1GWPA

Structure of the n-terminal domain of the mature hiv-1 capsid protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
151
structure length
151
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the N-Terminal 283-Residue Fragment of the Immature HIV-1 Gag Polyprotein
pubmed doi rcsb
molecule keywords GAG POLYPROTEIN
molecule tags Viral protein
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
total genus 36
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2002-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1gwpA00
4INBA 4PH3A 4HTWA 4PH0A 4PH2A 4LQWC 2GONA 2X82A 2XGYA 1M9FC 5JPAA 4U0CA 2PXRC 4XRQA 1G03A 3H4EA 4B4NA 2WLVB 2M8LA 4QNBA 1P7NA 2JPRA 1AK4C 4XROA 4DGEC 1D1DA 2PWMA 3BP9A 4XFZA 2M8PA 4U0EA 4U0BA 2PWOA 4E92A 4J93A 5HGMA 1EIAA 2Y4ZA 2XDEA 5HGNA 5HGOA 4U0DA 2GOLB 1GWPA 4E91A 1M9YC 3P05A 1AFVA 2X83A 2KGFA 4WYMA 2X2DD 1M9CC 2XGUA 1M9DC 4U0FA 2M8NA 2LF4A 1U7KA 1E6JP 2WLVA 5HGKA 4NX4C 2EIAA 1L6NA 3MGEA 2XGVA 5HGLA 3NTEA 3H47A 4XFYA 1M9XC 1EM9A 2V4XA 1M9EC 4XFXA 1QRJA 4DGAC 4U0AA
chains in the Genus database with same CATH superfamily
4INBA 4PH3A 4HTWA 4PH0A 4PH2A 4LQWC 2GONA 2X82A 2XGYA 1M9FC 5JPAA 4U0CA 2PXRC 4XRQA 1G03A 3H4EA 4B4NA 2WLVB 2M8LA 4QNBA 1P7NA 2JPRA 1AK4C 4XROA 4DGEC 1D1DA 2PWMA 3BP9A 4XFZA 2M8PA 4U0EA 4U0BA 2PWOA 4E92A 4J93A 5HGMA 1EIAA 2Y4ZA 2XDEA 5HGNA 5HGOA 4U0DA 2GOLB 1GWPA 4E91A 1M9YC 3P05A 1AFVA 2X83A 2KGFA 4WYMA 2X2DD 1M9CC 2XGUA 1M9DC 4U0FA 2M8NA 2LF4A 1U7KA 1E6JP 2WLVA 5HGKA 4NX4C 2EIAA 1L6NA 3MGEA 2XGVA 5HGLA 3NTEA 3H47A 4XFYA 1M9XC 1EM9A 2V4XA 1M9EC 4XFXA 1QRJA 4DGAC 4U0AA
chains in the Genus database with same CATH topology
4INBA 4PH3A 4HTWA 4PH0A 4PH2A 4LQWC 2GONA 2X82A 2XGYA 1M9FC 5JPAA 4U0CA 2PXRC 4XRQA 1G03A 3H4EA 4B4NA 2WLVB 2M8LA 4QNBA 1P7NA 2JPRA 1AK4C 4XROA 4DGEC 1D1DA 2PWMA 3BP9A 4XFZA 2M8PA 4U0EA 4U0BA 2PWOA 4E92A 4J93A 5HGMA 1EIAA 2Y4ZA 2XDEA 5HGNA 5HGOA 4U0DA 2GOLB 1GWPA 4E91A 1M9YC 3P05A 1AFVA 2X83A 2KGFA 4WYMA 2X2DD 1M9CC 2XGUA 1M9DC 4U0FA 2M8NA 2LF4A 1U7KA 1E6JP 2WLVA 5HGKA 4NX4C 2EIAA 1L6NA 3MGEA 2XGVA 5HGLA 3NTEA 3H47A 4XFYA 1M9XC 1EM9A 2V4XA 1M9EC 4XFXA 1QRJA 4DGAC 4U0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4INB A;  4PH3 A;  4HTW A;  4PH0 A;  4PH2 A;  4LQW C;  2GON A;  2X82 A;  2XGY A;  1M9F C;  5JPA A;  4U0C A;  2PXR C;  4XRQ A;  1G03 A;  3H4E A;  4B4N A;  2WLV B;  2M8L A;  4QNB A;  1P7N A;  2JPR A;  1AK4 C;  4XRO A;  4DGE C;  1D1D A;  2PWM A;  3BP9 A;  4XFZ A;  2M8P A;  4U0E A;  4U0B A;  2PWO A;  4E92 A;  4J93 A;  5HGM A;  1EIA A;  2Y4Z A;  2XDE A;  5HGN A;  5HGO A;  4U0D A;  2GOL B;  1GWP A;  4E91 A;  1M9Y C;  3P05 A;  1AFV A;  2X83 A;  2KGF A;  4WYM A;  2X2D D;  1M9C C;  2XGU A;  1M9D C;  4U0F A;  2M8N A;  2LF4 A;  1U7K A;  1E6J P;  2WLV A;  5HGK A;  4NX4 C;  2EIA A;  1L6N A;  3MGE A;  2XGV A;  5HGL A;  3NTE A;  3H47 A;  4XFY A;  1M9X C;  1EM9 A;  2V4X A;  1M9E C;  4XFX A;  1QRJ A;  4DGA C;  4U0A A; 
#chains in the Genus database with same CATH topology
 4INB A;  4PH3 A;  4HTW A;  4PH0 A;  4PH2 A;  4LQW C;  2GON A;  2X82 A;  2XGY A;  1M9F C;  5JPA A;  4U0C A;  2PXR C;  4XRQ A;  1G03 A;  3H4E A;  4B4N A;  2WLV B;  2M8L A;  4QNB A;  1P7N A;  2JPR A;  1AK4 C;  4XRO A;  4DGE C;  1D1D A;  2PWM A;  3BP9 A;  4XFZ A;  2M8P A;  4U0E A;  4U0B A;  2PWO A;  4E92 A;  4J93 A;  5HGM A;  1EIA A;  2Y4Z A;  2XDE A;  5HGN A;  5HGO A;  4U0D A;  2GOL B;  1GWP A;  4E91 A;  1M9Y C;  3P05 A;  1AFV A;  2X83 A;  2KGF A;  4WYM A;  2X2D D;  1M9C C;  2XGU A;  1M9D C;  4U0F A;  2M8N A;  2LF4 A;  1U7K A;  1E6J P;  2WLV A;  5HGK A;  4NX4 C;  2EIA A;  1L6N A;  3MGE A;  2XGV A;  5HGL A;  3NTE A;  3H47 A;  4XFY A;  1M9X C;  1EM9 A;  2V4X A;  1M9E C;  4XFX A;  1QRJ A;  4DGA C;  4U0A A; 
#chains in the Genus database with same CATH homology
 4INB A;  4PH3 A;  4HTW A;  4PH0 A;  4PH2 A;  4LQW C;  2GON A;  2X82 A;  2XGY A;  1M9F C;  5JPA A;  4U0C A;  2PXR C;  4XRQ A;  1G03 A;  3H4E A;  4B4N A;  2WLV B;  2M8L A;  4QNB A;  1P7N A;  2JPR A;  1AK4 C;  4XRO A;  4DGE C;  1D1D A;  2PWM A;  3BP9 A;  4XFZ A;  2M8P A;  4U0E A;  4U0B A;  2PWO A;  4E92 A;  4J93 A;  5HGM A;  1EIA A;  2Y4Z A;  2XDE A;  5HGN A;  5HGO A;  4U0D A;  2GOL B;  1GWP A;  4E91 A;  1M9Y C;  3P05 A;  1AFV A;  2X83 A;  2KGF A;  4WYM A;  2X2D D;  1M9C C;  2XGU A;  1M9D C;  4U0F A;  2M8N A;  2LF4 A;  1U7K A;  1E6J P;  2WLV A;  5HGK A;  4NX4 C;  2EIA A;  1L6N A;  3MGE A;  2XGV A;  5HGL A;  3NTE A;  3H47 A;  4XFY A;  1M9X C;  1EM9 A;  2V4X A;  1M9E C;  4XFX A;  1QRJ A;  4DGA C;  4U0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...