1GWPA

Structure of the n-terminal domain of the mature hiv-1 capsid protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
151
structure length
151
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Structure of the N-Terminal 283-Residue Fragment of the Immature HIV-1 Gag Polyprotein
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 36
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2002-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1gwpA00
2X2DD 2WLVA 2PWOA 1GWPA 1M9CC 4LQWC 4XFYA 4QNBA 4U0FA 1EIAA 3MGEA 2WLVB 2GOLB 4XFZA 3BP9A 4U0EA 1P7NA 2X82A 2LF4A 2M8NA 4XROA 2XGVA 4PH0A 1L6NA 2XGYA 2PXRC 2Y4ZA 4U0DA 1M9YC 2XDEA 1M9XC 2M8LA 2EIAA 2XGUA 1D1DA 4E92A 4B4NA 2V4XA 4U0CA 4WYMA 2KGFA 4XRQA 3H4EA 5HGNA 4E91A 1AK4C 4J93A 5HGLA 5HGKA 4XFXA 4DGEC 4PH2A 4DGAC 2GONA 1EM9A 4NX4C 5JPAA 4PH3A 2PWMA 3H47A 1M9EC 3NTEA 4INBA 1M9DC 5HGMA 1AFVA 4U0BA 2M8PA 1G03A 2JPRA 4U0AA 1U7KA 2X83A 1E6JP 3P05A 4HTWA 1QRJA 5HGOA 1M9FC
chains in the Genus database with same CATH superfamily
2X2DD 2WLVA 2PWOA 1GWPA 1M9CC 4LQWC 4XFYA 4QNBA 4U0FA 1EIAA 3MGEA 2WLVB 2GOLB 4XFZA 3BP9A 4U0EA 1P7NA 2X82A 2LF4A 2M8NA 4XROA 2XGVA 4PH0A 1L6NA 2XGYA 2PXRC 2Y4ZA 4U0DA 1M9YC 2XDEA 1M9XC 2M8LA 2EIAA 2XGUA 1D1DA 4E92A 4B4NA 2V4XA 4U0CA 4WYMA 2KGFA 4XRQA 3H4EA 5HGNA 4E91A 1AK4C 4J93A 5HGLA 5HGKA 4XFXA 4DGEC 4PH2A 4DGAC 2GONA 1EM9A 4NX4C 5JPAA 4PH3A 2PWMA 3H47A 1M9EC 3NTEA 4INBA 1M9DC 5HGMA 1AFVA 4U0BA 2M8PA 1G03A 2JPRA 4U0AA 1U7KA 2X83A 1E6JP 3P05A 4HTWA 1QRJA 5HGOA 1M9FC
chains in the Genus database with same CATH topology
2X2DD 2WLVA 2PWOA 1GWPA 1M9CC 4LQWC 4XFYA 4QNBA 4U0FA 1EIAA 3MGEA 2WLVB 2GOLB 4XFZA 3BP9A 4U0EA 1P7NA 2X82A 2LF4A 2M8NA 4XROA 2XGVA 4PH0A 1L6NA 2XGYA 2PXRC 2Y4ZA 4U0DA 1M9YC 2XDEA 1M9XC 2M8LA 2EIAA 2XGUA 1D1DA 4E92A 4B4NA 2V4XA 4U0CA 4WYMA 2KGFA 4XRQA 3H4EA 5HGNA 4E91A 1AK4C 4J93A 5HGLA 5HGKA 4XFXA 4DGEC 4PH2A 4DGAC 2GONA 1EM9A 4NX4C 5JPAA 4PH3A 2PWMA 3H47A 1M9EC 3NTEA 4INBA 1M9DC 5HGMA 1AFVA 4U0BA 2M8PA 1G03A 2JPRA 4U0AA 1U7KA 2X83A 1E6JP 3P05A 4HTWA 1QRJA 5HGOA 1M9FC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2D D;  2WLV A;  2PWO A;  1GWP A;  1M9C C;  4LQW C;  4XFY A;  4QNB A;  4U0F A;  1EIA A;  3MGE A;  2WLV B;  2GOL B;  4XFZ A;  3BP9 A;  4U0E A;  1P7N A;  2X82 A;  2LF4 A;  2M8N A;  4XRO A;  2XGV A;  4PH0 A;  1L6N A;  2XGY A;  2PXR C;  2Y4Z A;  4U0D A;  1M9Y C;  2XDE A;  1M9X C;  2M8L A;  2EIA A;  2XGU A;  1D1D A;  4E92 A;  4B4N A;  2V4X A;  4U0C A;  4WYM A;  2KGF A;  4XRQ A;  3H4E A;  5HGN A;  4E91 A;  1AK4 C;  4J93 A;  5HGL A;  5HGK A;  4XFX A;  4DGE C;  4PH2 A;  4DGA C;  2GON A;  1EM9 A;  4NX4 C;  5JPA A;  4PH3 A;  2PWM A;  3H47 A;  1M9E C;  3NTE A;  4INB A;  1M9D C;  5HGM A;  1AFV A;  4U0B A;  2M8P A;  1G03 A;  2JPR A;  4U0A A;  1U7K A;  2X83 A;  1E6J P;  3P05 A;  4HTW A;  1QRJ A;  5HGO A;  1M9F C; 
#chains in the Genus database with same CATH topology
 2X2D D;  2WLV A;  2PWO A;  1GWP A;  1M9C C;  4LQW C;  4XFY A;  4QNB A;  4U0F A;  1EIA A;  3MGE A;  2WLV B;  2GOL B;  4XFZ A;  3BP9 A;  4U0E A;  1P7N A;  2X82 A;  2LF4 A;  2M8N A;  4XRO A;  2XGV A;  4PH0 A;  1L6N A;  2XGY A;  2PXR C;  2Y4Z A;  4U0D A;  1M9Y C;  2XDE A;  1M9X C;  2M8L A;  2EIA A;  2XGU A;  1D1D A;  4E92 A;  4B4N A;  2V4X A;  4U0C A;  4WYM A;  2KGF A;  4XRQ A;  3H4E A;  5HGN A;  4E91 A;  1AK4 C;  4J93 A;  5HGL A;  5HGK A;  4XFX A;  4DGE C;  4PH2 A;  4DGA C;  2GON A;  1EM9 A;  4NX4 C;  5JPA A;  4PH3 A;  2PWM A;  3H47 A;  1M9E C;  3NTE A;  4INB A;  1M9D C;  5HGM A;  1AFV A;  4U0B A;  2M8P A;  1G03 A;  2JPR A;  4U0A A;  1U7K A;  2X83 A;  1E6J P;  3P05 A;  4HTW A;  1QRJ A;  5HGO A;  1M9F C; 
#chains in the Genus database with same CATH homology
 2X2D D;  2WLV A;  2PWO A;  1GWP A;  1M9C C;  4LQW C;  4XFY A;  4QNB A;  4U0F A;  1EIA A;  3MGE A;  2WLV B;  2GOL B;  4XFZ A;  3BP9 A;  4U0E A;  1P7N A;  2X82 A;  2LF4 A;  2M8N A;  4XRO A;  2XGV A;  4PH0 A;  1L6N A;  2XGY A;  2PXR C;  2Y4Z A;  4U0D A;  1M9Y C;  2XDE A;  1M9X C;  2M8L A;  2EIA A;  2XGU A;  1D1D A;  4E92 A;  4B4N A;  2V4X A;  4U0C A;  4WYM A;  2KGF A;  4XRQ A;  3H4E A;  5HGN A;  4E91 A;  1AK4 C;  4J93 A;  5HGL A;  5HGK A;  4XFX A;  4DGE C;  4PH2 A;  4DGA C;  2GON A;  1EM9 A;  4NX4 C;  5JPA A;  4PH3 A;  2PWM A;  3H47 A;  1M9E C;  3NTE A;  4INB A;  1M9D C;  5HGM A;  1AFV A;  4U0B A;  2M8P A;  1G03 A;  2JPR A;  4U0A A;  1U7K A;  2X83 A;  1E6J P;  3P05 A;  4HTW A;  1QRJ A;  5HGO A;  1M9F C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...