3NTEA

Crystal structure of the wild-type full-length hiv-1 capsid protein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
publication title Structure of the HIV-1 full-length capsid protein in a conformationally trapped unassembled state induced by small-molecule binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 76
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3nteA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3nteA02
2WLVB 2L6EA 2GONA 3DS5A 1A43A 1M9YC 2M8NA 3G1GA 2X2DD 2JPRA 3H47A 4XFYA 2JYLA 4HTWA 1A8OA 4QNBA 2X82A 4LQWC 3MGEA 3G29A 3BP9A 5HGOA 1L6NA 2JYGA 1M9XC 2XGYA 1U7KA 4B4NA 5HGLA 4U0DA 4U0BA 1G03A 3DS3A 1E6JP 2EIAA 2Y4ZA 1P7NA 3DS1A 3G0VA 1M9EC 4PH1A 3NTEA 4WYMA 2PXRC 4PH3A 4XFXA 3P05A 2XV6A 2PWOA 4IPYA 4COCA 3DPHA 4E92A 3DS2A 2KODA 3DS0A 5HGKA 1M9FC 2XT1A 4COPA 5HGNA 2M8PA 2XXMA 2XGVA 2M8LA 4U0CA 3G26A 3LRYA 4XRQA 1AFVA 3G21A 2WLVA 5DCKA 1M9CC 2LF4A 2KGFA 3G28A 3DS4A 1GWPA 1EIAA 2JO0A 2BUOA 4M0IA 5JPAA 4PH2A 1M9DC 4U0AA 4U0EA 4NX4C 4XROA 4E91A 2XDEA 1QRJA 2XGUA 1BAJA 1AK4C 3DTJA 4DGEC 2GOLB 1EOQA 4XFZA 5I4TG 4U0FA 5HGMA 4INBA 2ONTA 2X83A 3H4EA 3G1IA 1EM9A 1AUMA 4DGAC 4PH0A 4J93A 1D1DA 2V4XA 3VRLC 2PWMA
chains in the Genus database with same CATH superfamily
1Q7YQ 2GONA 2K92A 2KORA 2X2DD 2AFEA 1KLPA 1YJWP 2JYLA 4LQWC 2KG8A 1L6NA 2VLQA 2KOOA 1U7KA 2FACA 1RO0A 2MVUA 5F2KA 1YJNP 1VQ5P 3CXCO 3DS3A 2PEIA 3OW2O 1E6JP 2DNWA 2LPKA 3DS1A 1YITP 2MR8A 4BPFA 2PNGA 4PH3A 2PWOA 1IMQA 2GZJA 1ZNVA 2L9FA 1CEIA 3DS2A 1K8AQ 3I56P 1Q82Q 2LKIA 5HVCA 2XT1A 2LOLA 1KD1Q 2M8PA 1VHNA 4U0CA 3LRYA 3CCQP 1M90Q 4XRQA 1BXIA 2GZIA 4H2YC 2FQ0A 1M9CC 1T8KA 4MRTC 2QNWA 5BS2A 2VLNA 1K73Q 3HZQA 2CNRA 2PENA 3B4QA 3EJDA 4GR6A 1VQMP 2PEQA 1M1KQ 2PEOA 2LMLA 1NQ4A 2XDEA 4H2XC 2KGCA 1QRJA 4IZ6A 3CMAP 2XZ1C 1AK4C 4DGEC 1VKUA 4HKGA 2X2BA 3GZMA 2K94A 4INBA 2OTLP 2X83A 3G1IA 1HY8A 2K0DX 2PY8A 4J93A 2OARA 1L0HA 2PEJA 2EHSA 3EJBA 2PWMA 2L6EA 3RG6C 3U43A 1YIJP 1M9YC 3Q20A 2M8NA 2N6ZA 3G1GA 2QEXP 1A8OA 2M5RA 3H0DA 2X82A 3MGEA 3G29A 5HGOA 2N6YA 2JYGA 2P9XA 4B4NA 2K0YA 4U0BA 1UNKA 1G03A 1VQ6P 2PEMA 3GJNA 2EIAA 2FQ1A 1P7NA 2DGYA 2KOPA 4WYMA 2K93A 2GDWA 4UHPB 5CZDB 2PXRC 2WPTA 2LIUA 3P05A 4IPYA 4COCA 1Z6MA 4E92A 2VLPA 3M1MA 3CMEP 3DS0A 1ACPA 1QVFO 2ROQA 5HGNA 1OR5A 2XGVA 1Q81Q 3CCEP 1ZMBA 3G21A 5F2NA 1RO2A 4QKOA 1N8RQ 2N5HA 1VQ4P 2FVAA 4PWVB 1QVGO 2OTJP 2JBGA 2K0XA 3LMOA 2CWOA 1EIAA 2KGEA 2JO0A 2JGPA 2KWLA 5F2OA 5JPAA 4PH2A 1FR2A 3CCJP 4U0AA 2GZFA 4U0EA 4NX4C 4E91A 2K5XA 1DNYA 1KQSO 4GR2A 2JU2A 2GOLB 5I4TG 1YI2P 1M6NA 5HGMA 2ONTA 3H4EA 1EM9A 1AUMA 5BS1A 1Q86Q 3CCLP 5KP8B 2WLVB 2GYKA 2LTEA 2NO8A 2JPRA 3CCRP 3H47A 4XFYA 1HQBA 2KOQA 2CGQA 4QNBA 2Z45A 1MZ8A 3CCVP 2ERHA 2BHVA 2E1MA 1M9XC 3GZLA 3E2DA 2KGDA 2FQ2A 2AVAA 2Z46A 2Y4ZA 2LL8A 3G0VA 1IUQA 4NEOA 3NTEA 2GZEA 2KOSA 3WBHA 1DV5A 2EG5A 2XV6A 3DPHA 5HV8A 4H2WC 2JQ4A 1W2BO 2LIWA 5HGKA 1M9FC 1VQOP 2CQ8A 4COPA 1GPJA 2M8LA 3EJEA 2K2QA 3G26A 1AFVA 2FVEA 1GXHA 5DCKA 3CD6P 3HYBA 3G6EP 2LF4A 2MY5A 2KGFA 5EW5E 2FHSC 3G28A 1VQ8P 2FAEA 2GDXA 1VQ7P 1GWPA 1K30A 1VQNP 1M6EX 2CG5B 2BUOA 3CCSP 2JU1A 4XROA 2JB0A 2XGUA 2FADA 5KP6B 2QA4P 4CA3A 3GKLC 1EOQA 3CCMP 4U0FA 2GDYA 3CC2P 4DGAC 2FVFA 1L0IA 2V4XA 3VRLC 1AYIA 2MR7A 2KGAA 3CE7A 1EMVA 3DS5A 1A43A 2KR5A 1K9MQ 4HTWA 2XZ0D 2N5IA 3CC7P 3BP9A 2AF8A 2XGYA 5HGLA 2L22A 4U0DA 5KP7B 3RG2A 2KW2A 4PXHB 1NJIQ 1M9EC 2GZGA 4PH1A 4BPGA 1E0HA 7CEIA 3G71P 1F80D 4XFXA 1VQ9P 2KG9A 4BPHA 2EFJA 1VQLP 2KODA 1RNIA 2XXMA 2Z44A 2KG6A 1KC8Q 4DG9A 2WLVA 5EJDA 2EHTA 1M74A 2L0QA 3DS4A 1S72P 2VSQA 2MD9A 2N50A 3CC4P 2MF4A 4M0IA 1X3OA 2L4BA 1YJ9P 3CCUP 2MVVA 1GXGA 1M9DC 3CPWO 2VLOA 4F37A 1VQKP 2AFDA 3NY7B 1BAJA 1UJZA 3DTJA 4XFZA 3G4SP 1VQPP 4R0MA 1YHQP 3B5IA 4PH0A 1JJ2O 1D1DA 1AF8A 3I55P 2JAZA 2PEKA 2N98A 1IMPA
chains in the Genus database with same CATH topology
2WLVB 2L6EA 3RG6C 1YIJP 1Q7YQ 2GONA 3DS5A 1A43A 1M9YC 3Q20A 2M8NA 3G1GA 2QEXP 2X2DD 1K9MQ 2JPRA 3CCRP 3H47A 4XFYA 1YJWP 2JYLA 4HTWA 1A8OA 3H0DA 4QNBA 2X82A 4LQWC 3MGEA 3G29A 3CC7P 3BP9A 5HGOA 2Z45A 1L6NA 3CCVP 2BHVA 2E1MA 2JYGA 2P9XA 1M9XC 2XGYA 1U7KA 4B4NA 5HGLA 1RO0A 3E2DA 5F2KA 4U0DA 4U0BA 1YJNP 1VQ5P 1G03A 3CXCO 1VQ6P 3DS3A 2PEIA 2PEMA 2Z46A 3OW2O 1E6JP 2EIAA 2Y4ZA 1P7NA 3DS1A 1NJIQ 3G0VA 1M9EC 1IUQA 2DGYA 4PH1A 1YITP 3NTEA 4WYMA 3G71P 3WBHA 2PXRC 4PH3A 4XFXA 1VQ9P 3P05A 2EG5A 2XV6A 2EFJA 2PWOA 4IPYA 4COCA 1VQLP 3DPHA 4E92A 3M1MA 3CMEP 1W2BO 3DS2A 2KODA 1K8AQ 1RNIA 3DS0A 3I56P 1Q82Q 5HGKA 1M9FC 1VQOP 2XT1A 1QVFO 1KD1Q 4COPA 5HGNA 2M8PA 2XXMA 2XGVA 2Z44A 2M8LA 4U0CA 1Q81Q 3G26A 3CCEP 3LRYA 3CCQP 1M90Q 4XRQA 1KC8Q 1AFVA 1ZMBA 3G21A 2WLVA 5DCKA 3CD6P 3HYBA 1M9CC 3G6EP 5F2NA 2LF4A 1RO2A 1N8RQ 1VQ4P 2KGFA 5BS2A 1M74A 1QVGO 3G28A 2OTJP 1K73Q 1VQ8P 3DS4A 1S72P 3HZQA 2CWOA 1VQ7P 1GWPA 1EIAA 1K30A 2PENA 2JO0A 1VQNP 1M6EX 3CC4P 2BUOA 4M0IA 4GR6A 5F2OA 5JPAA 1VQMP 4PH2A 2PEQA 3CCUP 3CCSP 1YJ9P 1M1KQ 1M9DC 2PEOA 3CPWO 3CCJP 4U0AA 1VQKP 4U0EA 4NX4C 4XROA 4E91A 2XDEA 1QRJA 2XGUA 1BAJA 3CMAP 2QA4P 1AK4C 3DTJA 4DGEC 1KQSO 4GR2A 2GOLB 1EOQA 4XFZA 5I4TG 1YI2P 3CCMP 1M6NA 4U0FA 5HGMA 3G4SP 1VQPP 4INBA 2OTLP 2ONTA 2X83A 3H4EA 3G1IA 3CC2P 1EM9A 1YHQP 1AUMA 4DGAC 4PH0A 3B5IA 2PY8A 4J93A 2OARA 1JJ2O 1D1DA 2V4XA 5BS1A 3I55P 2PEJA 1Q86Q 3CCLP 3VRLC 2PEKA 2PWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLV B;  2L6E A;  2GON A;  3DS5 A;  1A43 A;  1M9Y C;  2M8N A;  3G1G A;  2X2D D;  2JPR A;  3H47 A;  4XFY A;  2JYL A;  4HTW A;  1A8O A;  4QNB A;  2X82 A;  4LQW C;  3MGE A;  3G29 A;  3BP9 A;  5HGO A;  1L6N A;  2JYG A;  1M9X C;  2XGY A;  1U7K A;  4B4N A;  5HGL A;  4U0D A;  4U0B A;  1G03 A;  3DS3 A;  1E6J P;  2EIA A;  2Y4Z A;  1P7N A;  3DS1 A;  3G0V A;  1M9E C;  4PH1 A;  3NTE A;  4WYM A;  2PXR C;  4PH3 A;  4XFX A;  3P05 A;  2XV6 A;  2PWO A;  4IPY A;  4COC A;  3DPH A;  4E92 A;  3DS2 A;  2KOD A;  3DS0 A;  5HGK A;  1M9F C;  2XT1 A;  4COP A;  5HGN A;  2M8P A;  2XXM A;  2XGV A;  2M8L A;  4U0C A;  3G26 A;  3LRY A;  4XRQ A;  1AFV A;  3G21 A;  2WLV A;  5DCK A;  1M9C C;  2LF4 A;  2KGF A;  3G28 A;  3DS4 A;  1GWP A;  1EIA A;  2JO0 A;  2BUO A;  4M0I A;  5JPA A;  4PH2 A;  1M9D C;  4U0A A;  4U0E A;  4NX4 C;  4XRO A;  4E91 A;  2XDE A;  1QRJ A;  2XGU A;  1BAJ A;  1AK4 C;  3DTJ A;  4DGE C;  2GOL B;  1EOQ A;  4XFZ A;  5I4T G;  4U0F A;  5HGM A;  4INB A;  2ONT A;  2X83 A;  3H4E A;  3G1I A;  1EM9 A;  1AUM A;  4DGA C;  4PH0 A;  4J93 A;  1D1D A;  2V4X A;  3VRL C;  2PWM A; 
#chains in the Genus database with same CATH topology
 1Q7Y Q;  2GON A;  2K92 A;  2KOR A;  2X2D D;  2AFE A;  1KLP A;  1YJW P;  2JYL A;  4LQW C;  2KG8 A;  1L6N A;  2VLQ A;  2KOO A;  1U7K A;  2FAC A;  1RO0 A;  2MVU A;  5F2K A;  1YJN P;  1VQ5 P;  3CXC O;  3DS3 A;  2PEI A;  3OW2 O;  1E6J P;  2DNW A;  2LPK A;  3DS1 A;  1YIT P;  2MR8 A;  4BPF A;  2PNG A;  4PH3 A;  2PWO A;  1IMQ A;  2GZJ A;  1ZNV A;  2L9F A;  1CEI A;  3DS2 A;  1K8A Q;  3I56 P;  1Q82 Q;  2LKI A;  5HVC A;  2XT1 A;  2LOL A;  1KD1 Q;  2M8P A;  1VHN A;  4U0C A;  3LRY A;  3CCQ P;  1M90 Q;  4XRQ A;  1BXI A;  2GZI A;  4H2Y C;  2FQ0 A;  1M9C C;  1T8K A;  4MRT C;  2QNW A;  5BS2 A;  2VLN A;  1K73 Q;  3HZQ A;  2CNR A;  2PEN A;  3B4Q A;  3EJD A;  4GR6 A;  1VQM P;  2PEQ A;  1M1K Q;  2PEO A;  2LML A;  1NQ4 A;  2XDE A;  4H2X C;  2KGC A;  1QRJ A;  4IZ6 A;  3CMA P;  2XZ1 C;  1AK4 C;  4DGE C;  1VKU A;  4HKG A;  2X2B A;  3GZM A;  2K94 A;  4INB A;  2OTL P;  2X83 A;  3G1I A;  1HY8 A;  2K0D X;  2PY8 A;  4J93 A;  2OAR A;  1L0H A;  2PEJ A;  2EHS A;  3EJB A;  2PWM A;  2L6E A;  3RG6 C;  3U43 A;  1YIJ P;  1M9Y C;  3Q20 A;  2M8N A;  2N6Z A;  3G1G A;  2QEX P;  1A8O A;  2M5R A;  3H0D A;  2X82 A;  3MGE A;  3G29 A;  5HGO A;  2N6Y A;  2JYG A;  2P9X A;  4B4N A;  2K0Y A;  4U0B A;  1UNK A;  1G03 A;  1VQ6 P;  2PEM A;  3GJN A;  2EIA A;  2FQ1 A;  1P7N A;  2DGY A;  2KOP A;  4WYM A;  2K93 A;  2GDW A;  4UHP B;  5CZD B;  2PXR C;  2WPT A;  2LIU A;  3P05 A;  4IPY A;  4COC A;  1Z6M A;  4E92 A;  2VLP A;  3M1M A;  3CME P;  3DS0 A;  1ACP A;  1QVF O;  2ROQ A;  5HGN A;  1OR5 A;  2XGV A;  1Q81 Q;  3CCE P;  1ZMB A;  3G21 A;  5F2N A;  1RO2 A;  4QKO A;  1N8R Q;  2N5H A;  1VQ4 P;  2FVA A;  4PWV B;  1QVG O;  2OTJ P;  2JBG A;  2K0X A;  3LMO A;  2CWO A;  1EIA A;  2KGE A;  2JO0 A;  2JGP A;  2KWL A;  5F2O A;  5JPA A;  4PH2 A;  1FR2 A;  3CCJ P;  4U0A A;  2GZF A;  4U0E A;  4NX4 C;  4E91 A;  2K5X A;  1DNY A;  1KQS O;  4GR2 A;  2JU2 A;  2GOL B;  5I4T G;  1YI2 P;  1M6N A;  5HGM A;  2ONT A;  3H4E A;  1EM9 A;  1AUM A;  5BS1 A;  1Q86 Q;  3CCL P;  5KP8 B;  2WLV B;  2GYK A;  2LTE A;  2NO8 A;  2JPR A;  3CCR P;  3H47 A;  4XFY A;  1HQB A;  2KOQ A;  2CGQ A;  4QNB A;  2Z45 A;  1MZ8 A;  3CCV P;  2ERH A;  2BHV A;  2E1M A;  1M9X C;  3GZL A;  3E2D A;  2KGD A;  2FQ2 A;  2AVA A;  2Z46 A;  2Y4Z A;  2LL8 A;  3G0V A;  1IUQ A;  4NEO A;  3NTE A;  2GZE A;  2KOS A;  3WBH A;  1DV5 A;  2EG5 A;  2XV6 A;  3DPH A;  5HV8 A;  4H2W C;  2JQ4 A;  1W2B O;  2LIW A;  5HGK A;  1M9F C;  1VQO P;  2CQ8 A;  4COP A;  1GPJ A;  2M8L A;  3EJE A;  2K2Q A;  3G26 A;  1AFV A;  2FVE A;  1GXH A;  5DCK A;  3CD6 P;  3HYB A;  3G6E P;  2LF4 A;  2MY5 A;  2KGF A;  5EW5 E;  2FHS C;  3G28 A;  1VQ8 P;  2FAE A;  2GDX A;  1VQ7 P;  1GWP A;  1K30 A;  1VQN P;  1M6E X;  2CG5 B;  2BUO A;  3CCS P;  2JU1 A;  4XRO A;  2JB0 A;  2XGU A;  2FAD A;  5KP6 B;  2QA4 P;  4CA3 A;  3GKL C;  1EOQ A;  3CCM P;  4U0F A;  2GDY A;  3CC2 P;  4DGA C;  2FVF A;  1L0I A;  2V4X A;  3VRL C;  1AYI A;  2MR7 A;  2KGA A;  3CE7 A;  1EMV A;  3DS5 A;  1A43 A;  2KR5 A;  1K9M Q;  4HTW A;  2XZ0 D;  2N5I A;  3CC7 P;  3BP9 A;  2AF8 A;  2XGY A;  5HGL A;  2L22 A;  4U0D A;  5KP7 B;  3RG2 A;  2KW2 A;  4PXH B;  1NJI Q;  1M9E C;  2GZG A;  4PH1 A;  4BPG A;  1E0H A;  7CEI A;  3G71 P;  1F80 D;  4XFX A;  1VQ9 P;  2KG9 A;  4BPH A;  2EFJ A;  1VQL P;  2KOD A;  1RNI A;  2XXM A;  2Z44 A;  2KG6 A;  1KC8 Q;  4DG9 A;  2WLV A;  5EJD A;  2EHT A;  1M74 A;  2L0Q A;  3DS4 A;  1S72 P;  2VSQ A;  2MD9 A;  2N50 A;  3CC4 P;  2MF4 A;  4M0I A;  1X3O A;  2L4B A;  1YJ9 P;  3CCU P;  2MVV A;  1GXG A;  1M9D C;  3CPW O;  2VLO A;  4F37 A;  1VQK P;  2AFD A;  3NY7 B;  1BAJ A;  1UJZ A;  3DTJ A;  4XFZ A;  3G4S P;  1VQP P;  4R0M A;  1YHQ P;  3B5I A;  4PH0 A;  1JJ2 O;  1D1D A;  1AF8 A;  3I55 P;  2JAZ A;  2PEK A;  2N98 A;  1IMP A; 
#chains in the Genus database with same CATH homology
 2WLV B;  2L6E A;  3RG6 C;  1YIJ P;  1Q7Y Q;  2GON A;  3DS5 A;  1A43 A;  1M9Y C;  3Q20 A;  2M8N A;  3G1G A;  2QEX P;  2X2D D;  1K9M Q;  2JPR A;  3CCR P;  3H47 A;  4XFY A;  1YJW P;  2JYL A;  4HTW A;  1A8O A;  3H0D A;  4QNB A;  2X82 A;  4LQW C;  3MGE A;  3G29 A;  3CC7 P;  3BP9 A;  5HGO A;  2Z45 A;  1L6N A;  3CCV P;  2BHV A;  2E1M A;  2JYG A;  2P9X A;  1M9X C;  2XGY A;  1U7K A;  4B4N A;  5HGL A;  1RO0 A;  3E2D A;  5F2K A;  4U0D A;  4U0B A;  1YJN P;  1VQ5 P;  1G03 A;  3CXC O;  1VQ6 P;  3DS3 A;  2PEI A;  2PEM A;  2Z46 A;  3OW2 O;  1E6J P;  2EIA A;  2Y4Z A;  1P7N A;  3DS1 A;  1NJI Q;  3G0V A;  1M9E C;  1IUQ A;  2DGY A;  4PH1 A;  1YIT P;  3NTE A;  4WYM A;  3G71 P;  3WBH A;  2PXR C;  4PH3 A;  4XFX A;  1VQ9 P;  3P05 A;  2EG5 A;  2XV6 A;  2EFJ A;  2PWO A;  4IPY A;  4COC A;  1VQL P;  3DPH A;  4E92 A;  3M1M A;  3CME P;  1W2B O;  3DS2 A;  2KOD A;  1K8A Q;  1RNI A;  3DS0 A;  3I56 P;  1Q82 Q;  5HGK A;  1M9F C;  1VQO P;  2XT1 A;  1QVF O;  1KD1 Q;  4COP A;  5HGN A;  2M8P A;  2XXM A;  2XGV A;  2Z44 A;  2M8L A;  4U0C A;  1Q81 Q;  3G26 A;  3CCE P;  3LRY A;  3CCQ P;  1M90 Q;  4XRQ A;  1KC8 Q;  1AFV A;  1ZMB A;  3G21 A;  2WLV A;  5DCK A;  3CD6 P;  3HYB A;  1M9C C;  3G6E P;  5F2N A;  2LF4 A;  1RO2 A;  1N8R Q;  1VQ4 P;  2KGF A;  5BS2 A;  1M74 A;  1QVG O;  3G28 A;  2OTJ P;  1K73 Q;  1VQ8 P;  3DS4 A;  1S72 P;  3HZQ A;  2CWO A;  1VQ7 P;  1GWP A;  1EIA A;  1K30 A;  2PEN A;  2JO0 A;  1VQN P;  1M6E X;  3CC4 P;  2BUO A;  4M0I A;  4GR6 A;  5F2O A;  5JPA A;  1VQM P;  4PH2 A;  2PEQ A;  3CCU P;  3CCS P;  1YJ9 P;  1M1K Q;  1M9D C;  2PEO A;  3CPW O;  3CCJ P;  4U0A A;  1VQK P;  4U0E A;  4NX4 C;  4XRO A;  4E91 A;  2XDE A;  1QRJ A;  2XGU A;  1BAJ A;  3CMA P;  2QA4 P;  1AK4 C;  3DTJ A;  4DGE C;  1KQS O;  4GR2 A;  2GOL B;  1EOQ A;  4XFZ A;  5I4T G;  1YI2 P;  3CCM P;  1M6N A;  4U0F A;  5HGM A;  3G4S P;  1VQP P;  4INB A;  2OTL P;  2ONT A;  2X83 A;  3H4E A;  3G1I A;  3CC2 P;  1EM9 A;  1YHQ P;  1AUM A;  4DGA C;  4PH0 A;  3B5I A;  2PY8 A;  4J93 A;  2OAR A;  1JJ2 O;  1D1D A;  2V4X A;  5BS1 A;  3I55 P;  2PEJ A;  1Q86 Q;  3CCL P;  3VRL C;  2PEK A;  2PWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...