3NTEA

Crystal structure of the wild-type full-length hiv-1 capsid protein
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
221
structure length
221
Chain Sequence
PIVQNIQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTNNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPAATLEEMMTACQGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the HIV-1 full-length capsid protein in a conformationally trapped unassembled state induced by small-molecule binding.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords HIV-1 capsid protein
total genus 76
structure length 221
sequence length 221
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 3nteA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 3nteA02
3G1GA 3H47A 2KGFA 4XFZA 1U7KA 2XT1A 4U0CA 5I4TG 1EIAA 2X82A 1BAJA 4B4NA 5JPAA 4IPYA 1AUMA 5HGNA 2KODA 4COCA 2M8NA 4COPA 3H4EA 4PH0A 2XDEA 3DS3A 1E6JP 3G26A 1M9FC 2XGVA 4XROA 2XXMA 3VRLC 3DS1A 2BUOA 1M9EC 2L6EA 4M0IA 2WLVB 4DGEC 2M8LA 2PXRC 5DCKA 2LF4A 1AFVA 1AK4C 2V4XA 3MGEA 3DS2A 2PWOA 1D1DA 1G03A 2X83A 4U0DA 3DPHA 4PH3A 2GONA 4NX4C 2EIAA 1P7NA 2M8PA 4XRQA 5HGMA 1M9DC 1M9XC 4U0EA 4U0BA 4XFYA 2JO0A 4U0FA 4INBA 4HTWA 3DS5A 2JYLA 1M9YC 3G0VA 4PH2A 2Y4ZA 3NTEA 3P05A 4E92A 2JPRA 3DS0A 5HGOA 3BP9A 2JYGA 3G29A 3G1IA 2PWMA 3G28A 5HGLA 3G21A 3DS4A 5HGKA 1EOQA 1L6NA 4LQWC 2XV6A 3LRYA 4XFXA 4U0AA 4QNBA 3DTJA 2ONTA 1QRJA 1A8OA 2X2DD 4PH1A 1A43A 2GOLB 2XGYA 4WYMA 1EM9A 2XGUA 1GWPA 2WLVA 1M9CC 4DGAC 4E91A 4J93A
chains in the Genus database with same CATH superfamily
4NEOA 2LMLA 1U7KA 1T8KA 2VLQA 5I4TG 2AFDA 2N5IA 1Q81Q 2PENA 3NY7B 5HGNA 4COCA 2M8NA 1HY8A 3H4EA 2LPKA 1VQ4P 1IUQA 2FAEA 4HKGA 2JU2A 3DS3A 1E6JP 1M74A 1M9FC 1VQ6P 2JQ4A 2EHTA 2K92A 2KG6A 1VQMP 4M0IA 5CZDB 2VLNA 2LF4A 2K93A 1AFVA 1AK4C 3CMAP 3CCQP 3LMOA 2FHSC 2ERHA 2PWOA 1G03A 2EFJA 4UHPB 1P7NA 3RG6C 1M1KQ 1M9DC 1M9XC 2N5HA 2VLPA 2JO0A 7CEIA 4INBA 3HYBA 1RO0A 1M9YC 3G0VA 4MRTC 3CCUP 1VQNP 5KP7B 1Q82Q 4E92A 5BS2A 3M1MA 1DNYA 1MZ8A 3I55P 2XZ1C 1ZMBA 5HGLA 2VSQA 2XZ0D 1F80D 4LQWC 2FQ1A 2JBGA 2KGDA 2QNWA 3LRYA 2QA4P 4H2YC 2NO8A 1VQ9P 1VHNA 1GPJA 2ONTA 2OARA 1EMVA 3CMEP 1IMPA 4PH1A 2GZGA 2KOQA 1M9CC 2LIUA 2FVAA 3H47A 4H2WC 2KGFA 2N98A 4BPFA 2JU1A 2X82A 1BAJA 2FQ0A 3G6EP 3RG2A 2GYKA 5HV8A 2PEJA 3CCEP 1IMQA 2CG5B 2GZEA 1M9EC 2WLVB 1L0HA 3B4QA 5DCKA 3CCRP 3MGEA 3H0DA 1M6EX 2AFEA 1K73Q 2KW2A 2PEKA 2KGEA 1NJIQ 2K0DX 2GONA 2M8PA 2N6ZA 1AYIA 5F2KA 2KOSA 2LOLA 1VQ5P 4U0EA 1RO2A 3EJBA 4XFYA 4U0FA 4HTWA 2DGYA 4PH2A 3CC2P 3NTEA 2JPRA 3DS0A 4BPGA 2BHVA 4IZ6A 2JGPA 3G29A 2PWMA 3GZMA 3G28A 1NQ4A 3G21A 4DG9A 5HGKA 1EOQA 1S72P 3CD6P 1L6NA 1Q7YQ 2MD9A 2MY5A 3B5IA 1AF8A 4XFXA 1VQ7P 4U0AA 4QNBA 3DTJA 1QRJA 1A8OA 1VQPP 2AVAA 1K9MQ 2CQ8A 2KGAA 3U43A 1GWPA 2WPTA 4H2XC 2KWLA 3G1GA 3I56P 5F2NA 4U0CA 2MR8A 1JJ2O 2K0YA 1EIAA 3GJNA 2KGCA 2OTJP 1M90Q 2KOOA 4IPYA 1AUMA 2KG9A 4QKOA 2QEXP 4COPA 2LTEA 1KC8Q 1KD1Q 1VQ8P 3G26A 1Q86Q 2GZFA 2KORA 4PXHB 2K94A 4XROA 2XXMA 3GZLA 3VRLC 2M5RA 2PEOA 2DNWA 2L6EA 1K8AQ 2M8LA 2FVFA 2PXRC 4F37A 1UJZA 2V4XA 2KOPA 1VQLP 2LIWA 2Z45A 2LL8A 1L0IA 1VKUA 2P9XA 2EG5A 3CCLP 3GKLC 1M6NA 5EW5E 2N6YA 1QVGO 1D1DA 1DV5A 2MVUA 2Z46A 2JAZA 1W2BO 2K5XA 2JB0A 2EIAA 1CEIA 2L0QA 1X3OA 4XRQA 5HGMA 2GDXA 1GXGA 2MF4A 2Z44A 1OR5A 3CC7P 4U0BA 3DS5A 1ACPA 5KP8B 2JYLA 4BPHA 2FADA 5EJDA 1YJWP 2PEMA 3P05A 1K30A 3CCVP 1UNKA 2MR7A 1Z6MA 1GXHA 4GR2A 3DS4A 1YIJP 3CC4P 1HQBA 5HVCA 1YJNP 2CWOA 5BS1A 1YHQP 2AF8A 1BXIA 2X2DD 2E1MA 4CA3A 2XGYA 4WYMA 1EM9A 2XGUA 1KLPA 2ROQA 2VLOA 4DGAC 2XV6A 4J93A 3CCJP 3E2DA 2CNRA 4XFZA 2XT1A 1VQKP 1E0HA 3HZQA 1RNIA 2GDWA 4B4NA 1FR2A 5JPAA 2KODA 2K2QA 3EJEA 4PH0A 4R0MA 5F2OA 2XDEA 1YITP 3CPWO 3G71P 2XGVA 3DS1A 2N50A 2BUOA 4DGEC 2CGQA 3Q20A 2PEIA 4GR6A 2LKIA 2FACA 2MVVA 2GZJA 2EHSA 3DS2A 1QVFO 4PWVB 2X83A 4U0DA 3DPHA 1YJ9P 4PH3A 3CE7A 4NX4C 3CCMP 2OTLP 3EJDA 2Y4ZA 2FQ2A 1YI2P 5HGOA 2GDYA 2L22A 3WBHA 3BP9A 2JYGA 3G1IA 1KQSO 3CCSP 3G4SP 2K0XA 2L4BA 5KP6B 3OW2O 2FVEA 2GZIA 2PNGA 2PEQA 1N8RQ 2L9FA 1ZNVA 2KG8A 1A43A 2X2BA 2GOLB 2PY8A 2KR5A 1VQOP 2WLVA 3CXCO 4E91A
chains in the Genus database with same CATH topology
3G1GA 3I56P 3CCJP 3H47A 3E2DA 2KGFA 4XFZA 1U7KA 2XT1A 4U0CA 5F2NA 1VQKP 1JJ2O 5I4TG 1EIAA 3HZQA 2OTJP 1RNIA 2X82A 1BAJA 1M90Q 4B4NA 5JPAA 4IPYA 1AUMA 1Q81Q 3G6EP 2PENA 5HGNA 2KODA 4COCA 2M8NA 2QEXP 4COPA 3H4EA 1VQ4P 4PH0A 1KC8Q 5F2OA 1KD1Q 1VQ8P 1IUQA 2XDEA 1YITP 2PEJA 3CCEP 3DS3A 3G71P 1E6JP 1M74A 3G26A 1M9FC 2XGVA 3CPWO 1Q86Q 1VQ6P 4XROA 2XXMA 3VRLC 3DS1A 1VQMP 2BUOA 2PEOA 1M9EC 2L6EA 4M0IA 2WLVB 1K8AQ 4DGEC 2M8LA 2PXRC 2PEIA 3Q20A 5DCKA 4GR6A 2LF4A 1AFVA 1AK4C 3CMAP 2V4XA 3CCRP 3MGEA 3H0DA 1M6EX 3CCQP 1VQLP 2Z45A 1K73Q 2PEKA 2P9XA 2EG5A 3CCLP 3DS2A 2PWOA 1M6NA 1QVFO 1QVGO 1D1DA 1G03A 2X83A 4U0DA 2EFJA 3DPHA 1YJ9P 4PH3A 2Z46A 1NJIQ 1W2BO 2GONA 4NX4C 2EIAA 1P7NA 2M8PA 3RG6C 4XRQA 5HGMA 3CCMP 1M1KQ 1M9DC 1M9XC 2Z44A 5F2KA 3CC7P 1VQ5P 2OTLP 4U0EA 4U0BA 1RO2A 4XFYA 2JO0A 4U0FA 4INBA 4HTWA 3DS5A 3HYBA 2JYLA 1RO0A 1M9YC 3G0VA 2DGYA 4PH2A 3CC2P 1YJWP 2Y4ZA 2PEMA 3NTEA 3CCUP 1VQNP 3P05A 1Q82Q 4E92A 1YI2P 2JPRA 1K30A 3DS0A 5BS2A 5HGOA 2BHVA 3M1MA 3WBHA 3BP9A 2JYGA 3I55P 3CCVP 3G29A 3G1IA 1KQSO 2PWMA 3CCSP 3G28A 1ZMBA 3G4SP 5HGLA 3G21A 4GR2A 3DS4A 5HGKA 1EOQA 1S72P 3CD6P 1L6NA 4LQWC 3OW2O 1Q7YQ 1YIJP 3CC4P 2XV6A 3LRYA 3B5IA 2QA4P 1VQ9P 2PEQA 1YJNP 4XFXA 1VQ7P 4U0AA 4QNBA 2CWOA 3DTJA 5BS1A 1YHQP 2ONTA 1QRJA 2OARA 3CMEP 1N8RQ 1A8OA 2X2DD 4PH1A 1A43A 1VQPP 1K9MQ 2GOLB 2E1MA 2XGYA 4WYMA 1EM9A 2XGUA 2PY8A 1GWPA 1VQOP 2WLVA 1M9CC 4DGAC 3CXCO 4E91A 4J93A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1G A;  3H47 A;  2KGF A;  4XFZ A;  1U7K A;  2XT1 A;  4U0C A;  5I4T G;  1EIA A;  2X82 A;  1BAJ A;  4B4N A;  5JPA A;  4IPY A;  1AUM A;  5HGN A;  2KOD A;  4COC A;  2M8N A;  4COP A;  3H4E A;  4PH0 A;  2XDE A;  3DS3 A;  1E6J P;  3G26 A;  1M9F C;  2XGV A;  4XRO A;  2XXM A;  3VRL C;  3DS1 A;  2BUO A;  1M9E C;  2L6E A;  4M0I A;  2WLV B;  4DGE C;  2M8L A;  2PXR C;  5DCK A;  2LF4 A;  1AFV A;  1AK4 C;  2V4X A;  3MGE A;  3DS2 A;  2PWO A;  1D1D A;  1G03 A;  2X83 A;  4U0D A;  3DPH A;  4PH3 A;  2GON A;  4NX4 C;  2EIA A;  1P7N A;  2M8P A;  4XRQ A;  5HGM A;  1M9D C;  1M9X C;  4U0E A;  4U0B A;  4XFY A;  2JO0 A;  4U0F A;  4INB A;  4HTW A;  3DS5 A;  2JYL A;  1M9Y C;  3G0V A;  4PH2 A;  2Y4Z A;  3NTE A;  3P05 A;  4E92 A;  2JPR A;  3DS0 A;  5HGO A;  3BP9 A;  2JYG A;  3G29 A;  3G1I A;  2PWM A;  3G28 A;  5HGL A;  3G21 A;  3DS4 A;  5HGK A;  1EOQ A;  1L6N A;  4LQW C;  2XV6 A;  3LRY A;  4XFX A;  4U0A A;  4QNB A;  3DTJ A;  2ONT A;  1QRJ A;  1A8O A;  2X2D D;  4PH1 A;  1A43 A;  2GOL B;  2XGY A;  4WYM A;  1EM9 A;  2XGU A;  1GWP A;  2WLV A;  1M9C C;  4DGA C;  4E91 A;  4J93 A; 
#chains in the Genus database with same CATH topology
 4NEO A;  2LML A;  1U7K A;  1T8K A;  2VLQ A;  5I4T G;  2AFD A;  2N5I A;  1Q81 Q;  2PEN A;  3NY7 B;  5HGN A;  4COC A;  2M8N A;  1HY8 A;  3H4E A;  2LPK A;  1VQ4 P;  1IUQ A;  2FAE A;  4HKG A;  2JU2 A;  3DS3 A;  1E6J P;  1M74 A;  1M9F C;  1VQ6 P;  2JQ4 A;  2EHT A;  2K92 A;  2KG6 A;  1VQM P;  4M0I A;  5CZD B;  2VLN A;  2LF4 A;  2K93 A;  1AFV A;  1AK4 C;  3CMA P;  3CCQ P;  3LMO A;  2FHS C;  2ERH A;  2PWO A;  1G03 A;  2EFJ A;  4UHP B;  1P7N A;  3RG6 C;  1M1K Q;  1M9D C;  1M9X C;  2N5H A;  2VLP A;  2JO0 A;  7CEI A;  4INB A;  3HYB A;  1RO0 A;  1M9Y C;  3G0V A;  4MRT C;  3CCU P;  1VQN P;  5KP7 B;  1Q82 Q;  4E92 A;  5BS2 A;  3M1M A;  1DNY A;  1MZ8 A;  3I55 P;  2XZ1 C;  1ZMB A;  5HGL A;  2VSQ A;  2XZ0 D;  1F80 D;  4LQW C;  2FQ1 A;  2JBG A;  2KGD A;  2QNW A;  3LRY A;  2QA4 P;  4H2Y C;  2NO8 A;  1VQ9 P;  1VHN A;  1GPJ A;  2ONT A;  2OAR A;  1EMV A;  3CME P;  1IMP A;  4PH1 A;  2GZG A;  2KOQ A;  1M9C C;  2LIU A;  2FVA A;  3H47 A;  4H2W C;  2KGF A;  2N98 A;  4BPF A;  2JU1 A;  2X82 A;  1BAJ A;  2FQ0 A;  3G6E P;  3RG2 A;  2GYK A;  5HV8 A;  2PEJ A;  3CCE P;  1IMQ A;  2CG5 B;  2GZE A;  1M9E C;  2WLV B;  1L0H A;  3B4Q A;  5DCK A;  3CCR P;  3MGE A;  3H0D A;  1M6E X;  2AFE A;  1K73 Q;  2KW2 A;  2PEK A;  2KGE A;  1NJI Q;  2K0D X;  2GON A;  2M8P A;  2N6Z A;  1AYI A;  5F2K A;  2KOS A;  2LOL A;  1VQ5 P;  4U0E A;  1RO2 A;  3EJB A;  4XFY A;  4U0F A;  4HTW A;  2DGY A;  4PH2 A;  3CC2 P;  3NTE A;  2JPR A;  3DS0 A;  4BPG A;  2BHV A;  4IZ6 A;  2JGP A;  3G29 A;  2PWM A;  3GZM A;  3G28 A;  1NQ4 A;  3G21 A;  4DG9 A;  5HGK A;  1EOQ A;  1S72 P;  3CD6 P;  1L6N A;  1Q7Y Q;  2MD9 A;  2MY5 A;  3B5I A;  1AF8 A;  4XFX A;  1VQ7 P;  4U0A A;  4QNB A;  3DTJ A;  1QRJ A;  1A8O A;  1VQP P;  2AVA A;  1K9M Q;  2CQ8 A;  2KGA A;  3U43 A;  1GWP A;  2WPT A;  4H2X C;  2KWL A;  3G1G A;  3I56 P;  5F2N A;  4U0C A;  2MR8 A;  1JJ2 O;  2K0Y A;  1EIA A;  3GJN A;  2KGC A;  2OTJ P;  1M90 Q;  2KOO A;  4IPY A;  1AUM A;  2KG9 A;  4QKO A;  2QEX P;  4COP A;  2LTE A;  1KC8 Q;  1KD1 Q;  1VQ8 P;  3G26 A;  1Q86 Q;  2GZF A;  2KOR A;  4PXH B;  2K94 A;  4XRO A;  2XXM A;  3GZL A;  3VRL C;  2M5R A;  2PEO A;  2DNW A;  2L6E A;  1K8A Q;  2M8L A;  2FVF A;  2PXR C;  4F37 A;  1UJZ A;  2V4X A;  2KOP A;  1VQL P;  2LIW A;  2Z45 A;  2LL8 A;  1L0I A;  1VKU A;  2P9X A;  2EG5 A;  3CCL P;  3GKL C;  1M6N A;  5EW5 E;  2N6Y A;  1QVG O;  1D1D A;  1DV5 A;  2MVU A;  2Z46 A;  2JAZ A;  1W2B O;  2K5X A;  2JB0 A;  2EIA A;  1CEI A;  2L0Q A;  1X3O A;  4XRQ A;  5HGM A;  2GDX A;  1GXG A;  2MF4 A;  2Z44 A;  1OR5 A;  3CC7 P;  4U0B A;  3DS5 A;  1ACP A;  5KP8 B;  2JYL A;  4BPH A;  2FAD A;  5EJD A;  1YJW P;  2PEM A;  3P05 A;  1K30 A;  3CCV P;  1UNK A;  2MR7 A;  1Z6M A;  1GXH A;  4GR2 A;  3DS4 A;  1YIJ P;  3CC4 P;  1HQB A;  5HVC A;  1YJN P;  2CWO A;  5BS1 A;  1YHQ P;  2AF8 A;  1BXI A;  2X2D D;  2E1M A;  4CA3 A;  2XGY A;  4WYM A;  1EM9 A;  2XGU A;  1KLP A;  2ROQ A;  2VLO A;  4DGA C;  2XV6 A;  4J93 A;  3CCJ P;  3E2D A;  2CNR A;  4XFZ A;  2XT1 A;  1VQK P;  1E0H A;  3HZQ A;  1RNI A;  2GDW A;  4B4N A;  1FR2 A;  5JPA A;  2KOD A;  2K2Q A;  3EJE A;  4PH0 A;  4R0M A;  5F2O A;  2XDE A;  1YIT P;  3CPW O;  3G71 P;  2XGV A;  3DS1 A;  2N50 A;  2BUO A;  4DGE C;  2CGQ A;  3Q20 A;  2PEI A;  4GR6 A;  2LKI A;  2FAC A;  2MVV A;  2GZJ A;  2EHS A;  3DS2 A;  1QVF O;  4PWV B;  2X83 A;  4U0D A;  3DPH A;  1YJ9 P;  4PH3 A;  3CE7 A;  4NX4 C;  3CCM P;  2OTL P;  3EJD A;  2Y4Z A;  2FQ2 A;  1YI2 P;  5HGO A;  2GDY A;  2L22 A;  3WBH A;  3BP9 A;  2JYG A;  3G1I A;  1KQS O;  3CCS P;  3G4S P;  2K0X A;  2L4B A;  5KP6 B;  3OW2 O;  2FVE A;  2GZI A;  2PNG A;  2PEQ A;  1N8R Q;  2L9F A;  1ZNV A;  2KG8 A;  1A43 A;  2X2B A;  2GOL B;  2PY8 A;  2KR5 A;  1VQO P;  2WLV A;  3CXC O;  4E91 A; 
#chains in the Genus database with same CATH homology
 3G1G A;  3I56 P;  3CCJ P;  3H47 A;  3E2D A;  2KGF A;  4XFZ A;  1U7K A;  2XT1 A;  4U0C A;  5F2N A;  1VQK P;  1JJ2 O;  5I4T G;  1EIA A;  3HZQ A;  2OTJ P;  1RNI A;  2X82 A;  1BAJ A;  1M90 Q;  4B4N A;  5JPA A;  4IPY A;  1AUM A;  1Q81 Q;  3G6E P;  2PEN A;  5HGN A;  2KOD A;  4COC A;  2M8N A;  2QEX P;  4COP A;  3H4E A;  1VQ4 P;  4PH0 A;  1KC8 Q;  5F2O A;  1KD1 Q;  1VQ8 P;  1IUQ A;  2XDE A;  1YIT P;  2PEJ A;  3CCE P;  3DS3 A;  3G71 P;  1E6J P;  1M74 A;  3G26 A;  1M9F C;  2XGV A;  3CPW O;  1Q86 Q;  1VQ6 P;  4XRO A;  2XXM A;  3VRL C;  3DS1 A;  1VQM P;  2BUO A;  2PEO A;  1M9E C;  2L6E A;  4M0I A;  2WLV B;  1K8A Q;  4DGE C;  2M8L A;  2PXR C;  2PEI A;  3Q20 A;  5DCK A;  4GR6 A;  2LF4 A;  1AFV A;  1AK4 C;  3CMA P;  2V4X A;  3CCR P;  3MGE A;  3H0D A;  1M6E X;  3CCQ P;  1VQL P;  2Z45 A;  1K73 Q;  2PEK A;  2P9X A;  2EG5 A;  3CCL P;  3DS2 A;  2PWO A;  1M6N A;  1QVF O;  1QVG O;  1D1D A;  1G03 A;  2X83 A;  4U0D A;  2EFJ A;  3DPH A;  1YJ9 P;  4PH3 A;  2Z46 A;  1NJI Q;  1W2B O;  2GON A;  4NX4 C;  2EIA A;  1P7N A;  2M8P A;  3RG6 C;  4XRQ A;  5HGM A;  3CCM P;  1M1K Q;  1M9D C;  1M9X C;  2Z44 A;  5F2K A;  3CC7 P;  1VQ5 P;  2OTL P;  4U0E A;  4U0B A;  1RO2 A;  4XFY A;  2JO0 A;  4U0F A;  4INB A;  4HTW A;  3DS5 A;  3HYB A;  2JYL A;  1RO0 A;  1M9Y C;  3G0V A;  2DGY A;  4PH2 A;  3CC2 P;  1YJW P;  2Y4Z A;  2PEM A;  3NTE A;  3CCU P;  1VQN P;  3P05 A;  1Q82 Q;  4E92 A;  1YI2 P;  2JPR A;  1K30 A;  3DS0 A;  5BS2 A;  5HGO A;  2BHV A;  3M1M A;  3WBH A;  3BP9 A;  2JYG A;  3I55 P;  3CCV P;  3G29 A;  3G1I A;  1KQS O;  2PWM A;  3CCS P;  3G28 A;  1ZMB A;  3G4S P;  5HGL A;  3G21 A;  4GR2 A;  3DS4 A;  5HGK A;  1EOQ A;  1S72 P;  3CD6 P;  1L6N A;  4LQW C;  3OW2 O;  1Q7Y Q;  1YIJ P;  3CC4 P;  2XV6 A;  3LRY A;  3B5I A;  2QA4 P;  1VQ9 P;  2PEQ A;  1YJN P;  4XFX A;  1VQ7 P;  4U0A A;  4QNB A;  2CWO A;  3DTJ A;  5BS1 A;  1YHQ P;  2ONT A;  1QRJ A;  2OAR A;  3CME P;  1N8R Q;  1A8O A;  2X2D D;  4PH1 A;  1A43 A;  1VQP P;  1K9M Q;  2GOL B;  2E1M A;  2XGY A;  4WYM A;  1EM9 A;  2XGU A;  2PY8 A;  1GWP A;  1VQO P;  2WLV A;  1M9C C;  4DGA C;  3CXC O;  4E91 A;  4J93 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...