  2PEO A;  1K73 Q;  3CC7 P;  3CCM P;  1RNI A;  4GR6 A;  2QA4 P;  3CCV P;  2M8P A;  2L6E A;  1VQ4 P;  2PEN A;  2V4X A;  1M9X C;  2OAR A;  4XFZ A;  1KC8 Q;  4J93 A;  4U0D A;  3DS5 A;  3M1M A;  1N8R Q;  2PWO A;  3G71 P;  2Y4Z A;  4U0F A;  4U0C A;  1VQ9 P;  2JPR A;  4XRO A;  4GR2 A;  3CCJ P;  3DS1 A;  4COP A;  1YIJ P;  2XXM A;  3CCS P;  1M6E X;  2JYG A;  1M9F C;  2EIA A;  4PH0 A;  1AUM A;  1M9D C;  1P7N A;  1RO0 A;  5BS2 A;  2XGV A;  2Z45 A;  2QEX P;  1YJW P;  4B4N A;  3CC4 P;  2BUO A;  1QVF O;  3CCR P;  3MGE A;  5DCK A;  1VQ6 P;  1W2B O;  2PEI A;  5F2K A;  4INB A;  2PY8 A;  2PEK A;  3DPH A;  3G1G A;  1YJ9 P;  4XFY A;  1D1D A;  2EFJ A;  1YIT P;  2PXR C;  1Q86 Q;  3CC2 P;  3CPW O;  3H0D A;  3CCQ P;  3CD6 P;  3DS3 A;  2M8N A;  4M0I A;  1Q81 Q;  1M6N A;  3DS0 A;  1AK4 C;  2X83 A;  5F2N A;  2BHV A;  4QNB A;  1K9M Q;  3CCL P;  2OTL P;  4PH2 A;  5BS1 A;  2EG5 A;  2XGU A;  3CCU P;  2XGY A;  1M1K Q;  3CME P;  4PH3 A;  1ZMB A;  1M74 A;  2Z46 A;  3WBH A;  1EOQ A;  3HZQ A;  1G03 A;  2JYL A;  3G4S P;  3P05 A;  1M9Y C;  3G29 A;  4COC A;  1M9E C;  5HGO A;  3VRL C;  3B5I A;  3CCE P;  1RO2 A;  2KOD A;  4PH1 A;  5JPA A;  3DS4 A;  3I55 P;  1A8O A;  2CWO A;  3G0V A;  2GOL B;  1YI2 P;  2JO0 A;  1EIA A;  2X2D D;  4LQW C;  3G26 A;  1KQS O;  3G6E P;  1K30 A;  1QRJ A;  4U0A A;  1VQ7 P;  2WLV B;  3G28 A;  1S72 P;  3E2D A;  3DS2 A;  1VQK P;  3H4E A;  2PEJ A;  2M8L A;  3RG6 C;  1M9C C;  2XT1 A;  3I56 P;  2E1M A;  3OW2 O;  3DTJ A;  1NJI Q;  5HGN A;  5HGK A;  1GWP A;  2OTJ P;  1YJN P;  2XV6 A;  3Q20 A;  2ONT A;  1K8A Q;  1VQL P;  3CXC O;  4HTW A;  1Q82 Q;  1QVG O;  2X82 A;  1VQ5 P;  1KD1 Q;  1JJ2 O;  4DGE C;  1BAJ A;  1VQP P;  4E92 A;  2GON A;  2KGF A;  3G1I A;  1U7K A;  4WYM A;  1YHQ P;  2Z44 A;  4XFX A;  2PWM A;  4U0B A;  4DGA C;  1EM9 A;  3NTE A;  1VQO P;  5F2O A;  1AFV A;  1M90 Q;  3H47 A;  1VQ8 P;  1E6J P;  3BP9 A;  4E91 A;  2DGY A;  1IUQ A;  2P9X A;  2PEM A;  1A43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...