4U0CA

Hexameric hiv-1 ca in complex with nup153 peptide, p6 crystal form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
210
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 74
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0cA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0cA02
1D1DA 2XGUA 4U0FA 2X83A 2KGFA 1A8OA 1E6JP 4XFYA 2XGYA 3G21A 4PH0A 4XROA 2JO0A 4PH3A 2PWOA 3G26A 2WLVA 2M8NA 1EOQA 4DGAC 3DS3A 4WYMA 4E92A 2PWMA 1L6NA 3DS0A 4HTWA 1AUMA 4PH1A 2GOLB 5HGKA 2ONTA 4U0BA 1M9YC 5DCKA 4COPA 1AFVA 1EM9A 3NTEA 1G03A 1M9DC 3DS1A 4COCA 1U7KA 2Y4ZA 5I4TG 4XRQA 4INBA 5JPAA 1BAJA 3MGEA 3G28A 1M9EC 2XT1A 2X2DD 4DGEC 2JYGA 1GWPA 1EIAA 1M9CC 2M8LA 3H47A 2KODA 2BUOA 1AK4C 4NX4C 3H4EA 3DS2A 4IPYA 1M9XC 2XDEA 4U0CA 4U0DA 4U0AA 2M8PA 3G0VA 5HGOA 3DTJA 2V4XA 1M9FC 2L6EA 2GONA 4XFZA 2EIAA 5HGLA 1A43A 2JPRA 3P05A 3G1GA 2LF4A 1P7NA 3BP9A 4LQWC 2WLVB 3G1IA 5HGMA 5HGNA 4M0IA 3G29A 4XFXA 4QNBA 4PH2A 2XV6A 4B4NA 3DPHA 3LRYA 2JYLA 2PXRC 4E91A 4J93A 3VRLC 2X82A 1QRJA 2XXMA 4U0EA 3DS4A 3DS5A 2XGVA
chains in the Genus database with same CATH superfamily
1D1DA 1IMQA 2KOPA 7CEIA 2XZ1C 1E6JP 4XFYA 1OR5A 1Q81Q 2XGYA 3G21A 1VKUA 3CXCO 4BPGA 2VLQA 5KP8B 1NJIQ 2WLVA 4DGAC 2PWMA 1L6NA 2KOSA 2N6ZA 1YJ9P 2GOLB 2OTLP 3CCSP 2ONTA 1M90Q 3CCRP 2KW2A 1EM9A 2P9XA 1S72P 1VQ8P 3NY7B 2Y4ZA 4BPFA 4XRQA 5JPAA 2FQ2A 3CMAP 3G28A 2PEQA 1QVGO 4DGEC 2KORA 2JYGA 1Z6MA 2KGAA 1DNYA 1M9CC 1X3OA 2K0XA 1VQNP 2FACA 2GDYA 2VSQA 2LIUA 4IPYA 1Q86Q 1QVFO 1HQBA 2LL8A 2GYKA 2AFDA 1VQ7P 4U0AA 1M74A 2PEMA 1MZ8A 3CCJP 2LKIA 3U43A 2V4XA 1L0HA 4XFZA 1RO0A 3EJDA 5HGLA 5KP6B 1VQKP 1UJZA 1M1KQ 2CQ8A 1M6NA 2K94A 3BP9A 4LQWC 2KGCA 2FVAA 2KOQA 5HGNA 4UHPB 2MVUA 3CCQP 1K8AQ 2X2BA 2DGYA 2L4BA 4PH2A 4B4NA 1BXIA 4E91A 4R0MA 3CCMP 1GPJA 1AF8A 2XXMA 4U0EA 2GZGA 1VQPP 2KOOA 1NQ4A 2PENA 2XGVA 1GXHA 4U0FA 1DV5A 2JQ4A 1A8OA 4PH0A 1E0HA 4PH3A 2PEJA 3HZQA 4IZ6A 1KLPA 4E92A 2PY8A 1KD1Q 2Z44A 4PWVB 5HGKA 3GZLA 3CCEP 1F80D 1M9YC 5DCKA 4COPA 1AFVA 2XZ0D 3CC2P 1M9DC 1YJWP 1U7KA 1VQOP 4H2XC 4INBA 2JBGA 2XT1A 1K9MQ 2VLPA 1K73Q 3CMEP 1VQMP 1CEIA 2FADA 1VQ4P 1AK4C 1IUQA 5CZDB 1M9XC 4U0CA 4U0DA 1ZNVA 2K0YA 2M8PA 3CC4P 3DTJA 2JU2A 2EIAA 3G71P 5EW5E 2LIWA 3E2DA 3P05A 2ERHA 3G1GA 2QEXP 1EMVA 4H2YC 2JB0A 2MY5A 3G29A 2KGEA 3CE7A 3EJEA 2GZEA 2XV6A 1YITP 2K92A 2N5HA 1RO2A 2LOLA 2PXRC 4J93A 1VQ6P 5HVCA 2X82A 1YIJP 2PNGA 3I56P 3B4QA 5EJDA 3M1MA 2BHVA 2MF4A 4XROA 2VLOA 2PWOA 2L0QA 3G26A 2MVVA 1EOQA 2M8NA 1N8RQ 3H0DA 5BS1A 2EG5A 2L22A 1Q82Q 2FVEA 2KG6A 4QKOA 3OW2O 4U0BA 2EFJA 3CC7P 3DS1A 5I4TG 2OARA 2K0DX 2CNRA 2K2QA 2X2DD 2FAEA 1UNKA 1GWPA 2N5IA 2GDWA 2FQ1A 2KGDA 4BPHA 3CCVP 2FVFA 2MR8A 2M8LA 2CG5B 2KODA 2BUOA 5KP7B 2LPKA 2CGQA 1VQLP 2XDEA 2QNWA 1VQ9P 2Z46A 2QA4P 2KG9A 5HGOA 2N6YA 4GR6A 1M9FC 2KR5A 2GZJA 2AFEA 2JPRA 2LMLA 4H2WC 2DNWA 2FQ0A 1K30A 4DG9A 1ZMBA 2OTJP 3CCUP 2ROQA 1P7NA 2E1MA 5HGMA 1HY8A 4M0IA 5BS2A 3G6EP 4XFXA 4QNBA 1Q7YQ 3VRLC 3WBHA 2KG8A 1T8KA 3RG2A 4CA3A 1AYIA 3DS5A 4GR2A 2KWLA 1JJ2O 1KC8Q 3CPWO 2XGUA 1GXGA 1FR2A 2AF8A 2X83A 2KGFA 2FHSC 1M6EX 5F2OA 2JO0A 2LTEA 4F37A 3DS3A 4WYMA 1VHNA 2MD9A 3DS0A 2MR7A 4HTWA 1AUMA 4PH1A 1RNIA 3G4SP 1YI2P 1VQ5P 3RG6C 5F2KA 3NTEA 1G03A 2CWOA 2JAZA 4COCA 1BAJA 3MGEA 3CCLP 3EJBA 2N50A 3GZMA 1M9EC 2PEOA 3HYBA 4HKGA 2PEIA 3GKLC 2GZIA 2N98A 3LMOA 1EIAA 3Q20A 3H47A 1YJNP 4NEOA 4NX4C 2AVAA 3H4EA 3DS2A 2VLNA 3G0VA 3CD6P 5HV8A 2L6EA 2GONA 2EHSA 2K5XA 2JGPA 1A43A 2PEKA 4MRTC 2JU1A 1W2BO 2LF4A 2M5RA 2NO8A 3G1IA 2WLVB 1L0IA 3GJNA 1YHQP 1IMPA 2K93A 3LRYA 3DPHA 2JYLA 1KQSO 2L9FA 2GZFA 1ACPA 2GDXA 2Z45A 4PXHB 2WPTA 1QRJA 3DS4A 3I55P 5F2NA 3B5IA 2EHTA
chains in the Genus database with same CATH topology
1D1DA 2XGUA 4U0FA 2X83A 2KGFA 1A8OA 1E6JP 4XFYA 1M6EX 3M1MA 2XGYA 5F2OA 2BHVA 3G21A 1Q81Q 4PH0A 4XROA 2JO0A 4PH3A 3CXCO 2PWOA 2PEJA 1NJIQ 3G26A 3HZQA 2WLVA 2M8NA 1EOQA 1N8RQ 4DGAC 3DS3A 4WYMA 3H0DA 4E92A 2PWMA 2PY8A 5BS1A 1L6NA 2EG5A 1KD1Q 3DS0A 4HTWA 1AUMA 1YJ9P 1Q82Q 2Z44A 4PH1A 1RNIA 2GOLB 2OTLP 3G4SP 3CCSP 5HGKA 1YI2P 2ONTA 3OW2O 4U0BA 1M90Q 3CCEP 1M9YC 5DCKA 4COPA 1AFVA 5F2KA 3RG6C 1EM9A 2EFJA 3CCRP 1VQ5P 3NTEA 1G03A 2P9XA 1S72P 3CC2P 1M9DC 3CC7P 2CWOA 3DS1A 4COCA 1YJWP 1VQ8P 1U7KA 1VQOP 2Y4ZA 5I4TG 4XRQA 4INBA 5JPAA 1BAJA 2OARA 3MGEA 3CCLP 3CMAP 3G28A 1M9EC 2PEQA 2XT1A 2PEOA 1QVGO 2X2DD 3HYBA 1K9MQ 4DGEC 2PEIA 2JYGA 1GWPA 1K73Q 3CMEP 1VQMP 1EIAA 1M9CC 3Q20A 3CCVP 2M8LA 3H47A 1VQ4P 1YJNP 2KODA 1VQNP 2BUOA 1AK4C 4NX4C 1IUQA 3H4EA 3DS2A 4IPYA 1VQLP 1M9XC 1Q86Q 2XDEA 4U0CA 1VQ9P 1QVFO 4U0DA 1VQ7P 4U0AA 2Z46A 1M74A 2PEMA 2QA4P 2M8PA 3G0VA 3CCJP 3CC4P 3CD6P 5HGOA 3DTJA 2V4XA 4GR6A 1M9FC 2L6EA 2GONA 4XFZA 1RO0A 2EIAA 3G71P 5HGLA 1A43A 2JPRA 1VQKP 3E2DA 2PEKA 3P05A 1K30A 1ZMBA 2OTJP 3G1GA 1W2BO 2LF4A 2QEXP 3CCUP 1M1KQ 1M6NA 1P7NA 3BP9A 4LQWC 2WLVB 2E1MA 5HGMA 3G1IA 5HGNA 4M0IA 3CCQP 1YHQP 5BS2A 3G29A 3G6EP 1K8AQ 2DGYA 4XFXA 4QNBA 4PH2A 2XV6A 4B4NA 3DPHA 3LRYA 1YITP 2JYLA 1KQSO 1RO2A 2PXRC 4E91A 3CCMP 1Q7YQ 4J93A 1VQ6P 2Z45A 3VRLC 2X82A 3WBHA 1QRJA 2XXMA 4U0EA 1VQPP 3DS4A 1YIJP 3I55P 5F2NA 3B5IA 3DS5A 4GR2A 2PENA 2XGVA 1JJ2O 1KC8Q 3I56P 3CPWO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1D A;  2XGU A;  4U0F A;  2X83 A;  2KGF A;  1A8O A;  1E6J P;  4XFY A;  2XGY A;  3G21 A;  4PH0 A;  4XRO A;  2JO0 A;  4PH3 A;  2PWO A;  3G26 A;  2WLV A;  2M8N A;  1EOQ A;  4DGA C;  3DS3 A;  4WYM A;  4E92 A;  2PWM A;  1L6N A;  3DS0 A;  4HTW A;  1AUM A;  4PH1 A;  2GOL B;  5HGK A;  2ONT A;  4U0B A;  1M9Y C;  5DCK A;  4COP A;  1AFV A;  1EM9 A;  3NTE A;  1G03 A;  1M9D C;  3DS1 A;  4COC A;  1U7K A;  2Y4Z A;  5I4T G;  4XRQ A;  4INB A;  5JPA A;  1BAJ A;  3MGE A;  3G28 A;  1M9E C;  2XT1 A;  2X2D D;  4DGE C;  2JYG A;  1GWP A;  1EIA A;  1M9C C;  2M8L A;  3H47 A;  2KOD A;  2BUO A;  1AK4 C;  4NX4 C;  3H4E A;  3DS2 A;  4IPY A;  1M9X C;  2XDE A;  4U0C A;  4U0D A;  4U0A A;  2M8P A;  3G0V A;  5HGO A;  3DTJ A;  2V4X A;  1M9F C;  2L6E A;  2GON A;  4XFZ A;  2EIA A;  5HGL A;  1A43 A;  2JPR A;  3P05 A;  3G1G A;  2LF4 A;  1P7N A;  3BP9 A;  4LQW C;  2WLV B;  3G1I A;  5HGM A;  5HGN A;  4M0I A;  3G29 A;  4XFX A;  4QNB A;  4PH2 A;  2XV6 A;  4B4N A;  3DPH A;  3LRY A;  2JYL A;  2PXR C;  4E91 A;  4J93 A;  3VRL C;  2X82 A;  1QRJ A;  2XXM A;  4U0E A;  3DS4 A;  3DS5 A;  2XGV A; 
#chains in the Genus database with same CATH topology
 1D1D A;  1IMQ A;  2KOP A;  7CEI A;  2XZ1 C;  1E6J P;  4XFY A;  1OR5 A;  1Q81 Q;  2XGY A;  3G21 A;  1VKU A;  3CXC O;  4BPG A;  2VLQ A;  5KP8 B;  1NJI Q;  2WLV A;  4DGA C;  2PWM A;  1L6N A;  2KOS A;  2N6Z A;  1YJ9 P;  2GOL B;  2OTL P;  3CCS P;  2ONT A;  1M90 Q;  3CCR P;  2KW2 A;  1EM9 A;  2P9X A;  1S72 P;  1VQ8 P;  3NY7 B;  2Y4Z A;  4BPF A;  4XRQ A;  5JPA A;  2FQ2 A;  3CMA P;  3G28 A;  2PEQ A;  1QVG O;  4DGE C;  2KOR A;  2JYG A;  1Z6M A;  2KGA A;  1DNY A;  1M9C C;  1X3O A;  2K0X A;  1VQN P;  2FAC A;  2GDY A;  2VSQ A;  2LIU A;  4IPY A;  1Q86 Q;  1QVF O;  1HQB A;  2LL8 A;  2GYK A;  2AFD A;  1VQ7 P;  4U0A A;  1M74 A;  2PEM A;  1MZ8 A;  3CCJ P;  2LKI A;  3U43 A;  2V4X A;  1L0H A;  4XFZ A;  1RO0 A;  3EJD A;  5HGL A;  5KP6 B;  1VQK P;  1UJZ A;  1M1K Q;  2CQ8 A;  1M6N A;  2K94 A;  3BP9 A;  4LQW C;  2KGC A;  2FVA A;  2KOQ A;  5HGN A;  4UHP B;  2MVU A;  3CCQ P;  1K8A Q;  2X2B A;  2DGY A;  2L4B A;  4PH2 A;  4B4N A;  1BXI A;  4E91 A;  4R0M A;  3CCM P;  1GPJ A;  1AF8 A;  2XXM A;  4U0E A;  2GZG A;  1VQP P;  2KOO A;  1NQ4 A;  2PEN A;  2XGV A;  1GXH A;  4U0F A;  1DV5 A;  2JQ4 A;  1A8O A;  4PH0 A;  1E0H A;  4PH3 A;  2PEJ A;  3HZQ A;  4IZ6 A;  1KLP A;  4E92 A;  2PY8 A;  1KD1 Q;  2Z44 A;  4PWV B;  5HGK A;  3GZL A;  3CCE P;  1F80 D;  1M9Y C;  5DCK A;  4COP A;  1AFV A;  2XZ0 D;  3CC2 P;  1M9D C;  1YJW P;  1U7K A;  1VQO P;  4H2X C;  4INB A;  2JBG A;  2XT1 A;  1K9M Q;  2VLP A;  1K73 Q;  3CME P;  1VQM P;  1CEI A;  2FAD A;  1VQ4 P;  1AK4 C;  1IUQ A;  5CZD B;  1M9X C;  4U0C A;  4U0D A;  1ZNV A;  2K0Y A;  2M8P A;  3CC4 P;  3DTJ A;  2JU2 A;  2EIA A;  3G71 P;  5EW5 E;  2LIW A;  3E2D A;  3P05 A;  2ERH A;  3G1G A;  2QEX P;  1EMV A;  4H2Y C;  2JB0 A;  2MY5 A;  3G29 A;  2KGE A;  3CE7 A;  3EJE A;  2GZE A;  2XV6 A;  1YIT P;  2K92 A;  2N5H A;  1RO2 A;  2LOL A;  2PXR C;  4J93 A;  1VQ6 P;  5HVC A;  2X82 A;  1YIJ P;  2PNG A;  3I56 P;  3B4Q A;  5EJD A;  3M1M A;  2BHV A;  2MF4 A;  4XRO A;  2VLO A;  2PWO A;  2L0Q A;  3G26 A;  2MVV A;  1EOQ A;  2M8N A;  1N8R Q;  3H0D A;  5BS1 A;  2EG5 A;  2L22 A;  1Q82 Q;  2FVE A;  2KG6 A;  4QKO A;  3OW2 O;  4U0B A;  2EFJ A;  3CC7 P;  3DS1 A;  5I4T G;  2OAR A;  2K0D X;  2CNR A;  2K2Q A;  2X2D D;  2FAE A;  1UNK A;  1GWP A;  2N5I A;  2GDW A;  2FQ1 A;  2KGD A;  4BPH A;  3CCV P;  2FVF A;  2MR8 A;  2M8L A;  2CG5 B;  2KOD A;  2BUO A;  5KP7 B;  2LPK A;  2CGQ A;  1VQL P;  2XDE A;  2QNW A;  1VQ9 P;  2Z46 A;  2QA4 P;  2KG9 A;  5HGO A;  2N6Y A;  4GR6 A;  1M9F C;  2KR5 A;  2GZJ A;  2AFE A;  2JPR A;  2LML A;  4H2W C;  2DNW A;  2FQ0 A;  1K30 A;  4DG9 A;  1ZMB A;  2OTJ P;  3CCU P;  2ROQ A;  1P7N A;  2E1M A;  5HGM A;  1HY8 A;  4M0I A;  5BS2 A;  3G6E P;  4XFX A;  4QNB A;  1Q7Y Q;  3VRL C;  3WBH A;  2KG8 A;  1T8K A;  3RG2 A;  4CA3 A;  1AYI A;  3DS5 A;  4GR2 A;  2KWL A;  1JJ2 O;  1KC8 Q;  3CPW O;  2XGU A;  1GXG A;  1FR2 A;  2AF8 A;  2X83 A;  2KGF A;  2FHS C;  1M6E X;  5F2O A;  2JO0 A;  2LTE A;  4F37 A;  3DS3 A;  4WYM A;  1VHN A;  2MD9 A;  3DS0 A;  2MR7 A;  4HTW A;  1AUM A;  4PH1 A;  1RNI A;  3G4S P;  1YI2 P;  1VQ5 P;  3RG6 C;  5F2K A;  3NTE A;  1G03 A;  2CWO A;  2JAZ A;  4COC A;  1BAJ A;  3MGE A;  3CCL P;  3EJB A;  2N50 A;  3GZM A;  1M9E C;  2PEO A;  3HYB A;  4HKG A;  2PEI A;  3GKL C;  2GZI A;  2N98 A;  3LMO A;  1EIA A;  3Q20 A;  3H47 A;  1YJN P;  4NEO A;  4NX4 C;  2AVA A;  3H4E A;  3DS2 A;  2VLN A;  3G0V A;  3CD6 P;  5HV8 A;  2L6E A;  2GON A;  2EHS A;  2K5X A;  2JGP A;  1A43 A;  2PEK A;  4MRT C;  2JU1 A;  1W2B O;  2LF4 A;  2M5R A;  2NO8 A;  3G1I A;  2WLV B;  1L0I A;  3GJN A;  1YHQ P;  1IMP A;  2K93 A;  3LRY A;  3DPH A;  2JYL A;  1KQS O;  2L9F A;  2GZF A;  1ACP A;  2GDX A;  2Z45 A;  4PXH B;  2WPT A;  1QRJ A;  3DS4 A;  3I55 P;  5F2N A;  3B5I A;  2EHT A; 
#chains in the Genus database with same CATH homology
 1D1D A;  2XGU A;  4U0F A;  2X83 A;  2KGF A;  1A8O A;  1E6J P;  4XFY A;  1M6E X;  3M1M A;  2XGY A;  5F2O A;  2BHV A;  3G21 A;  1Q81 Q;  4PH0 A;  4XRO A;  2JO0 A;  4PH3 A;  3CXC O;  2PWO A;  2PEJ A;  1NJI Q;  3G26 A;  3HZQ A;  2WLV A;  2M8N A;  1EOQ A;  1N8R Q;  4DGA C;  3DS3 A;  4WYM A;  3H0D A;  4E92 A;  2PWM A;  2PY8 A;  5BS1 A;  1L6N A;  2EG5 A;  1KD1 Q;  3DS0 A;  4HTW A;  1AUM A;  1YJ9 P;  1Q82 Q;  2Z44 A;  4PH1 A;  1RNI A;  2GOL B;  2OTL P;  3G4S P;  3CCS P;  5HGK A;  1YI2 P;  2ONT A;  3OW2 O;  4U0B A;  1M90 Q;  3CCE P;  1M9Y C;  5DCK A;  4COP A;  1AFV A;  5F2K A;  3RG6 C;  1EM9 A;  2EFJ A;  3CCR P;  1VQ5 P;  3NTE A;  1G03 A;  2P9X A;  1S72 P;  3CC2 P;  1M9D C;  3CC7 P;  2CWO A;  3DS1 A;  4COC A;  1YJW P;  1VQ8 P;  1U7K A;  1VQO P;  2Y4Z A;  5I4T G;  4XRQ A;  4INB A;  5JPA A;  1BAJ A;  2OAR A;  3MGE A;  3CCL P;  3CMA P;  3G28 A;  1M9E C;  2PEQ A;  2XT1 A;  2PEO A;  1QVG O;  2X2D D;  3HYB A;  1K9M Q;  4DGE C;  2PEI A;  2JYG A;  1GWP A;  1K73 Q;  3CME P;  1VQM P;  1EIA A;  1M9C C;  3Q20 A;  3CCV P;  2M8L A;  3H47 A;  1VQ4 P;  1YJN P;  2KOD A;  1VQN P;  2BUO A;  1AK4 C;  4NX4 C;  1IUQ A;  3H4E A;  3DS2 A;  4IPY A;  1VQL P;  1M9X C;  1Q86 Q;  2XDE A;  4U0C A;  1VQ9 P;  1QVF O;  4U0D A;  1VQ7 P;  4U0A A;  2Z46 A;  1M74 A;  2PEM A;  2QA4 P;  2M8P A;  3G0V A;  3CCJ P;  3CC4 P;  3CD6 P;  5HGO A;  3DTJ A;  2V4X A;  4GR6 A;  1M9F C;  2L6E A;  2GON A;  4XFZ A;  1RO0 A;  2EIA A;  3G71 P;  5HGL A;  1A43 A;  2JPR A;  1VQK P;  3E2D A;  2PEK A;  3P05 A;  1K30 A;  1ZMB A;  2OTJ P;  3G1G A;  1W2B O;  2LF4 A;  2QEX P;  3CCU P;  1M1K Q;  1M6N A;  1P7N A;  3BP9 A;  4LQW C;  2WLV B;  2E1M A;  5HGM A;  3G1I A;  5HGN A;  4M0I A;  3CCQ P;  1YHQ P;  5BS2 A;  3G29 A;  3G6E P;  1K8A Q;  2DGY A;  4XFX A;  4QNB A;  4PH2 A;  2XV6 A;  4B4N A;  3DPH A;  3LRY A;  1YIT P;  2JYL A;  1KQS O;  1RO2 A;  2PXR C;  4E91 A;  3CCM P;  1Q7Y Q;  4J93 A;  1VQ6 P;  2Z45 A;  3VRL C;  2X82 A;  3WBH A;  1QRJ A;  2XXM A;  4U0E A;  1VQP P;  3DS4 A;  1YIJ P;  3I55 P;  5F2N A;  3B5I A;  3DS5 A;  4GR2 A;  2PEN A;  2XGV A;  1JJ2 O;  1KC8 Q;  3I56 P;  3CPW O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...