1GWPA

Structure of the n-terminal domain of the mature hiv-1 capsid protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
151
structure length
151
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Structure of the N-Terminal 283-Residue Fragment of the Immature HIV-1 Gag Polyprotein
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 (new york-5 isolate)
molecule tags Viral protein
total genus 36
structure length 151
sequence length 151
ec nomenclature
pdb deposition date 2002-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1gwpA00
4E92A 1D1DA 1QRJA 4U0FA 1AK4C 4HTWA 1P7NA 1EM9A 2XGUA 2X2DD 4INBA 4WYMA 1U7KA 3H4EA 4J93A 2WLVA 2Y4ZA 4PH0A 2M8PA 1EIAA 1E6JP 4XRQA 2GOLB 4NX4C 2XDEA 3BP9A 2M8LA 3P05A 2LF4A 4XFXA 4U0DA 2JPRA 4QNBA 4U0AA 2PWMA 5HGKA 3NTEA 1GWPA 2KGFA 2M8NA 4U0CA 2X82A 1L6NA 2EIAA 1G03A 5HGMA 4DGAC 1M9EC 1M9DC 5HGLA 4B4NA 1AFVA 2XGYA 2X83A 3MGEA 4XFYA 1M9FC 4E91A 2PXRC 4LQWC 2XGVA 1M9YC 5HGOA 4U0EA 2GONA 3H47A 1M9XC 4U0BA 4DGEC 2PWOA 5JPAA 4PH2A 4PH3A 2WLVB 2V4XA 4XROA 4XFZA 1M9CC 5HGNA
chains in the Genus database with same CATH superfamily
4E92A 1D1DA 1QRJA 4U0FA 1AK4C 4HTWA 1P7NA 1EM9A 2XGUA 2X2DD 4INBA 4WYMA 1U7KA 3H4EA 4J93A 2WLVA 2Y4ZA 4PH0A 2M8PA 1EIAA 1E6JP 4XRQA 2GOLB 4NX4C 2XDEA 3BP9A 2M8LA 3P05A 2LF4A 4XFXA 4U0DA 2JPRA 4QNBA 4U0AA 2PWMA 5HGKA 3NTEA 1GWPA 2KGFA 2M8NA 4U0CA 2X82A 1L6NA 2EIAA 1G03A 5HGMA 4DGAC 1M9EC 1M9DC 5HGLA 4B4NA 1AFVA 2XGYA 2X83A 3MGEA 4XFYA 1M9FC 4E91A 2PXRC 4LQWC 2XGVA 1M9YC 5HGOA 4U0EA 2GONA 3H47A 1M9XC 4U0BA 4DGEC 2PWOA 5JPAA 4PH2A 4PH3A 2WLVB 2V4XA 4XROA 4XFZA 1M9CC 5HGNA
chains in the Genus database with same CATH topology
4E92A 1D1DA 1QRJA 4U0FA 1AK4C 4HTWA 1P7NA 1EM9A 2XGUA 2X2DD 4INBA 4WYMA 1U7KA 3H4EA 4J93A 2WLVA 2Y4ZA 4PH0A 2M8PA 1EIAA 1E6JP 4XRQA 2GOLB 4NX4C 2XDEA 3BP9A 2M8LA 3P05A 2LF4A 4XFXA 4U0DA 2JPRA 4QNBA 4U0AA 2PWMA 5HGKA 3NTEA 1GWPA 2KGFA 2M8NA 4U0CA 2X82A 1L6NA 2EIAA 1G03A 5HGMA 4DGAC 1M9EC 1M9DC 5HGLA 4B4NA 1AFVA 2XGYA 2X83A 3MGEA 4XFYA 1M9FC 4E91A 2PXRC 4LQWC 2XGVA 1M9YC 5HGOA 4U0EA 2GONA 3H47A 1M9XC 4U0BA 4DGEC 2PWOA 5JPAA 4PH2A 4PH3A 2WLVB 2V4XA 4XROA 4XFZA 1M9CC 5HGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E92 A;  1D1D A;  1QRJ A;  4U0F A;  1AK4 C;  4HTW A;  1P7N A;  1EM9 A;  2XGU A;  2X2D D;  4INB A;  4WYM A;  1U7K A;  3H4E A;  4J93 A;  2WLV A;  2Y4Z A;  4PH0 A;  2M8P A;  1EIA A;  1E6J P;  4XRQ A;  2GOL B;  4NX4 C;  2XDE A;  3BP9 A;  2M8L A;  3P05 A;  2LF4 A;  4XFX A;  4U0D A;  2JPR A;  4QNB A;  4U0A A;  2PWM A;  5HGK A;  3NTE A;  1GWP A;  2KGF A;  2M8N A;  4U0C A;  2X82 A;  1L6N A;  2EIA A;  1G03 A;  5HGM A;  4DGA C;  1M9E C;  1M9D C;  5HGL A;  4B4N A;  1AFV A;  2XGY A;  2X83 A;  3MGE A;  4XFY A;  1M9F C;  4E91 A;  2PXR C;  4LQW C;  2XGV A;  1M9Y C;  5HGO A;  4U0E A;  2GON A;  3H47 A;  1M9X C;  4U0B A;  4DGE C;  2PWO A;  5JPA A;  4PH2 A;  4PH3 A;  2WLV B;  2V4X A;  4XRO A;  4XFZ A;  1M9C C;  5HGN A; 
#chains in the Genus database with same CATH topology
 4E92 A;  1D1D A;  1QRJ A;  4U0F A;  1AK4 C;  4HTW A;  1P7N A;  1EM9 A;  2XGU A;  2X2D D;  4INB A;  4WYM A;  1U7K A;  3H4E A;  4J93 A;  2WLV A;  2Y4Z A;  4PH0 A;  2M8P A;  1EIA A;  1E6J P;  4XRQ A;  2GOL B;  4NX4 C;  2XDE A;  3BP9 A;  2M8L A;  3P05 A;  2LF4 A;  4XFX A;  4U0D A;  2JPR A;  4QNB A;  4U0A A;  2PWM A;  5HGK A;  3NTE A;  1GWP A;  2KGF A;  2M8N A;  4U0C A;  2X82 A;  1L6N A;  2EIA A;  1G03 A;  5HGM A;  4DGA C;  1M9E C;  1M9D C;  5HGL A;  4B4N A;  1AFV A;  2XGY A;  2X83 A;  3MGE A;  4XFY A;  1M9F C;  4E91 A;  2PXR C;  4LQW C;  2XGV A;  1M9Y C;  5HGO A;  4U0E A;  2GON A;  3H47 A;  1M9X C;  4U0B A;  4DGE C;  2PWO A;  5JPA A;  4PH2 A;  4PH3 A;  2WLV B;  2V4X A;  4XRO A;  4XFZ A;  1M9C C;  5HGN A; 
#chains in the Genus database with same CATH homology
 4E92 A;  1D1D A;  1QRJ A;  4U0F A;  1AK4 C;  4HTW A;  1P7N A;  1EM9 A;  2XGU A;  2X2D D;  4INB A;  4WYM A;  1U7K A;  3H4E A;  4J93 A;  2WLV A;  2Y4Z A;  4PH0 A;  2M8P A;  1EIA A;  1E6J P;  4XRQ A;  2GOL B;  4NX4 C;  2XDE A;  3BP9 A;  2M8L A;  3P05 A;  2LF4 A;  4XFX A;  4U0D A;  2JPR A;  4QNB A;  4U0A A;  2PWM A;  5HGK A;  3NTE A;  1GWP A;  2KGF A;  2M8N A;  4U0C A;  2X82 A;  1L6N A;  2EIA A;  1G03 A;  5HGM A;  4DGA C;  1M9E C;  1M9D C;  5HGL A;  4B4N A;  1AFV A;  2XGY A;  2X83 A;  3MGE A;  4XFY A;  1M9F C;  4E91 A;  2PXR C;  4LQW C;  2XGV A;  1M9Y C;  5HGO A;  4U0E A;  2GON A;  3H47 A;  1M9X C;  4U0B A;  4DGE C;  2PWO A;  5JPA A;  4PH2 A;  4PH3 A;  2WLV B;  2V4X A;  4XRO A;  4XFZ A;  1M9C C;  5HGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...