3NTEA

Crystal structure of the wild-type full-length hiv-1 capsid protein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the HIV-1 full-length capsid protein in a conformationally trapped unassembled state induced by small-molecule binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
total genus 76
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3nteA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3nteA02
1AFVA 2GONA 1L6NA 4XFXA 2JO0A 2KODA 2M8PA 1EOQA 4J93A 1D1DA 3G21A 2LF4A 2XT1A 4U0BA 4XROA 4U0FA 1AUMA 1G03A 4COPA 4U0CA 3H4EA 3DTJA 4IPYA 1EIAA 4HTWA 1M9XC 3DS2A 2JYLA 4U0EA 3DS3A 2WLVB 3DS5A 3DS0A 2XV6A 5HGLA 5HGNA 3G29A 1M9CC 1M9FC 3VRLC 4U0AA 4COCA 1A43A 4B4NA 1U7KA 4LQWC 2KGFA 1AK4C 5HGOA 3DS4A 2JYGA 2X82A 2ONTA 2XGYA 2M8NA 2M8LA 4WYMA 4PH1A 2L6EA 3NTEA 2XGUA 2WLVA 4DGAC 1P7NA 5HGMA 3H47A 3G0VA 5I4TG 2XXMA 4PH2A 3DPHA 3G1IA 2PWOA 4M0IA 4DGEC 1EM9A 4PH3A 4XFZA 1GWPA 2X83A 2JPRA 2X2DD 3G26A 4XRQA 4U0DA 1BAJA 4PH0A 4E92A 2V4XA 5JPAA 1E6JP 4XFYA 5DCKA 3G28A 2GOLB 4INBA 4E91A 2PWMA 1QRJA 3MGEA 1A8OA 1M9YC 2Y4ZA 4NX4C 1M9DC 3DS1A 3G1GA 3P05A 1M9EC 3BP9A 3LRYA 2PXRC 5HGKA 2XGVA 2XDEA 2EIAA 4QNBA 2BUOA
chains in the Genus database with same CATH superfamily
2VLNA 2P9XA 4H2XC 1VHNA 2KODA 1VQMP 2GYKA 3CXCO 4XROA 1HQBA 3RG6C 1X3OA 2AFEA 4COPA 4U0CA 3H4EA 3DTJA 3WBHA 1RO2A 2PEOA 1S72P 2PY8A 1VQ4P 5HGLA 1NJIQ 4CA3A 2KG6A 1U7KA 1K8AQ 2K5XA 2PENA 2FQ1A 5EJDA 2KOPA 4PH1A 3GZLA 2EHSA 2XGUA 2FVAA 4DGAC 3HYBA 1P7NA 1N8RQ 4HKGA 4PH2A 1IUQA 3G1IA 2GZEA 2KGDA 1T8KA 2K93A 1FR2A 3M1MA 3G26A 1AF8A 5F2NA 4U0DA 1BAJA 4PH0A 1YHQP 1YITP 2EG5A 2MF4A 2FVFA 4XFYA 5DCKA 3I55P 1QRJA 2KOSA 1M9YC 2Y4ZA 2CQ8A 2M5RA 1YI2P 1KC8Q 1W2BO 3P05A 3LRYA 2K0YA 2JGPA 5BS1A 4F37A 2VLQA 4BPGA 4QNBA 5KP8B 1VQ9P 1VQ7P 3CC4P 1L6NA 2NO8A 3G6EP 4XFXA 2JO0A 2M8PA 2LIWA 4J93A 1MZ8A 2Z44A 2LF4A 3RG2A 2DGYA 2LL8A 3B5IA 1EIAA 4HTWA 1F80D 2JYLA 4U0EA 5BS2A 3DS5A 3DS0A 1Q86Q 3CMEP 2QA4P 2XZ0D 2OTJP 1M9FC 2N5IA 3Q20A 2GZFA 4COCA 5EW5E 3CCRP 2VLOA 4B4NA 2L22A 2LTEA 2PNGA 2FVEA 1VQ5P 2KORA 2GZIA 1VQOP 3DS4A 2OTLP 2AVAA 2X82A 4MRTC 3CC2P 2M8NA 4PWVB 1JJ2O 4BPFA 2M8LA 4WYMA 2L6EA 1RNIA 2CGQA 3CCJP 2CNRA 2MR8A 1NQ4A 3G71P 3G0VA 2MVUA 1VQPP 2JBGA 2FAEA 1L0HA 4M0IA 1DNYA 1UJZA 2KG9A 5KP6B 1KD1Q 2PEMA 4XFZA 1Q7YQ 2JPRA 2FQ0A 1QVGO 2EHTA 3CD6P 2K2QA 4E91A 4INBA 2L0QA 2PWMA 2LMLA 4BPHA 3MGEA 2K92A 2KGEA 3G1GA 1IMPA 2K0DX 1UNKA 1YJ9P 1ZNVA 2XZ1C 3CCQP 1VKUA 2BUOA 1AFVA 2GONA 2LKIA 2BHVA 2GDWA 2PEIA 1EOQA 1VQNP 1VQ6P 1D1DA 3CCUP 2EFJA 4GR2A 4U0BA 1AUMA 1G03A 2JAZA 1GXHA 3GZMA 3CCVP 1M9XC 3DS2A 1YJWP 2OARA 3DS3A 2WLVB 1RO0A 1GXGA 1VQLP 2MD9A 3CCMP 3G29A 3VRLC 4H2YC 3I56P 5CZDB 1VQ8P 2QEXP 2MVVA 1VQKP 2FACA 4LQWC 1ACPA 1YJNP 2FHSC 3CMAP 5HGOA 2JB0A 5F2KA 1M1KQ 2N6YA 3E2DA 3G4SP 2PEKA 1KLPA 1HY8A 3EJBA 2X2BA 3NTEA 2L4BA 2WPTA 5HGMA 1M6EX 4UHPB 3H47A 2N6ZA 2FQ2A 5I4TG 2XXMA 3GJNA 3DPHA 1M74A 2PWOA 5KP7B 2KOOA 4PH3A 3OW2O 1QVFO 1GWPA 2X83A 4XRQA 5HVCA 1M6NA 2V4XA 3CE7A 1K73Q 4DG9A 2VSQA 3G28A 2Z46A 1A8OA 4NX4C 4IZ6A 2N98A 2MY5A 1M9EC 2PXRC 5HGKA 2XGVA 2XDEA 2EIAA 3LMOA 2KW2A 3CCEP 2E1MA 4R0MA 3EJDA 1BXIA 1KQSO 3G21A 1Z6MA 2XT1A 2KGAA 3U43A 4U0FA 2N50A 4IPYA 2AF8A 1K9MQ 2XV6A 2KOQA 5HGNA 1M9CC 2ERHA 4U0AA 2GDYA 2JU2A 2PEQA 1A43A 2KG8A 2KGFA 1AK4C 1YIJP 1GPJA 4NEOA 1IMQA 2N5HA 2Z45A 2JYGA 2ONTA 1K30A 2JU1A 7CEIA 2XGYA 2CWOA 5F2OA 4QKOA 2KR5A 3H0DA 1DV5A 3GKLC 2GZJA 3CCSP 2AFDA 2WLVA 2GZGA 1EMVA 2L9FA 2DNWA 1ZMBA 4H2WC 3CPWO 1AYIA 2FADA 1Q81Q 1CEIA 3CCLP 2QNWA 4DGEC 3B4QA 2MR7A 2VLPA 1EM9A 2X2DD 3NY7B 3CC7P 2LPKA 2K94A 4E92A 1Q82Q 3EJEA 5JPAA 1E6JP 2LIUA 2GOLB 1E0HA 2GDXA 2LOLA 3HZQA 2K0XA 1M9DC 5HV8A 2KGCA 3DS1A 1L0IA 4PXHB 2CG5B 2PEJA 1OR5A 2KWLA 3BP9A 2JQ4A 2ROQA 1M90Q 4GR6A
chains in the Genus database with same CATH topology
1VQ9P 3CCEP 1VQ7P 1AFVA 2GONA 2E1MA 2P9XA 3CC4P 1L6NA 2BHVA 3G6EP 4XFXA 2JO0A 2KODA 2M8PA 2PEIA 1VQMP 1EOQA 1VQNP 4J93A 1VQ6P 1D1DA 3CCUP 1KQSO 2EFJA 3G21A 2Z44A 4GR2A 2LF4A 2XT1A 3CXCO 4U0BA 4XROA 4U0FA 3RG6C 2DGYA 1AUMA 1G03A 4COPA 4U0CA 3H4EA 3DTJA 3B5IA 4IPYA 1EIAA 3CCVP 4HTWA 1M9XC 3DS2A 3WBHA 1RO2A 1YJWP 2OARA 2PEOA 1S72P 1K9MQ 2JYLA 4U0EA 3DS3A 2WLVB 3DS5A 3DS0A 2PY8A 5BS2A 1Q86Q 3CMEP 2XV6A 1VQ4P 1RO0A 5HGLA 2QA4P 1VQLP 5HGNA 3CCMP 3G29A 1M9CC 1M9FC 1NJIQ 3VRLC 2OTJP 4U0AA 3Q20A 3I56P 1VQ8P 4COCA 2QEXP 2PEQA 1A43A 3CCRP 4B4NA 1VQKP 1U7KA 4LQWC 2KGFA 1AK4C 1YJNP 1YIJP 1K8AQ 3CMAP 5HGOA 5F2KA 1VQ5P 1M1KQ 1VQOP 3DS4A 2OTLP 3E2DA 2Z45A 2JYGA 3G4SP 2X82A 2ONTA 1K30A 2PEKA 2PENA 3CC2P 2XGYA 2CWOA 5F2OA 2M8NA 1JJ2O 3H0DA 2M8LA 4WYMA 4PH1A 2L6EA 1RNIA 3CCSP 3NTEA 2XGUA 3CCJP 2WLVA 4DGAC 3HYBA 1P7NA 1N8RQ 5HGMA 1M6EX 1ZMBA 3H47A 3G71P 3G0VA 5I4TG 3CPWO 2XXMA 4PH2A 1VQPP 1IUQA 3DPHA 1Q81Q 1M74A 3CCLP 3G1IA 2PWOA 4M0IA 4DGEC 1KD1Q 1EM9A 4PH3A 3OW2O 2PEMA 4XFZA 1GWPA 1Q7YQ 2X83A 2JPRA 1QVFO 2X2DD 3M1MA 3CC7P 3G26A 5F2NA 1QVGO 4XRQA 4U0DA 1BAJA 4PH0A 1YHQP 1YITP 1M6NA 4E92A 1Q82Q 3CD6P 2V4XA 2EG5A 5JPAA 1E6JP 1K73Q 4XFYA 5DCKA 3G28A 2GOLB 4INBA 4E91A 2PWMA 3I55P 1QRJA 2Z46A 3MGEA 1A8OA 3HZQA 1M9YC 2Y4ZA 4NX4C 1M9DC 3DS1A 3G1GA 2PEJA 1YI2P 1KC8Q 1W2BO 3P05A 1M9EC 3BP9A 3LRYA 2PXRC 1YJ9P 5BS1A 5HGKA 3CCQP 2XGVA 2XDEA 1M90Q 2EIAA 4GR6A 4QNBA 2BUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AFV A;  2GON A;  1L6N A;  4XFX A;  2JO0 A;  2KOD A;  2M8P A;  1EOQ A;  4J93 A;  1D1D A;  3G21 A;  2LF4 A;  2XT1 A;  4U0B A;  4XRO A;  4U0F A;  1AUM A;  1G03 A;  4COP A;  4U0C A;  3H4E A;  3DTJ A;  4IPY A;  1EIA A;  4HTW A;  1M9X C;  3DS2 A;  2JYL A;  4U0E A;  3DS3 A;  2WLV B;  3DS5 A;  3DS0 A;  2XV6 A;  5HGL A;  5HGN A;  3G29 A;  1M9C C;  1M9F C;  3VRL C;  4U0A A;  4COC A;  1A43 A;  4B4N A;  1U7K A;  4LQW C;  2KGF A;  1AK4 C;  5HGO A;  3DS4 A;  2JYG A;  2X82 A;  2ONT A;  2XGY A;  2M8N A;  2M8L A;  4WYM A;  4PH1 A;  2L6E A;  3NTE A;  2XGU A;  2WLV A;  4DGA C;  1P7N A;  5HGM A;  3H47 A;  3G0V A;  5I4T G;  2XXM A;  4PH2 A;  3DPH A;  3G1I A;  2PWO A;  4M0I A;  4DGE C;  1EM9 A;  4PH3 A;  4XFZ A;  1GWP A;  2X83 A;  2JPR A;  2X2D D;  3G26 A;  4XRQ A;  4U0D A;  1BAJ A;  4PH0 A;  4E92 A;  2V4X A;  5JPA A;  1E6J P;  4XFY A;  5DCK A;  3G28 A;  2GOL B;  4INB A;  4E91 A;  2PWM A;  1QRJ A;  3MGE A;  1A8O A;  1M9Y C;  2Y4Z A;  4NX4 C;  1M9D C;  3DS1 A;  3G1G A;  3P05 A;  1M9E C;  3BP9 A;  3LRY A;  2PXR C;  5HGK A;  2XGV A;  2XDE A;  2EIA A;  4QNB A;  2BUO A; 
#chains in the Genus database with same CATH topology
 2VLN A;  2P9X A;  4H2X C;  1VHN A;  2KOD A;  1VQM P;  2GYK A;  3CXC O;  4XRO A;  1HQB A;  3RG6 C;  1X3O A;  2AFE A;  4COP A;  4U0C A;  3H4E A;  3DTJ A;  3WBH A;  1RO2 A;  2PEO A;  1S72 P;  2PY8 A;  1VQ4 P;  5HGL A;  1NJI Q;  4CA3 A;  2KG6 A;  1U7K A;  1K8A Q;  2K5X A;  2PEN A;  2FQ1 A;  5EJD A;  2KOP A;  4PH1 A;  3GZL A;  2EHS A;  2XGU A;  2FVA A;  4DGA C;  3HYB A;  1P7N A;  1N8R Q;  4HKG A;  4PH2 A;  1IUQ A;  3G1I A;  2GZE A;  2KGD A;  1T8K A;  2K93 A;  1FR2 A;  3M1M A;  3G26 A;  1AF8 A;  5F2N A;  4U0D A;  1BAJ A;  4PH0 A;  1YHQ P;  1YIT P;  2EG5 A;  2MF4 A;  2FVF A;  4XFY A;  5DCK A;  3I55 P;  1QRJ A;  2KOS A;  1M9Y C;  2Y4Z A;  2CQ8 A;  2M5R A;  1YI2 P;  1KC8 Q;  1W2B O;  3P05 A;  3LRY A;  2K0Y A;  2JGP A;  5BS1 A;  4F37 A;  2VLQ A;  4BPG A;  4QNB A;  5KP8 B;  1VQ9 P;  1VQ7 P;  3CC4 P;  1L6N A;  2NO8 A;  3G6E P;  4XFX A;  2JO0 A;  2M8P A;  2LIW A;  4J93 A;  1MZ8 A;  2Z44 A;  2LF4 A;  3RG2 A;  2DGY A;  2LL8 A;  3B5I A;  1EIA A;  4HTW A;  1F80 D;  2JYL A;  4U0E A;  5BS2 A;  3DS5 A;  3DS0 A;  1Q86 Q;  3CME P;  2QA4 P;  2XZ0 D;  2OTJ P;  1M9F C;  2N5I A;  3Q20 A;  2GZF A;  4COC A;  5EW5 E;  3CCR P;  2VLO A;  4B4N A;  2L22 A;  2LTE A;  2PNG A;  2FVE A;  1VQ5 P;  2KOR A;  2GZI A;  1VQO P;  3DS4 A;  2OTL P;  2AVA A;  2X82 A;  4MRT C;  3CC2 P;  2M8N A;  4PWV B;  1JJ2 O;  4BPF A;  2M8L A;  4WYM A;  2L6E A;  1RNI A;  2CGQ A;  3CCJ P;  2CNR A;  2MR8 A;  1NQ4 A;  3G71 P;  3G0V A;  2MVU A;  1VQP P;  2JBG A;  2FAE A;  1L0H A;  4M0I A;  1DNY A;  1UJZ A;  2KG9 A;  5KP6 B;  1KD1 Q;  2PEM A;  4XFZ A;  1Q7Y Q;  2JPR A;  2FQ0 A;  1QVG O;  2EHT A;  3CD6 P;  2K2Q A;  4E91 A;  4INB A;  2L0Q A;  2PWM A;  2LML A;  4BPH A;  3MGE A;  2K92 A;  2KGE A;  3G1G A;  1IMP A;  2K0D X;  1UNK A;  1YJ9 P;  1ZNV A;  2XZ1 C;  3CCQ P;  1VKU A;  2BUO A;  1AFV A;  2GON A;  2LKI A;  2BHV A;  2GDW A;  2PEI A;  1EOQ A;  1VQN P;  1VQ6 P;  1D1D A;  3CCU P;  2EFJ A;  4GR2 A;  4U0B A;  1AUM A;  1G03 A;  2JAZ A;  1GXH A;  3GZM A;  3CCV P;  1M9X C;  3DS2 A;  1YJW P;  2OAR A;  3DS3 A;  2WLV B;  1RO0 A;  1GXG A;  1VQL P;  2MD9 A;  3CCM P;  3G29 A;  3VRL C;  4H2Y C;  3I56 P;  5CZD B;  1VQ8 P;  2QEX P;  2MVV A;  1VQK P;  2FAC A;  4LQW C;  1ACP A;  1YJN P;  2FHS C;  3CMA P;  5HGO A;  2JB0 A;  5F2K A;  1M1K Q;  2N6Y A;  3E2D A;  3G4S P;  2PEK A;  1KLP A;  1HY8 A;  3EJB A;  2X2B A;  3NTE A;  2L4B A;  2WPT A;  5HGM A;  1M6E X;  4UHP B;  3H47 A;  2N6Z A;  2FQ2 A;  5I4T G;  2XXM A;  3GJN A;  3DPH A;  1M74 A;  2PWO A;  5KP7 B;  2KOO A;  4PH3 A;  3OW2 O;  1QVF O;  1GWP A;  2X83 A;  4XRQ A;  5HVC A;  1M6N A;  2V4X A;  3CE7 A;  1K73 Q;  4DG9 A;  2VSQ A;  3G28 A;  2Z46 A;  1A8O A;  4NX4 C;  4IZ6 A;  2N98 A;  2MY5 A;  1M9E C;  2PXR C;  5HGK A;  2XGV A;  2XDE A;  2EIA A;  3LMO A;  2KW2 A;  3CCE P;  2E1M A;  4R0M A;  3EJD A;  1BXI A;  1KQS O;  3G21 A;  1Z6M A;  2XT1 A;  2KGA A;  3U43 A;  4U0F A;  2N50 A;  4IPY A;  2AF8 A;  1K9M Q;  2XV6 A;  2KOQ A;  5HGN A;  1M9C C;  2ERH A;  4U0A A;  2GDY A;  2JU2 A;  2PEQ A;  1A43 A;  2KG8 A;  2KGF A;  1AK4 C;  1YIJ P;  1GPJ A;  4NEO A;  1IMQ A;  2N5H A;  2Z45 A;  2JYG A;  2ONT A;  1K30 A;  2JU1 A;  7CEI A;  2XGY A;  2CWO A;  5F2O A;  4QKO A;  2KR5 A;  3H0D A;  1DV5 A;  3GKL C;  2GZJ A;  3CCS P;  2AFD A;  2WLV A;  2GZG A;  1EMV A;  2L9F A;  2DNW A;  1ZMB A;  4H2W C;  3CPW O;  1AYI A;  2FAD A;  1Q81 Q;  1CEI A;  3CCL P;  2QNW A;  4DGE C;  3B4Q A;  2MR7 A;  2VLP A;  1EM9 A;  2X2D D;  3NY7 B;  3CC7 P;  2LPK A;  2K94 A;  4E92 A;  1Q82 Q;  3EJE A;  5JPA A;  1E6J P;  2LIU A;  2GOL B;  1E0H A;  2GDX A;  2LOL A;  3HZQ A;  2K0X A;  1M9D C;  5HV8 A;  2KGC A;  3DS1 A;  1L0I A;  4PXH B;  2CG5 B;  2PEJ A;  1OR5 A;  2KWL A;  3BP9 A;  2JQ4 A;  2ROQ A;  1M90 Q;  4GR6 A; 
#chains in the Genus database with same CATH homology
 1VQ9 P;  3CCE P;  1VQ7 P;  1AFV A;  2GON A;  2E1M A;  2P9X A;  3CC4 P;  1L6N A;  2BHV A;  3G6E P;  4XFX A;  2JO0 A;  2KOD A;  2M8P A;  2PEI A;  1VQM P;  1EOQ A;  1VQN P;  4J93 A;  1VQ6 P;  1D1D A;  3CCU P;  1KQS O;  2EFJ A;  3G21 A;  2Z44 A;  4GR2 A;  2LF4 A;  2XT1 A;  3CXC O;  4U0B A;  4XRO A;  4U0F A;  3RG6 C;  2DGY A;  1AUM A;  1G03 A;  4COP A;  4U0C A;  3H4E A;  3DTJ A;  3B5I A;  4IPY A;  1EIA A;  3CCV P;  4HTW A;  1M9X C;  3DS2 A;  3WBH A;  1RO2 A;  1YJW P;  2OAR A;  2PEO A;  1S72 P;  1K9M Q;  2JYL A;  4U0E A;  3DS3 A;  2WLV B;  3DS5 A;  3DS0 A;  2PY8 A;  5BS2 A;  1Q86 Q;  3CME P;  2XV6 A;  1VQ4 P;  1RO0 A;  5HGL A;  2QA4 P;  1VQL P;  5HGN A;  3CCM P;  3G29 A;  1M9C C;  1M9F C;  1NJI Q;  3VRL C;  2OTJ P;  4U0A A;  3Q20 A;  3I56 P;  1VQ8 P;  4COC A;  2QEX P;  2PEQ A;  1A43 A;  3CCR P;  4B4N A;  1VQK P;  1U7K A;  4LQW C;  2KGF A;  1AK4 C;  1YJN P;  1YIJ P;  1K8A Q;  3CMA P;  5HGO A;  5F2K A;  1VQ5 P;  1M1K Q;  1VQO P;  3DS4 A;  2OTL P;  3E2D A;  2Z45 A;  2JYG A;  3G4S P;  2X82 A;  2ONT A;  1K30 A;  2PEK A;  2PEN A;  3CC2 P;  2XGY A;  2CWO A;  5F2O A;  2M8N A;  1JJ2 O;  3H0D A;  2M8L A;  4WYM A;  4PH1 A;  2L6E A;  1RNI A;  3CCS P;  3NTE A;  2XGU A;  3CCJ P;  2WLV A;  4DGA C;  3HYB A;  1P7N A;  1N8R Q;  5HGM A;  1M6E X;  1ZMB A;  3H47 A;  3G71 P;  3G0V A;  5I4T G;  3CPW O;  2XXM A;  4PH2 A;  1VQP P;  1IUQ A;  3DPH A;  1Q81 Q;  1M74 A;  3CCL P;  3G1I A;  2PWO A;  4M0I A;  4DGE C;  1KD1 Q;  1EM9 A;  4PH3 A;  3OW2 O;  2PEM A;  4XFZ A;  1GWP A;  1Q7Y Q;  2X83 A;  2JPR A;  1QVF O;  2X2D D;  3M1M A;  3CC7 P;  3G26 A;  5F2N A;  1QVG O;  4XRQ A;  4U0D A;  1BAJ A;  4PH0 A;  1YHQ P;  1YIT P;  1M6N A;  4E92 A;  1Q82 Q;  3CD6 P;  2V4X A;  2EG5 A;  5JPA A;  1E6J P;  1K73 Q;  4XFY A;  5DCK A;  3G28 A;  2GOL B;  4INB A;  4E91 A;  2PWM A;  3I55 P;  1QRJ A;  2Z46 A;  3MGE A;  1A8O A;  3HZQ A;  1M9Y C;  2Y4Z A;  4NX4 C;  1M9D C;  3DS1 A;  3G1G A;  2PEJ A;  1YI2 P;  1KC8 Q;  1W2B O;  3P05 A;  1M9E C;  3BP9 A;  3LRY A;  2PXR C;  1YJ9 P;  5BS1 A;  5HGK A;  3CCQ P;  2XGV A;  2XDE A;  1M90 Q;  2EIA A;  4GR6 A;  4QNB A;  2BUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...