3NTEA

Crystal structure of the wild-type full-length hiv-1 capsid protein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
b'PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 capsid protein
publication title Structure of the HIV-1 full-length capsid protein in a conformationally trapped unassembled state induced by small-molecule binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 76
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3nteA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3nteA02
2XGVA 2XGYA 3DS3A 4B4NA 2EIAA 4XFYA 4WYMA 1M9YC 4XFZA 5I4TG 5HGNA 2PWMA 3MGEA 4E92A 3DS1A 3G1GA 4PH2A 2BUOA 4IPYA 4PH1A 4J93A 4U0AA 2XDEA 3G29A 2M8NA 2PXRC 2L6EA 4U0EA 3DPHA 2ONTA 3H47A 1A8OA 2JYLA 3G1IA 3LRYA 1EM9A 1AK4C 1M9FC 5HGMA 1M9XC 4NX4C 3BP9A 2X82A 5JPAA 2WLVA 3P05A 2V4XA 3DTJA 4DGAC 2XGUA 1U7KA 4PH0A 1E6JP 2KGFA 4QNBA 2GOLB 2M8LA 3G0VA 2LF4A 3G26A 4U0FA 2JO0A 1EIAA 4XRQA 1QRJA 3H4EA 4COCA 3G28A 3VRLC 1L6NA 1EOQA 1M9EC 1BAJA 5HGLA 2M8PA 4U0CA 2KODA 4E91A 4U0BA 3DS5A 1AUMA 2GONA 2XT1A 3DS4A 4LQWC 5HGKA 4PH3A 5HGOA 2WLVB 4HTWA 2Y4ZA 2X2DD 4COPA 2XV6A 3DS0A 1M9CC 3G21A 3DS2A 4M0IA 2X83A 3NTEA 4XFXA 2PWOA 1AFVA 1P7NA 4DGEC 1D1DA 1G03A 1M9DC 2JPRA 4U0DA 1A43A 1GWPA 4INBA 5DCKA 2XXMA 2JYGA 4XROA
chains in the Genus database with same CATH superfamily
2XGVA 1ZMBA 4B4NA 2Z45A 1S72P 2BUOA 5HVCA 4U0AA 2M8NA 2KOOA 1VQ4P 3RG2A 2L6EA 2FQ0A 1M6EX 2KOSA 1HY8A 2AFDA 3LRYA 4GR2A 2LKIA 4DG9A 1M9FC 4NX4C 1E0HA 3B5IA 5KP8B 2Z46A 2X82A 1L0HA 2WLVA 3P05A 1NJIQ 3DTJA 4DGAC 2LIUA 2FQ2A 1KLPA 2N98A 2P9XA 1M90Q 2FQ1A 4QNBA 2JBGA 3G0VA 3CCVP 1EIAA 2L22A 1VQ5P 3H4EA 4F37A 1VQLP 1Q86Q 2OTJP 2JGPA 2GDWA 2MVVA 3VRLC 2VSQA 1BAJA 1Q81Q 2QEXP 1KD1Q 3CCUP 2FVEA 2L0QA 3DS5A 2QNWA 2EG5A 3GKLC 4PH3A 5HGOA 3CXCO 2MR7A 4COPA 1CEIA 3DS0A 5EJDA 1M74A 1IMQA 3EJEA 3CMAP 3B4QA 2PWOA 1P7NA 1D1DA 2CNRA 2JPRA 5BS1A 2EHTA 3E2DA 4U0DA 4IZ6A 1VQ6P 3GZLA 5BS2A 2XGYA 2N6YA 4XFYA 4WYMA 2K5XA 4XFZA 5I4TG 5HGNA 2PWMA 3G1GA 1Q82Q 2JU2A 2KGAA 2LOLA 2E1MA 4PXHB 2KGEA 3G29A 2PXRC 4BPFA 1MZ8A 1K8AQ 2MF4A 2PENA 2NO8A 1YI2P 2VLQA 3DPHA 3CCMP 1F80D 3H47A 1JJ2O 4CA3A 2K0DX 1A8OA 3G1IA 1EM9A 1IMPA 1YHQP 2K0XA 2PNGA 4QKOA 3CD6P 3BP9A 2K0YA 3HZQA 5JPAA 2PEJA 1RO2A 4H2XC 2PEMA 1GPJA 4PH0A 3CCQP 1VQNP 2FVFA 4HKGA 2M8LA 3CCEP 2FAEA 1M6NA 3CMEP 4BPHA 3CCJP 3M1MA 4BPGA 2KOQA 1VQ9P 2XZ1C 2JU1A 1M1KQ 2FADA 2LPKA 4H2WC 1L6NA 2KG9A 2KG8A 2GZGA 5HV8A 4R0MA 2MR8A 2GONA 2XT1A 2Z44A 5F2KA 4HTWA 1K73Q 1N8RQ 2X2DD 5CZDB 1YITP 2WPTA 1FR2A 3WBHA 1DNYA 3CCLP 2PEKA 1T8KA 4PWVB 2X83A 1VQKP 1AF8A 2DGYA 2KR5A 3RG6C 1M9DC 2DNWA 2OARA 1GXGA 3DS3A 2FACA 1VHNA 2KOPA 1M9YC 2BHVA 1KC8Q 1YJNP 2KGCA 2GZFA 1IUQA 2VLOA 4PH2A 4IPYA 1DV5A 2CG5B 4J93A 2K94A 3I55P 1Q7YQ 2QA4P 1W2BO 2LL8A 1K30A 4U0EA 1UNKA 1QVGO 3EJDA 2ONTA 5F2NA 2JYLA 2GDXA 2N5HA 1AK4C 5HGMA 1AYIA 1VKUA 2MY5A 2XGUA 2JB0A 2GZJA 1U7KA 2VLNA 2KGFA 2GOLB 1VQMP 2N6ZA 1YJ9P 3HYBA 4H2YC 2JQ4A 2PEQA 3G26A 4U0FA 2JO0A 2L9FA 4XRQA 1QRJA 1YJWP 2K92A 2FVAA 1QVFO 5HGLA 2L4BA 2M8PA 4U0CA 2KODA 4E91A 2N50A 3GJNA 3LMOA 4LQWC 5HGKA 3CCRP 2PY8A 2WLVB 1K9MQ 3CPWO 1M9CC 2K93A 5EW5E 4M0IA 3G6EP 2KWLA 4GR6A 4XFXA 1AFVA 4DGEC 2KG6A 1G03A 1VQ8P 1X3OA 2EHSA 2AFEA 1A43A 7CEIA 1GWPA 1BXIA 2OTLP 2XXMA 2KORA 5F2OA 2EIAA 2GZEA 3MGEA 4E92A 3DS1A 4PH1A 2CQ8A 2CGQA 1NQ4A 2AF8A 3CC4P 2XDEA 1RO0A 1UJZA 2KGDA 2AVAA 3CC2P 3U43A 3H0DA 3GZMA 3OW2O 2FHSC 3G4SP 1VQPP 4NEOA 1VQOP 2MD9A 3CC7P 1M9XC 2LIWA 5KP6B 2N5IA 3EJBA 2V4XA 2GZIA 1ACPA 4MRTC 2GDYA 2PEIA 2MVUA 2CWOA 1E6JP 1VQ7P 3I56P 2LF4A 1EMVA 1KQSO 2GYKA 1YIJP 1ZNVA 2KW2A 2LMLA 4COCA 1GXHA 3G28A 2PEOA 1EOQA 1M9EC 2JAZA 2X2BA 2XZ0D 3G71P 4U0BA 1RNIA 3Q20A 1AUMA 2ERHA 3CCSP 3DS4A 4UHPB 1HQBA 2Y4ZA 2XV6A 2K2QA 3CE7A 3G21A 3DS2A 3NY7B 3NTEA 1L0IA 2EFJA 2VLPA 1OR5A 2LTEA 5KP7B 4INBA 5DCKA 2ROQA 1Z6MA 2M5RA 2JYGA 4XROA
chains in the Genus database with same CATH topology
2XGVA 2XGYA 1ZMBA 5F2OA 3DS3A 4B4NA 2EIAA 4XFYA 2Z45A 4WYMA 1S72P 1M9YC 2BHVA 4XFZA 5I4TG 1YJNP 5HGNA 2PWMA 1KC8Q 3MGEA 4E92A 1IUQA 3DS1A 3G1GA 4PH2A 2BUOA 4IPYA 1Q82Q 4PH1A 4J93A 2E1MA 3I55P 1Q7YQ 4U0AA 2QA4P 1W2BO 3CC4P 2XDEA 1RO0A 2M8NA 2PXRC 3G29A 1VQ4P 1K30A 2L6EA 1K8AQ 3CC2P 2PENA 4U0EA 1QVGO 1YI2P 3H0DA 1M6EX 3DPHA 3CCMP 3OW2O 2ONTA 5F2NA 3H47A 3G4SP 1JJ2O 1VQPP 1A8OA 2JYLA 3G1IA 3LRYA 4GR2A 1VQOP 1EM9A 1AK4C 1YHQP 3CC7P 1M9FC 5HGMA 1M9XC 4NX4C 3CD6P 3BP9A 3B5IA 2Z46A 2X82A 3HZQA 5JPAA 2WLVA 3P05A 2PEJA 2V4XA 1RO2A 3DTJA 1NJIQ 4DGAC 2PEMA 2XGUA 1U7KA 4PH0A 2PEIA 2CWOA 2P9XA 3CCQP 1E6JP 1M90Q 2KGFA 1VQ7P 4QNBA 3I56P 1VQNP 2GOLB 1VQMP 2M8LA 3CCEP 1YJ9P 3CMEP 1M6NA 2LF4A 3G0VA 3HYBA 3CCVP 2PEQA 3G26A 4U0FA 2JO0A 3CCJP 1KQSO 3M1MA 1EIAA 1YIJP 1VQ5P 4XRQA 1QRJA 3H4EA 1VQLP 4COCA 1Q86Q 2OTJP 1YJWP 1VQ9P 3G28A 1M1KQ 2PEOA 3VRLC 1L6NA 1EOQA 1M9EC 1QVFO 1BAJA 5HGLA 2QEXP 1Q81Q 1KD1Q 2M8PA 4U0CA 2KODA 3CCUP 4E91A 3G71P 4U0BA 1RNIA 3DS5A 3Q20A 1AUMA 2GONA 2XT1A 3CCSP 2EG5A 3DS4A 4LQWC 5HGKA 4PH3A 2Z44A 2PY8A 5HGOA 2WLVB 4HTWA 5F2KA 3CXCO 3CCRP 1K73Q 2Y4ZA 2X2DD 4COPA 1N8RQ 1K9MQ 2XV6A 3CPWO 1YITP 3DS0A 1M9CC 1M74A 3WBHA 3G21A 3DS2A 4M0IA 3CMAP 3CCLP 3G6EP 2PEKA 4GR6A 2X83A 1VQKP 3NTEA 4XFXA 2DGYA 2EFJA 2PWOA 1AFVA 1P7NA 4DGEC 1D1DA 3RG6C 1G03A 1M9DC 1VQ8P 2JPRA 5BS1A 3E2DA 4U0DA 1A43A 1GWPA 4INBA 2OARA 5DCKA 1VQ6P 2OTLP 5BS2A 2XXMA 2JYGA 4XROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGV A;  2XGY A;  3DS3 A;  4B4N A;  2EIA A;  4XFY A;  4WYM A;  1M9Y C;  4XFZ A;  5I4T G;  5HGN A;  2PWM A;  3MGE A;  4E92 A;  3DS1 A;  3G1G A;  4PH2 A;  2BUO A;  4IPY A;  4PH1 A;  4J93 A;  4U0A A;  2XDE A;  3G29 A;  2M8N A;  2PXR C;  2L6E A;  4U0E A;  3DPH A;  2ONT A;  3H47 A;  1A8O A;  2JYL A;  3G1I A;  3LRY A;  1EM9 A;  1AK4 C;  1M9F C;  5HGM A;  1M9X C;  4NX4 C;  3BP9 A;  2X82 A;  5JPA A;  2WLV A;  3P05 A;  2V4X A;  3DTJ A;  4DGA C;  2XGU A;  1U7K A;  4PH0 A;  1E6J P;  2KGF A;  4QNB A;  2GOL B;  2M8L A;  3G0V A;  2LF4 A;  3G26 A;  4U0F A;  2JO0 A;  1EIA A;  4XRQ A;  1QRJ A;  3H4E A;  4COC A;  3G28 A;  3VRL C;  1L6N A;  1EOQ A;  1M9E C;  1BAJ A;  5HGL A;  2M8P A;  4U0C A;  2KOD A;  4E91 A;  4U0B A;  3DS5 A;  1AUM A;  2GON A;  2XT1 A;  3DS4 A;  4LQW C;  5HGK A;  4PH3 A;  5HGO A;  2WLV B;  4HTW A;  2Y4Z A;  2X2D D;  4COP A;  2XV6 A;  3DS0 A;  1M9C C;  3G21 A;  3DS2 A;  4M0I A;  2X83 A;  3NTE A;  4XFX A;  2PWO A;  1AFV A;  1P7N A;  4DGE C;  1D1D A;  1G03 A;  1M9D C;  2JPR A;  4U0D A;  1A43 A;  1GWP A;  4INB A;  5DCK A;  2XXM A;  2JYG A;  4XRO A; 
#chains in the Genus database with same CATH topology
 2XGV A;  1ZMB A;  4B4N A;  2Z45 A;  1S72 P;  2BUO A;  5HVC A;  4U0A A;  2M8N A;  2KOO A;  1VQ4 P;  3RG2 A;  2L6E A;  2FQ0 A;  1M6E X;  2KOS A;  1HY8 A;  2AFD A;  3LRY A;  4GR2 A;  2LKI A;  4DG9 A;  1M9F C;  4NX4 C;  1E0H A;  3B5I A;  5KP8 B;  2Z46 A;  2X82 A;  1L0H A;  2WLV A;  3P05 A;  1NJI Q;  3DTJ A;  4DGA C;  2LIU A;  2FQ2 A;  1KLP A;  2N98 A;  2P9X A;  1M90 Q;  2FQ1 A;  4QNB A;  2JBG A;  3G0V A;  3CCV P;  1EIA A;  2L22 A;  1VQ5 P;  3H4E A;  4F37 A;  1VQL P;  1Q86 Q;  2OTJ P;  2JGP A;  2GDW A;  2MVV A;  3VRL C;  2VSQ A;  1BAJ A;  1Q81 Q;  2QEX P;  1KD1 Q;  3CCU P;  2FVE A;  2L0Q A;  3DS5 A;  2QNW A;  2EG5 A;  3GKL C;  4PH3 A;  5HGO A;  3CXC O;  2MR7 A;  4COP A;  1CEI A;  3DS0 A;  5EJD A;  1M74 A;  1IMQ A;  3EJE A;  3CMA P;  3B4Q A;  2PWO A;  1P7N A;  1D1D A;  2CNR A;  2JPR A;  5BS1 A;  2EHT A;  3E2D A;  4U0D A;  4IZ6 A;  1VQ6 P;  3GZL A;  5BS2 A;  2XGY A;  2N6Y A;  4XFY A;  4WYM A;  2K5X A;  4XFZ A;  5I4T G;  5HGN A;  2PWM A;  3G1G A;  1Q82 Q;  2JU2 A;  2KGA A;  2LOL A;  2E1M A;  4PXH B;  2KGE A;  3G29 A;  2PXR C;  4BPF A;  1MZ8 A;  1K8A Q;  2MF4 A;  2PEN A;  2NO8 A;  1YI2 P;  2VLQ A;  3DPH A;  3CCM P;  1F80 D;  3H47 A;  1JJ2 O;  4CA3 A;  2K0D X;  1A8O A;  3G1I A;  1EM9 A;  1IMP A;  1YHQ P;  2K0X A;  2PNG A;  4QKO A;  3CD6 P;  3BP9 A;  2K0Y A;  3HZQ A;  5JPA A;  2PEJ A;  1RO2 A;  4H2X C;  2PEM A;  1GPJ A;  4PH0 A;  3CCQ P;  1VQN P;  2FVF A;  4HKG A;  2M8L A;  3CCE P;  2FAE A;  1M6N A;  3CME P;  4BPH A;  3CCJ P;  3M1M A;  4BPG A;  2KOQ A;  1VQ9 P;  2XZ1 C;  2JU1 A;  1M1K Q;  2FAD A;  2LPK A;  4H2W C;  1L6N A;  2KG9 A;  2KG8 A;  2GZG A;  5HV8 A;  4R0M A;  2MR8 A;  2GON A;  2XT1 A;  2Z44 A;  5F2K A;  4HTW A;  1K73 Q;  1N8R Q;  2X2D D;  5CZD B;  1YIT P;  2WPT A;  1FR2 A;  3WBH A;  1DNY A;  3CCL P;  2PEK A;  1T8K A;  4PWV B;  2X83 A;  1VQK P;  1AF8 A;  2DGY A;  2KR5 A;  3RG6 C;  1M9D C;  2DNW A;  2OAR A;  1GXG A;  3DS3 A;  2FAC A;  1VHN A;  2KOP A;  1M9Y C;  2BHV A;  1KC8 Q;  1YJN P;  2KGC A;  2GZF A;  1IUQ A;  2VLO A;  4PH2 A;  4IPY A;  1DV5 A;  2CG5 B;  4J93 A;  2K94 A;  3I55 P;  1Q7Y Q;  2QA4 P;  1W2B O;  2LL8 A;  1K30 A;  4U0E A;  1UNK A;  1QVG O;  3EJD A;  2ONT A;  5F2N A;  2JYL A;  2GDX A;  2N5H A;  1AK4 C;  5HGM A;  1AYI A;  1VKU A;  2MY5 A;  2XGU A;  2JB0 A;  2GZJ A;  1U7K A;  2VLN A;  2KGF A;  2GOL B;  1VQM P;  2N6Z A;  1YJ9 P;  3HYB A;  4H2Y C;  2JQ4 A;  2PEQ A;  3G26 A;  4U0F A;  2JO0 A;  2L9F A;  4XRQ A;  1QRJ A;  1YJW P;  2K92 A;  2FVA A;  1QVF O;  5HGL A;  2L4B A;  2M8P A;  4U0C A;  2KOD A;  4E91 A;  2N50 A;  3GJN A;  3LMO A;  4LQW C;  5HGK A;  3CCR P;  2PY8 A;  2WLV B;  1K9M Q;  3CPW O;  1M9C C;  2K93 A;  5EW5 E;  4M0I A;  3G6E P;  2KWL A;  4GR6 A;  4XFX A;  1AFV A;  4DGE C;  2KG6 A;  1G03 A;  1VQ8 P;  1X3O A;  2EHS A;  2AFE A;  1A43 A;  7CEI A;  1GWP A;  1BXI A;  2OTL P;  2XXM A;  2KOR A;  5F2O A;  2EIA A;  2GZE A;  3MGE A;  4E92 A;  3DS1 A;  4PH1 A;  2CQ8 A;  2CGQ A;  1NQ4 A;  2AF8 A;  3CC4 P;  2XDE A;  1RO0 A;  1UJZ A;  2KGD A;  2AVA A;  3CC2 P;  3U43 A;  3H0D A;  3GZM A;  3OW2 O;  2FHS C;  3G4S P;  1VQP P;  4NEO A;  1VQO P;  2MD9 A;  3CC7 P;  1M9X C;  2LIW A;  5KP6 B;  2N5I A;  3EJB A;  2V4X A;  2GZI A;  1ACP A;  4MRT C;  2GDY A;  2PEI A;  2MVU A;  2CWO A;  1E6J P;  1VQ7 P;  3I56 P;  2LF4 A;  1EMV A;  1KQS O;  2GYK A;  1YIJ P;  1ZNV A;  2KW2 A;  2LML A;  4COC A;  1GXH A;  3G28 A;  2PEO A;  1EOQ A;  1M9E C;  2JAZ A;  2X2B A;  2XZ0 D;  3G71 P;  4U0B A;  1RNI A;  3Q20 A;  1AUM A;  2ERH A;  3CCS P;  3DS4 A;  4UHP B;  1HQB A;  2Y4Z A;  2XV6 A;  2K2Q A;  3CE7 A;  3G21 A;  3DS2 A;  3NY7 B;  3NTE A;  1L0I A;  2EFJ A;  2VLP A;  1OR5 A;  2LTE A;  5KP7 B;  4INB A;  5DCK A;  2ROQ A;  1Z6M A;  2M5R A;  2JYG A;  4XRO A; 
#chains in the Genus database with same CATH homology
 2XGV A;  2XGY A;  1ZMB A;  5F2O A;  3DS3 A;  4B4N A;  2EIA A;  4XFY A;  2Z45 A;  4WYM A;  1S72 P;  1M9Y C;  2BHV A;  4XFZ A;  5I4T G;  1YJN P;  5HGN A;  2PWM A;  1KC8 Q;  3MGE A;  4E92 A;  1IUQ A;  3DS1 A;  3G1G A;  4PH2 A;  2BUO A;  4IPY A;  1Q82 Q;  4PH1 A;  4J93 A;  2E1M A;  3I55 P;  1Q7Y Q;  4U0A A;  2QA4 P;  1W2B O;  3CC4 P;  2XDE A;  1RO0 A;  2M8N A;  2PXR C;  3G29 A;  1VQ4 P;  1K30 A;  2L6E A;  1K8A Q;  3CC2 P;  2PEN A;  4U0E A;  1QVG O;  1YI2 P;  3H0D A;  1M6E X;  3DPH A;  3CCM P;  3OW2 O;  2ONT A;  5F2N A;  3H47 A;  3G4S P;  1JJ2 O;  1VQP P;  1A8O A;  2JYL A;  3G1I A;  3LRY A;  4GR2 A;  1VQO P;  1EM9 A;  1AK4 C;  1YHQ P;  3CC7 P;  1M9F C;  5HGM A;  1M9X C;  4NX4 C;  3CD6 P;  3BP9 A;  3B5I A;  2Z46 A;  2X82 A;  3HZQ A;  5JPA A;  2WLV A;  3P05 A;  2PEJ A;  2V4X A;  1RO2 A;  3DTJ A;  1NJI Q;  4DGA C;  2PEM A;  2XGU A;  1U7K A;  4PH0 A;  2PEI A;  2CWO A;  2P9X A;  3CCQ P;  1E6J P;  1M90 Q;  2KGF A;  1VQ7 P;  4QNB A;  3I56 P;  1VQN P;  2GOL B;  1VQM P;  2M8L A;  3CCE P;  1YJ9 P;  3CME P;  1M6N A;  2LF4 A;  3G0V A;  3HYB A;  3CCV P;  2PEQ A;  3G26 A;  4U0F A;  2JO0 A;  3CCJ P;  1KQS O;  3M1M A;  1EIA A;  1YIJ P;  1VQ5 P;  4XRQ A;  1QRJ A;  3H4E A;  1VQL P;  4COC A;  1Q86 Q;  2OTJ P;  1YJW P;  1VQ9 P;  3G28 A;  1M1K Q;  2PEO A;  3VRL C;  1L6N A;  1EOQ A;  1M9E C;  1QVF O;  1BAJ A;  5HGL A;  2QEX P;  1Q81 Q;  1KD1 Q;  2M8P A;  4U0C A;  2KOD A;  3CCU P;  4E91 A;  3G71 P;  4U0B A;  1RNI A;  3DS5 A;  3Q20 A;  1AUM A;  2GON A;  2XT1 A;  3CCS P;  2EG5 A;  3DS4 A;  4LQW C;  5HGK A;  4PH3 A;  2Z44 A;  2PY8 A;  5HGO A;  2WLV B;  4HTW A;  5F2K A;  3CXC O;  3CCR P;  1K73 Q;  2Y4Z A;  2X2D D;  4COP A;  1N8R Q;  1K9M Q;  2XV6 A;  3CPW O;  1YIT P;  3DS0 A;  1M9C C;  1M74 A;  3WBH A;  3G21 A;  3DS2 A;  4M0I A;  3CMA P;  3CCL P;  3G6E P;  2PEK A;  4GR6 A;  2X83 A;  1VQK P;  3NTE A;  4XFX A;  2DGY A;  2EFJ A;  2PWO A;  1AFV A;  1P7N A;  4DGE C;  1D1D A;  3RG6 C;  1G03 A;  1M9D C;  1VQ8 P;  2JPR A;  5BS1 A;  3E2D A;  4U0D A;  1A43 A;  1GWP A;  4INB A;  2OAR A;  5DCK A;  1VQ6 P;  2OTL P;  5BS2 A;  2XXM A;  2JYG A;  4XRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...