3NTEA

Crystal structure of the wild-type full-length hiv-1 capsid protein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HIV-1 capsid protein
publication title Structure of the HIV-1 full-length capsid protein in a conformationally trapped unassembled state induced by small-molecule binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 76
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3nteA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3nteA02
1EM9A 2X83A 3DS3A 3G1IA 2M8PA 4U0FA 3G26A 3H4EA 2LF4A 2JYLA 3G21A 2L6EA 2JPRA 4IPYA 2PXRC 4DGAC 4PH0A 1AK4C 5DCKA 3P05A 3G28A 4COPA 2KGFA 4U0EA 1QRJA 4PH1A 4XROA 3NTEA 4QNBA 4U0AA 3DPHA 2JO0A 2PWOA 5HGMA 1M9YC 1G03A 1A43A 4U0CA 2XGVA 2ONTA 4U0BA 4XFXA 4E91A 4DGEC 2GOLB 4XFZA 3MGEA 1M9DC 1E6JP 2Y4ZA 3G1GA 3DS4A 4XRQA 4M0IA 2BUOA 4COCA 1EOQA 3DTJA 1M9EC 5HGOA 1EIAA 2JYGA 2XT1A 1AUMA 1M9XC 2PWMA 2GONA 1GWPA 4PH3A 1M9CC 2XXMA 2XGUA 2XV6A 3H47A 2M8NA 1A8OA 3DS1A 4E92A 4NX4C 4INBA 1U7KA 4PH2A 4XFYA 2KODA 2X82A 2XDEA 1AFVA 4WYMA 2EIAA 2V4XA 2WLVB 5HGKA 3G29A 4U0DA 2X2DD 2M8LA 1L6NA 3DS2A 3DS0A 3G0VA 3LRYA 4HTWA 5JPAA 1D1DA 1P7NA 5I4TG 3VRLC 5HGNA 3BP9A 2WLVA 4J93A 4LQWC 2XGYA 3DS5A 1M9FC 1BAJA 4B4NA 5HGLA
chains in the Genus database with same CATH superfamily
2DGYA 3G1IA 3U43A 2EG5A 2M8PA 1IMPA 1YIJP 4BPFA 2PEQA 2JPRA 4IPYA 1QVFO 4DGAC 3WBHA 4PH0A 1YHQP 1ZNVA 2N6ZA 1AK4C 2E1MA 2K0YA 2Z46A 1K73Q 2MY5A 4HKGA 2XZ0D 1VQ4P 2KOOA 5KP7B 5HGMA 3CCQP 2GZIA 2DNWA 3EJDA 1HY8A 1A43A 1E0HA 4DG9A 3CXCO 4XFXA 4E91A 3GKLC 1YJ9P 2Y4ZA 1VQ7P 1T8KA 2KGDA 2FHSC 2QA4P 2FACA 2K2QA 1ACPA 4COCA 3DTJA 5HGOA 3CMEP 1AUMA 1GWPA 1Z6MA 2PEIA 1Q82Q 1M9CC 3HYBA 2PENA 2M8NA 3CD6P 1YITP 1Q81Q 3RG6C 2LTEA 2X82A 1VQ8P 2K94A 2N50A 1KQSO 3NY7B 1DV5A 2GZJA 2WLVB 1RO2A 1K9MQ 2M8LA 2JAZA 3DS0A 3CCJP 4CA3A 3OW2O 1KLPA 2K0XA 3G0VA 3LRYA 3CCMP 4HTWA 3I55P 2PEJA 4LQWC 1VQMP 2JQ4A 1BAJA 2MVVA 2FQ1A 1EM9A 3RG2A 2VSQA 2FVAA 2GZGA 1Q7YQ 1YJWP 4GR6A 4H2XC 1VQKP 3G26A 1VQ6P 3H0DA 2NO8A 1ZMBA 2MVUA 2VLNA 2GYKA 1VQPP 5EJDA 5DCKA 1YI2P 2PNGA 3CC2P 3B4QA 2AVAA 2KG8A 4PH1A 2LKIA 4U0AA 2PWOA 2BHVA 1CEIA 2ROQA 5HVCA 5HV8A 2WPTA 2ONTA 2Z45A 1IUQA 2MR7A 3MGEA 1M9DC 1E6JP 1KC8Q 3GZLA 4M0IA 2CWOA 2FVFA 1M9EC 1JJ2O 2PY8A 1VQ5P 1W2BO 1M9XC 1K30A 2KR5A 4PH3A 2XXMA 2XGUA 2XV6A 3H47A 2EHSA 1GXHA 1NJIQ 3CC7P 2GDXA 4INBA 2KODA 2XDEA 1YJNP 1L0HA 4WYMA 2X2BA 2EIAA 4U0DA 2VLPA 3DS2A 5JPAA 1VHNA 1P7NA 5I4TG 2CNRA 1M1KQ 5BS2A 2WLVA 2AFEA 4H2YC 1M6EX 4PXHB 3G71P 2OTLP 1KD1Q 1FR2A 4MRTC 1X3OA 3E2DA 2X83A 3DS3A 3CCEP 4U0FA 2L0QA 3H4EA 2LF4A 2KGAA 2LIUA 2JYLA 3G21A 2L6EA 2LOLA 3Q20A 1M6NA 1M90Q 1L0IA 3P05A 2L4BA 5BS1A 1AF8A 2KGFA 2FVEA 3CCLP 1QRJA 2N6YA 4XROA 2FQ0A 3LMOA 1M9YC 2AF8A 1G03A 4R0MA 2EFJA 4U0CA 1NQ4A 2MF4A 7CEIA 2GOLB 2JBGA 2L9FA 4XRQA 4NEOA 4QKOA 2FAEA 2BUOA 1EOQA 1GXGA 1EIAA 2JYGA 1Q86Q 2FADA 2L22A 2GDWA 3G4SP 1K8AQ 2PWMA 1M74A 3B5IA 2N98A 2QEXP 3I56P 3CMAP 1IMQA 1EMVA 4NX4C 2Z44A 4PH2A 1GPJA 5F2NA 2KGEA 2LMLA 2V4XA 2MD9A 4H2WC 5EW5E 3G6EP 2PEKA 2K5XA 2JU2A 2XZ1C 2ERHA 1D1DA 2JB0A 5HGNA 3BP9A 2KOPA 2XGYA 2KOQA 3DS5A 1M9FC 2QNWA 2CQ8A 2FQ2A 2KGCA 2EHTA 2K93A 3EJEA 3HZQA 4PWVB 3CCRP 2JU1A 2OARA 3CCVP 2PXRC 2N5IA 4BPGA 3G28A 4COPA 4U0EA 5CZDB 3NTEA 1RO0A 4QNBA 3DPHA 2JO0A 3CCUP 4F37A 2CG5B 2N5HA 2KORA 2XGVA 4U0BA 2MR8A 4DGEC 5KP6B 3CE7A 4XFZA 1VQOP 1VQ9P 2LPKA 4IZ6A 3G1GA 2PEMA 3DS4A 3CC4P 4UHPB 1MZ8A 1OR5A 2KG9A 2P9XA 2PEOA 2XT1A 2GONA 2CGQA 2VLOA 1DNYA 5F2KA 1AYIA 1A8OA 1VQNP 3DS1A 4E92A 1HQBA 4BPHA 1N8RQ 2M5RA 1UJZA 1U7KA 4XFYA 3EJBA 2JGPA 1S72P 2LL8A 1AFVA 1VQLP 2GZEA 3GJNA 2AFDA 3GZMA 5HGKA 2VLQA 3G29A 1VKUA 2KOSA 2X2DD 3M1MA 1L6NA 1BXIA 2OTJP 2K0DX 2GDYA 2KW2A 5F2OA 1RNIA 2K92A 2KG6A 3VRLC 1F80D 4GR2A 2LIWA 4J93A 3CPWO 5KP8B 3CCSP 1UNKA 1QVGO 2KWLA 2GZFA 4B4NA 5HGLA
chains in the Genus database with same CATH topology
1EM9A 3E2DA 2X83A 2DGYA 3DS3A 3G1IA 3CCEP 2EG5A 2M8PA 1Q7YQ 1YJWP 4GR6A 4U0FA 1Q82Q 3G26A 1VQKP 3H4EA 3HZQA 2LF4A 1YIJP 3CCRP 1VQ6P 3H0DA 2JYLA 2PEQA 1ZMBA 3G21A 2L6EA 2OARA 2JPRA 4IPYA 3Q20A 3CCVP 2PXRC 4DGAC 4PH0A 3WBHA 1YHQP 1M6NA 1QVFO 1AK4C 2E1MA 1M90Q 1VQPP 5DCKA 2Z46A 3P05A 1YI2P 5BS1A 1K73Q 3G28A 4COPA 3CC2P 2KGFA 3CCLP 4U0EA 1QRJA 4PH1A 4XROA 3NTEA 1RO0A 4QNBA 4U0AA 3DPHA 1VQ4P 2JO0A 3CCUP 2PWOA 2BHVA 5HGMA 3CCQP 1M9YC 1G03A 1A43A 2EFJA 4U0CA 2XGVA 2ONTA 2Z45A 4U0BA 3CXCO 4XFXA 4E91A 4DGEC 1IUQA 1YJ9P 2GOLB 4XFZA 1VQOP 3MGEA 1VQ9P 1M9DC 1E6JP 2Y4ZA 1VQ7P 3G1GA 1KC8Q 2PEMA 3DS4A 4XRQA 4M0IA 2QA4P 3CC4P 2CWOA 2BUOA 4COCA 1EOQA 3DTJA 1M9EC 2P9XA 2PEOA 5HGOA 1JJ2O 1EIAA 2JYGA 2XT1A 1Q86Q 3CMEP 2PY8A 1AUMA 3G4SP 1VQ5P 1K8AQ 1W2BO 1M9XC 1K30A 2PWMA 2GONA 1GWPA 1M74A 4PH3A 1M9CC 2PEIA 2XXMA 2XGUA 3B5IA 3HYBA 5F2KA 2XV6A 3H47A 2QEXP 3I56P 2PENA 1NJIQ 2M8NA 1KD1Q 3CC7P 1A8OA 1VQNP 3CMAP 3DS1A 3CD6P 4E92A 1YITP 1Q81Q 3RG6C 1N8RQ 4NX4C 2Z44A 4INBA 1U7KA 4PH2A 4XFYA 2KODA 2X82A 5F2NA 1VQ8P 1S72P 2XDEA 1AFVA 1KQSO 1YJNP 1VQLP 4WYMA 2EIAA 2V4XA 2WLVB 1RO2A 1K9MQ 5HGKA 3G29A 4U0DA 2X2DD 2M8LA 1L6NA 3M1MA 2OTJP 3DS2A 3DS0A 3G6EP 3CCJP 2PEKA 3OW2O 3G0VA 3LRYA 3CCMP 4HTWA 1RNIA 5JPAA 1D1DA 5F2OA 1P7NA 3I55P 5I4TG 3VRLC 5HGNA 2PEJA 4GR2A 1M1KQ 3BP9A 2WLVA 5BS2A 4J93A 3CPWO 3CCSP 4LQWC 1QVGO 1VQMP 1M6EX 2XGYA 3G71P 3DS5A 1M9FC 2OTLP 1BAJA 4B4NA 5HGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EM9 A;  2X83 A;  3DS3 A;  3G1I A;  2M8P A;  4U0F A;  3G26 A;  3H4E A;  2LF4 A;  2JYL A;  3G21 A;  2L6E A;  2JPR A;  4IPY A;  2PXR C;  4DGA C;  4PH0 A;  1AK4 C;  5DCK A;  3P05 A;  3G28 A;  4COP A;  2KGF A;  4U0E A;  1QRJ A;  4PH1 A;  4XRO A;  3NTE A;  4QNB A;  4U0A A;  3DPH A;  2JO0 A;  2PWO A;  5HGM A;  1M9Y C;  1G03 A;  1A43 A;  4U0C A;  2XGV A;  2ONT A;  4U0B A;  4XFX A;  4E91 A;  4DGE C;  2GOL B;  4XFZ A;  3MGE A;  1M9D C;  1E6J P;  2Y4Z A;  3G1G A;  3DS4 A;  4XRQ A;  4M0I A;  2BUO A;  4COC A;  1EOQ A;  3DTJ A;  1M9E C;  5HGO A;  1EIA A;  2JYG A;  2XT1 A;  1AUM A;  1M9X C;  2PWM A;  2GON A;  1GWP A;  4PH3 A;  1M9C C;  2XXM A;  2XGU A;  2XV6 A;  3H47 A;  2M8N A;  1A8O A;  3DS1 A;  4E92 A;  4NX4 C;  4INB A;  1U7K A;  4PH2 A;  4XFY A;  2KOD A;  2X82 A;  2XDE A;  1AFV A;  4WYM A;  2EIA A;  2V4X A;  2WLV B;  5HGK A;  3G29 A;  4U0D A;  2X2D D;  2M8L A;  1L6N A;  3DS2 A;  3DS0 A;  3G0V A;  3LRY A;  4HTW A;  5JPA A;  1D1D A;  1P7N A;  5I4T G;  3VRL C;  5HGN A;  3BP9 A;  2WLV A;  4J93 A;  4LQW C;  2XGY A;  3DS5 A;  1M9F C;  1BAJ A;  4B4N A;  5HGL A; 
#chains in the Genus database with same CATH topology
 2DGY A;  3G1I A;  3U43 A;  2EG5 A;  2M8P A;  1IMP A;  1YIJ P;  4BPF A;  2PEQ A;  2JPR A;  4IPY A;  1QVF O;  4DGA C;  3WBH A;  4PH0 A;  1YHQ P;  1ZNV A;  2N6Z A;  1AK4 C;  2E1M A;  2K0Y A;  2Z46 A;  1K73 Q;  2MY5 A;  4HKG A;  2XZ0 D;  1VQ4 P;  2KOO A;  5KP7 B;  5HGM A;  3CCQ P;  2GZI A;  2DNW A;  3EJD A;  1HY8 A;  1A43 A;  1E0H A;  4DG9 A;  3CXC O;  4XFX A;  4E91 A;  3GKL C;  1YJ9 P;  2Y4Z A;  1VQ7 P;  1T8K A;  2KGD A;  2FHS C;  2QA4 P;  2FAC A;  2K2Q A;  1ACP A;  4COC A;  3DTJ A;  5HGO A;  3CME P;  1AUM A;  1GWP A;  1Z6M A;  2PEI A;  1Q82 Q;  1M9C C;  3HYB A;  2PEN A;  2M8N A;  3CD6 P;  1YIT P;  1Q81 Q;  3RG6 C;  2LTE A;  2X82 A;  1VQ8 P;  2K94 A;  2N50 A;  1KQS O;  3NY7 B;  1DV5 A;  2GZJ A;  2WLV B;  1RO2 A;  1K9M Q;  2M8L A;  2JAZ A;  3DS0 A;  3CCJ P;  4CA3 A;  3OW2 O;  1KLP A;  2K0X A;  3G0V A;  3LRY A;  3CCM P;  4HTW A;  3I55 P;  2PEJ A;  4LQW C;  1VQM P;  2JQ4 A;  1BAJ A;  2MVV A;  2FQ1 A;  1EM9 A;  3RG2 A;  2VSQ A;  2FVA A;  2GZG A;  1Q7Y Q;  1YJW P;  4GR6 A;  4H2X C;  1VQK P;  3G26 A;  1VQ6 P;  3H0D A;  2NO8 A;  1ZMB A;  2MVU A;  2VLN A;  2GYK A;  1VQP P;  5EJD A;  5DCK A;  1YI2 P;  2PNG A;  3CC2 P;  3B4Q A;  2AVA A;  2KG8 A;  4PH1 A;  2LKI A;  4U0A A;  2PWO A;  2BHV A;  1CEI A;  2ROQ A;  5HVC A;  5HV8 A;  2WPT A;  2ONT A;  2Z45 A;  1IUQ A;  2MR7 A;  3MGE A;  1M9D C;  1E6J P;  1KC8 Q;  3GZL A;  4M0I A;  2CWO A;  2FVF A;  1M9E C;  1JJ2 O;  2PY8 A;  1VQ5 P;  1W2B O;  1M9X C;  1K30 A;  2KR5 A;  4PH3 A;  2XXM A;  2XGU A;  2XV6 A;  3H47 A;  2EHS A;  1GXH A;  1NJI Q;  3CC7 P;  2GDX A;  4INB A;  2KOD A;  2XDE A;  1YJN P;  1L0H A;  4WYM A;  2X2B A;  2EIA A;  4U0D A;  2VLP A;  3DS2 A;  5JPA A;  1VHN A;  1P7N A;  5I4T G;  2CNR A;  1M1K Q;  5BS2 A;  2WLV A;  2AFE A;  4H2Y C;  1M6E X;  4PXH B;  3G71 P;  2OTL P;  1KD1 Q;  1FR2 A;  4MRT C;  1X3O A;  3E2D A;  2X83 A;  3DS3 A;  3CCE P;  4U0F A;  2L0Q A;  3H4E A;  2LF4 A;  2KGA A;  2LIU A;  2JYL A;  3G21 A;  2L6E A;  2LOL A;  3Q20 A;  1M6N A;  1M90 Q;  1L0I A;  3P05 A;  2L4B A;  5BS1 A;  1AF8 A;  2KGF A;  2FVE A;  3CCL P;  1QRJ A;  2N6Y A;  4XRO A;  2FQ0 A;  3LMO A;  1M9Y C;  2AF8 A;  1G03 A;  4R0M A;  2EFJ A;  4U0C A;  1NQ4 A;  2MF4 A;  7CEI A;  2GOL B;  2JBG A;  2L9F A;  4XRQ A;  4NEO A;  4QKO A;  2FAE A;  2BUO A;  1EOQ A;  1GXG A;  1EIA A;  2JYG A;  1Q86 Q;  2FAD A;  2L22 A;  2GDW A;  3G4S P;  1K8A Q;  2PWM A;  1M74 A;  3B5I A;  2N98 A;  2QEX P;  3I56 P;  3CMA P;  1IMQ A;  1EMV A;  4NX4 C;  2Z44 A;  4PH2 A;  1GPJ A;  5F2N A;  2KGE A;  2LML A;  2V4X A;  2MD9 A;  4H2W C;  5EW5 E;  3G6E P;  2PEK A;  2K5X A;  2JU2 A;  2XZ1 C;  2ERH A;  1D1D A;  2JB0 A;  5HGN A;  3BP9 A;  2KOP A;  2XGY A;  2KOQ A;  3DS5 A;  1M9F C;  2QNW A;  2CQ8 A;  2FQ2 A;  2KGC A;  2EHT A;  2K93 A;  3EJE A;  3HZQ A;  4PWV B;  3CCR P;  2JU1 A;  2OAR A;  3CCV P;  2PXR C;  2N5I A;  4BPG A;  3G28 A;  4COP A;  4U0E A;  5CZD B;  3NTE A;  1RO0 A;  4QNB A;  3DPH A;  2JO0 A;  3CCU P;  4F37 A;  2CG5 B;  2N5H A;  2KOR A;  2XGV A;  4U0B A;  2MR8 A;  4DGE C;  5KP6 B;  3CE7 A;  4XFZ A;  1VQO P;  1VQ9 P;  2LPK A;  4IZ6 A;  3G1G A;  2PEM A;  3DS4 A;  3CC4 P;  4UHP B;  1MZ8 A;  1OR5 A;  2KG9 A;  2P9X A;  2PEO A;  2XT1 A;  2GON A;  2CGQ A;  2VLO A;  1DNY A;  5F2K A;  1AYI A;  1A8O A;  1VQN P;  3DS1 A;  4E92 A;  1HQB A;  4BPH A;  1N8R Q;  2M5R A;  1UJZ A;  1U7K A;  4XFY A;  3EJB A;  2JGP A;  1S72 P;  2LL8 A;  1AFV A;  1VQL P;  2GZE A;  3GJN A;  2AFD A;  3GZM A;  5HGK A;  2VLQ A;  3G29 A;  1VKU A;  2KOS A;  2X2D D;  3M1M A;  1L6N A;  1BXI A;  2OTJ P;  2K0D X;  2GDY A;  2KW2 A;  5F2O A;  1RNI A;  2K92 A;  2KG6 A;  3VRL C;  1F80 D;  4GR2 A;  2LIW A;  4J93 A;  3CPW O;  5KP8 B;  3CCS P;  1UNK A;  1QVG O;  2KWL A;  2GZF A;  4B4N A;  5HGL A; 
#chains in the Genus database with same CATH homology
 1EM9 A;  3E2D A;  2X83 A;  2DGY A;  3DS3 A;  3G1I A;  3CCE P;  2EG5 A;  2M8P A;  1Q7Y Q;  1YJW P;  4GR6 A;  4U0F A;  1Q82 Q;  3G26 A;  1VQK P;  3H4E A;  3HZQ A;  2LF4 A;  1YIJ P;  3CCR P;  1VQ6 P;  3H0D A;  2JYL A;  2PEQ A;  1ZMB A;  3G21 A;  2L6E A;  2OAR A;  2JPR A;  4IPY A;  3Q20 A;  3CCV P;  2PXR C;  4DGA C;  4PH0 A;  3WBH A;  1YHQ P;  1M6N A;  1QVF O;  1AK4 C;  2E1M A;  1M90 Q;  1VQP P;  5DCK A;  2Z46 A;  3P05 A;  1YI2 P;  5BS1 A;  1K73 Q;  3G28 A;  4COP A;  3CC2 P;  2KGF A;  3CCL P;  4U0E A;  1QRJ A;  4PH1 A;  4XRO A;  3NTE A;  1RO0 A;  4QNB A;  4U0A A;  3DPH A;  1VQ4 P;  2JO0 A;  3CCU P;  2PWO A;  2BHV A;  5HGM A;  3CCQ P;  1M9Y C;  1G03 A;  1A43 A;  2EFJ A;  4U0C A;  2XGV A;  2ONT A;  2Z45 A;  4U0B A;  3CXC O;  4XFX A;  4E91 A;  4DGE C;  1IUQ A;  1YJ9 P;  2GOL B;  4XFZ A;  1VQO P;  3MGE A;  1VQ9 P;  1M9D C;  1E6J P;  2Y4Z A;  1VQ7 P;  3G1G A;  1KC8 Q;  2PEM A;  3DS4 A;  4XRQ A;  4M0I A;  2QA4 P;  3CC4 P;  2CWO A;  2BUO A;  4COC A;  1EOQ A;  3DTJ A;  1M9E C;  2P9X A;  2PEO A;  5HGO A;  1JJ2 O;  1EIA A;  2JYG A;  2XT1 A;  1Q86 Q;  3CME P;  2PY8 A;  1AUM A;  3G4S P;  1VQ5 P;  1K8A Q;  1W2B O;  1M9X C;  1K30 A;  2PWM A;  2GON A;  1GWP A;  1M74 A;  4PH3 A;  1M9C C;  2PEI A;  2XXM A;  2XGU A;  3B5I A;  3HYB A;  5F2K A;  2XV6 A;  3H47 A;  2QEX P;  3I56 P;  2PEN A;  1NJI Q;  2M8N A;  1KD1 Q;  3CC7 P;  1A8O A;  1VQN P;  3CMA P;  3DS1 A;  3CD6 P;  4E92 A;  1YIT P;  1Q81 Q;  3RG6 C;  1N8R Q;  4NX4 C;  2Z44 A;  4INB A;  1U7K A;  4PH2 A;  4XFY A;  2KOD A;  2X82 A;  5F2N A;  1VQ8 P;  1S72 P;  2XDE A;  1AFV A;  1KQS O;  1YJN P;  1VQL P;  4WYM A;  2EIA A;  2V4X A;  2WLV B;  1RO2 A;  1K9M Q;  5HGK A;  3G29 A;  4U0D A;  2X2D D;  2M8L A;  1L6N A;  3M1M A;  2OTJ P;  3DS2 A;  3DS0 A;  3G6E P;  3CCJ P;  2PEK A;  3OW2 O;  3G0V A;  3LRY A;  3CCM P;  4HTW A;  1RNI A;  5JPA A;  1D1D A;  5F2O A;  1P7N A;  3I55 P;  5I4T G;  3VRL C;  5HGN A;  2PEJ A;  4GR2 A;  1M1K Q;  3BP9 A;  2WLV A;  5BS2 A;  4J93 A;  3CPW O;  3CCS P;  4LQW C;  1QVG O;  1VQM P;  1M6E X;  2XGY A;  3G71 P;  3DS5 A;  1M9F C;  2OTL P;  1BAJ A;  4B4N A;  5HGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...