4U0CA

Hexameric hiv-1 ca in complex with nup153 peptide, p6 crystal form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
210
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
total genus 74
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0cA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0cA02
1A8OA 4INBA 5JPAA 1M9DC 2L6EA 2V4XA 2JPRA 4NX4C 5HGKA 2XT1A 1BAJA 2Y4ZA 1M9FC 4LQWC 2XXMA 2BUOA 1A43A 4M0IA 2WLVA 5DCKA 2WLVB 4U0FA 5HGMA 4U0DA 3DPHA 4U0CA 1U7KA 5HGOA 3DS2A 2PXRC 2X82A 3H4EA 2PWMA 3DS0A 4DGEC 2KODA 2XDEA 2XGVA 2XV6A 4COPA 1EOQA 2XGUA 1AK4C 4XFZA 3H47A 4U0EA 3DS4A 2X2DD 4J93A 3DS5A 3VRLC 4PH2A 2EIAA 3NTEA 4QNBA 2JYGA 3DS3A 5I4TG 3DS1A 4E91A 3P05A 2KGFA 2M8PA 1AUMA 2LF4A 4DGAC 3G0VA 1AFVA 3DTJA 4XROA 2GONA 3G1IA 1M9XC 4WYMA 1M9CC 4XFYA 3G21A 2M8NA 1M9EC 1P7NA 4U0AA 3G1GA 1L6NA 1M9YC 4PH0A 3MGEA 3G26A 2JO0A 2ONTA 3G29A 3G28A 2M8LA 2XGYA 4E92A 1GWPA 4IPYA 2GOLB 1QRJA 3LRYA 4XRQA 2PWOA 1EM9A 1E6JP 4PH3A 4HTWA 4U0BA 4B4NA 4XFXA 2X83A 5HGLA 1EIAA 1D1DA 3BP9A 2JYLA 4PH1A 5HGNA 1G03A 4COCA
chains in the Genus database with same CATH superfamily
1A8OA 2L6EA 3E2DA 2V4XA 2JPRA 3G4SP 2XT1A 1BAJA 1CEIA 4M0IA 1VQ5P 2WLVA 4BPHA 2PNGA 2LIUA 3DPHA 3CMEP 1U7KA 2OTLP 1T8KA 1GXGA 1ZNVA 2FVEA 2P9XA 2KG9A 2FVFA 1VQ8P 2KGDA 2PEQA 2FQ2A 3CE7A 2OARA 2X2DD 1M1KQ 3RG2A 3NTEA 2PY8A 3DS3A 2BHVA 4E91A 5BS1A 1KD1Q 3G0VA 1AFVA 2KW2A 3OW2O 4QKOA 7CEIA 1M6EX 1VQOP 1M90Q 3CMAP 1HQBA 2GDYA 1VQNP 1DV5A 1P7NA 4PXHB 3U43A 2MR8A 2LIWA 4HKGA 1L6NA 2JU1A 2ROQA 2K5XA 1YITP 2GYKA 2M8LA 2JGPA 1BXIA 5F2OA 5KP7B 1YJ9P 1GWPA 2JU2A 2GOLB 1QRJA 2GZJA 2JAZA 2EHSA 4HTWA 1RO2A 3GJNA 4XFXA 5HGLA 2VLNA 1D1DA 4MRTC 1Q81Q 3CCVP 3GZLA 2K93A 4INBA 3WBHA 2L0QA 4GR2A 2GZIA 2Y4ZA 4LQWC 1VKUA 2XXMA 4U0FA 5HGMA 3G6EP 1IMQA 2KR5A 5HGOA 2K92A 5F2NA 2JBGA 3H4EA 2PWMA 2VLQA 3DS0A 1NJIQ 1K9MQ 2XDEA 2EG5A 1KQSO 2KGCA 2XGUA 4IZ6A 2CQ8A 2K0YA 3B4QA 2K0XA 2L4BA 2EIAA 2JYGA 1UJZA 1EMVA 3DS1A 2KORA 3CCUP 1IMPA 4DG9A 1L0IA 4DGAC 4XROA 2OTJP 2GONA 1F80D 2N5IA 2X2BA 2NO8A 1K30A 1M9XC 2GZGA 1M9CC 1QVFO 5KP6B 3G21A 2M8NA 2FQ0A 3CCJP 2K2QA 2FQ1A 1ZMBA 2K0DX 1L0HA 2N6ZA 1VQ6P 2ONTA 2EHTA 3EJDA 2LTEA 2Z45A 2JQ4A 1Q82Q 2L22A 2GDXA 2MR7A 4CA3A 3LRYA 2PWOA 1EM9A 4PH3A 3EJBA 1MZ8A 2X83A 2AFEA 2VLOA 2PEOA 4UHPB 3BP9A 1G03A 3LMOA 2LPKA 2FAEA 4COCA 1KLPA 2XZ0D 5JPAA 1M9DC 2CWOA 3I55P 3CCEP 5HGKA 2XZ1C 5F2KA 4H2WC 1M9FC 2BUOA 2GZEA 4R0MA 1Q7YQ 5DCKA 2WLVB 2KOSA 2DNWA 3I56P 2KGAA 2CG5B 3RG6C 2AVAA 1Z6MA 1W2BO 2PEJA 1K8AQ 2XGVA 1ACPA 1EOQA 2JB0A 4H2YC 2EFJA 2N5HA 4U0EA 2MVUA 3DS4A 1VQ9P 2DGYA 2N98A 5HVCA 1QVGO 1S72P 4J93A 3DS5A 2KG8A 1JJ2O 3CCLP 4PWVB 4PH2A 4QNBA 3CD6P 1GXHA 5I4TG 3B5IA 1RO0A 1YHQP 2GDWA 3EJEA 3CXCO 2Z44A 3CCQP 2FACA 2N6YA 1OR5A 1M9EC 1VQLP 3G1GA 3Q20A 1X3OA 2LMLA 1VQMP 2LL8A 4GR6A 2VSQA 3HZQA 1M9YC 3MGEA 3H0DA 3G71P 2JO0A 1YJWP 3G28A 1DNYA 2FVAA 1VQPP 4E92A 3HYBA 1E0HA 3GZMA 4NEOA 1VQ7P 1NQ4A 2M5RA 3CCRP 4U0BA 2L9FA 4B4NA 1GPJA 1EIAA 1N8RQ 5CZDB 2JYLA 5HGNA 2Z46A 2MF4A 2ERHA 4NX4C 2QEXP 1IUQA 1AF8A 3CC7P 1A43A 2KGEA 3CC4P 1YI2P 5HV8A 1K73Q 2VLPA 4U0DA 2QA4P 4U0CA 3DS2A 2KOQA 2PXRC 2X82A 4DGEC 2KODA 1VQ4P 2XV6A 4COPA 1VHNA 1AK4C 4XFZA 1YJNP 3CCMP 3H47A 2KG6A 4BPGA 2PENA 1RNIA 3VRLC 2E1MA 4BPFA 1AYIA 2N50A 2KWLA 2KOPA 3P05A 1M6NA 2KGFA 1KC8Q 2M8PA 1AUMA 2LF4A 2LKIA 3DTJA 2PEKA 5BS2A 3G1IA 2PEMA 4WYMA 4XFYA 3CPWO 3GKLC 1M74A 1Q86Q 2MVVA 2FHSC 4U0AA 4F37A 2MY5A 4PH0A 2MD9A 3M1MA 3G26A 2CGQA 1HY8A 3G29A 2KOOA 3NY7B 5KP8B 3CC2P 2XGYA 1YIJP 4IPYA 2AFDA 2CNRA 2K94A 2PEIA 1FR2A 4XRQA 2AF8A 1E6JP 2FADA 1VQKP 5EJDA 5EW5E 2QNWA 3CCSP 2WPTA 1UNKA 2LOLA 4PH1A 4H2XC 2GZFA
chains in the Genus database with same CATH topology
1A8OA 4INBA 5JPAA 1M9DC 2L6EA 3WBHA 2CWOA 3E2DA 2V4XA 3I55P 2JPRA 3CCEP 3G4SP 4NX4C 5HGKA 2XT1A 1IUQA 4GR2A 2QEXP 1BAJA 5F2KA 2Y4ZA 3CC7P 1M9FC 4LQWC 2XXMA 2BUOA 1A43A 4M0IA 1VQ5P 3CC4P 1YI2P 2WLVA 1Q7YQ 5DCKA 2WLVB 4U0FA 1K73Q 5HGMA 3G6EP 4U0DA 3DPHA 3I56P 2QA4P 3CMEP 4U0CA 1U7KA 2OTLP 5HGOA 3DS2A 5F2NA 2PXRC 2X82A 3H4EA 2PWMA 3RG6C 3DS0A 4DGEC 2KODA 1W2BO 1NJIQ 2PEJA 1K9MQ 1K8AQ 2XDEA 2XGVA 2EG5A 2P9XA 2XV6A 1VQ4P 1KQSO 4COPA 1EOQA 1VQ8P 2XGUA 2EFJA 1AK4C 4XFZA 2PEQA 3CCMP 3H47A 4U0EA 1YJNP 3DS4A 1VQ9P 2OARA 2DGYA 2X2DD 2PENA 1S72P 1QVGO 1RNIA 4J93A 2E1MA 3DS5A 3VRLC 1JJ2O 1M1KQ 3CCLP 4PH2A 2EIAA 3NTEA 4QNBA 2JYGA 2PY8A 3DS3A 5I4TG 3DS1A 3CD6P 3CCUP 3B5IA 2BHVA 1RO0A 4E91A 3P05A 1M6NA 2KGFA 5BS1A 1KD1Q 1KC8Q 2M8PA 1AUMA 2LF4A 1YHQP 4DGAC 3G0VA 1AFVA 3CXCO 2Z44A 3DTJA 3OW2O 4XROA 2OTJP 2PEKA 5BS2A 1M6EX 2GONA 1VQOP 1M90Q 3CMAP 1K30A 3G1IA 1M9XC 2PEMA 4WYMA 3CCQP 1M9CC 4XFYA 1QVFO 1VQNP 3CPWO 3G21A 1M74A 2M8NA 1Q86Q 1M9EC 1P7NA 1VQLP 4U0AA 3G1GA 3Q20A 3CCJP 1L6NA 1VQMP 4GR6A 1ZMBA 1YITP 3HZQA 1M9YC 4PH0A 1VQ6P 3M1MA 3MGEA 3H0DA 3G26A 2JO0A 3G71P 2ONTA 3G29A 1YJWP 3G28A 2M8LA 3CC2P 2XGYA 2Z45A 5F2OA 1VQPP 4E92A 1GWPA 1YIJP 1YJ9P 1Q82Q 3HYBA 4IPYA 2GOLB 1QRJA 2PEIA 1VQ7P 3LRYA 4XRQA 2PWOA 1EM9A 1E6JP 4PH3A 4HTWA 1RO2A 1VQKP 3CCRP 4U0BA 3CCSP 4B4NA 4XFXA 2X83A 5HGLA 1EIAA 1D1DA 1N8RQ 2PEOA 3BP9A 1Q81Q 2JYLA 4PH1A 3CCVP 5HGNA 1G03A 2Z46A 4COCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A8O A;  4INB A;  5JPA A;  1M9D C;  2L6E A;  2V4X A;  2JPR A;  4NX4 C;  5HGK A;  2XT1 A;  1BAJ A;  2Y4Z A;  1M9F C;  4LQW C;  2XXM A;  2BUO A;  1A43 A;  4M0I A;  2WLV A;  5DCK A;  2WLV B;  4U0F A;  5HGM A;  4U0D A;  3DPH A;  4U0C A;  1U7K A;  5HGO A;  3DS2 A;  2PXR C;  2X82 A;  3H4E A;  2PWM A;  3DS0 A;  4DGE C;  2KOD A;  2XDE A;  2XGV A;  2XV6 A;  4COP A;  1EOQ A;  2XGU A;  1AK4 C;  4XFZ A;  3H47 A;  4U0E A;  3DS4 A;  2X2D D;  4J93 A;  3DS5 A;  3VRL C;  4PH2 A;  2EIA A;  3NTE A;  4QNB A;  2JYG A;  3DS3 A;  5I4T G;  3DS1 A;  4E91 A;  3P05 A;  2KGF A;  2M8P A;  1AUM A;  2LF4 A;  4DGA C;  3G0V A;  1AFV A;  3DTJ A;  4XRO A;  2GON A;  3G1I A;  1M9X C;  4WYM A;  1M9C C;  4XFY A;  3G21 A;  2M8N A;  1M9E C;  1P7N A;  4U0A A;  3G1G A;  1L6N A;  1M9Y C;  4PH0 A;  3MGE A;  3G26 A;  2JO0 A;  2ONT A;  3G29 A;  3G28 A;  2M8L A;  2XGY A;  4E92 A;  1GWP A;  4IPY A;  2GOL B;  1QRJ A;  3LRY A;  4XRQ A;  2PWO A;  1EM9 A;  1E6J P;  4PH3 A;  4HTW A;  4U0B A;  4B4N A;  4XFX A;  2X83 A;  5HGL A;  1EIA A;  1D1D A;  3BP9 A;  2JYL A;  4PH1 A;  5HGN A;  1G03 A;  4COC A; 
#chains in the Genus database with same CATH topology
 1A8O A;  2L6E A;  3E2D A;  2V4X A;  2JPR A;  3G4S P;  2XT1 A;  1BAJ A;  1CEI A;  4M0I A;  1VQ5 P;  2WLV A;  4BPH A;  2PNG A;  2LIU A;  3DPH A;  3CME P;  1U7K A;  2OTL P;  1T8K A;  1GXG A;  1ZNV A;  2FVE A;  2P9X A;  2KG9 A;  2FVF A;  1VQ8 P;  2KGD A;  2PEQ A;  2FQ2 A;  3CE7 A;  2OAR A;  2X2D D;  1M1K Q;  3RG2 A;  3NTE A;  2PY8 A;  3DS3 A;  2BHV A;  4E91 A;  5BS1 A;  1KD1 Q;  3G0V A;  1AFV A;  2KW2 A;  3OW2 O;  4QKO A;  7CEI A;  1M6E X;  1VQO P;  1M90 Q;  3CMA P;  1HQB A;  2GDY A;  1VQN P;  1DV5 A;  1P7N A;  4PXH B;  3U43 A;  2MR8 A;  2LIW A;  4HKG A;  1L6N A;  2JU1 A;  2ROQ A;  2K5X A;  1YIT P;  2GYK A;  2M8L A;  2JGP A;  1BXI A;  5F2O A;  5KP7 B;  1YJ9 P;  1GWP A;  2JU2 A;  2GOL B;  1QRJ A;  2GZJ A;  2JAZ A;  2EHS A;  4HTW A;  1RO2 A;  3GJN A;  4XFX A;  5HGL A;  2VLN A;  1D1D A;  4MRT C;  1Q81 Q;  3CCV P;  3GZL A;  2K93 A;  4INB A;  3WBH A;  2L0Q A;  4GR2 A;  2GZI A;  2Y4Z A;  4LQW C;  1VKU A;  2XXM A;  4U0F A;  5HGM A;  3G6E P;  1IMQ A;  2KR5 A;  5HGO A;  2K92 A;  5F2N A;  2JBG A;  3H4E A;  2PWM A;  2VLQ A;  3DS0 A;  1NJI Q;  1K9M Q;  2XDE A;  2EG5 A;  1KQS O;  2KGC A;  2XGU A;  4IZ6 A;  2CQ8 A;  2K0Y A;  3B4Q A;  2K0X A;  2L4B A;  2EIA A;  2JYG A;  1UJZ A;  1EMV A;  3DS1 A;  2KOR A;  3CCU P;  1IMP A;  4DG9 A;  1L0I A;  4DGA C;  4XRO A;  2OTJ P;  2GON A;  1F80 D;  2N5I A;  2X2B A;  2NO8 A;  1K30 A;  1M9X C;  2GZG A;  1M9C C;  1QVF O;  5KP6 B;  3G21 A;  2M8N A;  2FQ0 A;  3CCJ P;  2K2Q A;  2FQ1 A;  1ZMB A;  2K0D X;  1L0H A;  2N6Z A;  1VQ6 P;  2ONT A;  2EHT A;  3EJD A;  2LTE A;  2Z45 A;  2JQ4 A;  1Q82 Q;  2L22 A;  2GDX A;  2MR7 A;  4CA3 A;  3LRY A;  2PWO A;  1EM9 A;  4PH3 A;  3EJB A;  1MZ8 A;  2X83 A;  2AFE A;  2VLO A;  2PEO A;  4UHP B;  3BP9 A;  1G03 A;  3LMO A;  2LPK A;  2FAE A;  4COC A;  1KLP A;  2XZ0 D;  5JPA A;  1M9D C;  2CWO A;  3I55 P;  3CCE P;  5HGK A;  2XZ1 C;  5F2K A;  4H2W C;  1M9F C;  2BUO A;  2GZE A;  4R0M A;  1Q7Y Q;  5DCK A;  2WLV B;  2KOS A;  2DNW A;  3I56 P;  2KGA A;  2CG5 B;  3RG6 C;  2AVA A;  1Z6M A;  1W2B O;  2PEJ A;  1K8A Q;  2XGV A;  1ACP A;  1EOQ A;  2JB0 A;  4H2Y C;  2EFJ A;  2N5H A;  4U0E A;  2MVU A;  3DS4 A;  1VQ9 P;  2DGY A;  2N98 A;  5HVC A;  1QVG O;  1S72 P;  4J93 A;  3DS5 A;  2KG8 A;  1JJ2 O;  3CCL P;  4PWV B;  4PH2 A;  4QNB A;  3CD6 P;  1GXH A;  5I4T G;  3B5I A;  1RO0 A;  1YHQ P;  2GDW A;  3EJE A;  3CXC O;  2Z44 A;  3CCQ P;  2FAC A;  2N6Y A;  1OR5 A;  1M9E C;  1VQL P;  3G1G A;  3Q20 A;  1X3O A;  2LML A;  1VQM P;  2LL8 A;  4GR6 A;  2VSQ A;  3HZQ A;  1M9Y C;  3MGE A;  3H0D A;  3G71 P;  2JO0 A;  1YJW P;  3G28 A;  1DNY A;  2FVA A;  1VQP P;  4E92 A;  3HYB A;  1E0H A;  3GZM A;  4NEO A;  1VQ7 P;  1NQ4 A;  2M5R A;  3CCR P;  4U0B A;  2L9F A;  4B4N A;  1GPJ A;  1EIA A;  1N8R Q;  5CZD B;  2JYL A;  5HGN A;  2Z46 A;  2MF4 A;  2ERH A;  4NX4 C;  2QEX P;  1IUQ A;  1AF8 A;  3CC7 P;  1A43 A;  2KGE A;  3CC4 P;  1YI2 P;  5HV8 A;  1K73 Q;  2VLP A;  4U0D A;  2QA4 P;  4U0C A;  3DS2 A;  2KOQ A;  2PXR C;  2X82 A;  4DGE C;  2KOD A;  1VQ4 P;  2XV6 A;  4COP A;  1VHN A;  1AK4 C;  4XFZ A;  1YJN P;  3CCM P;  3H47 A;  2KG6 A;  4BPG A;  2PEN A;  1RNI A;  3VRL C;  2E1M A;  4BPF A;  1AYI A;  2N50 A;  2KWL A;  2KOP A;  3P05 A;  1M6N A;  2KGF A;  1KC8 Q;  2M8P A;  1AUM A;  2LF4 A;  2LKI A;  3DTJ A;  2PEK A;  5BS2 A;  3G1I A;  2PEM A;  4WYM A;  4XFY A;  3CPW O;  3GKL C;  1M74 A;  1Q86 Q;  2MVV A;  2FHS C;  4U0A A;  4F37 A;  2MY5 A;  4PH0 A;  2MD9 A;  3M1M A;  3G26 A;  2CGQ A;  1HY8 A;  3G29 A;  2KOO A;  3NY7 B;  5KP8 B;  3CC2 P;  2XGY A;  1YIJ P;  4IPY A;  2AFD A;  2CNR A;  2K94 A;  2PEI A;  1FR2 A;  4XRQ A;  2AF8 A;  1E6J P;  2FAD A;  1VQK P;  5EJD A;  5EW5 E;  2QNW A;  3CCS P;  2WPT A;  1UNK A;  2LOL A;  4PH1 A;  4H2X C;  2GZF A; 
#chains in the Genus database with same CATH homology
 1A8O A;  4INB A;  5JPA A;  1M9D C;  2L6E A;  3WBH A;  2CWO A;  3E2D A;  2V4X A;  3I55 P;  2JPR A;  3CCE P;  3G4S P;  4NX4 C;  5HGK A;  2XT1 A;  1IUQ A;  4GR2 A;  2QEX P;  1BAJ A;  5F2K A;  2Y4Z A;  3CC7 P;  1M9F C;  4LQW C;  2XXM A;  2BUO A;  1A43 A;  4M0I A;  1VQ5 P;  3CC4 P;  1YI2 P;  2WLV A;  1Q7Y Q;  5DCK A;  2WLV B;  4U0F A;  1K73 Q;  5HGM A;  3G6E P;  4U0D A;  3DPH A;  3I56 P;  2QA4 P;  3CME P;  4U0C A;  1U7K A;  2OTL P;  5HGO A;  3DS2 A;  5F2N A;  2PXR C;  2X82 A;  3H4E A;  2PWM A;  3RG6 C;  3DS0 A;  4DGE C;  2KOD A;  1W2B O;  1NJI Q;  2PEJ A;  1K9M Q;  1K8A Q;  2XDE A;  2XGV A;  2EG5 A;  2P9X A;  2XV6 A;  1VQ4 P;  1KQS O;  4COP A;  1EOQ A;  1VQ8 P;  2XGU A;  2EFJ A;  1AK4 C;  4XFZ A;  2PEQ A;  3CCM P;  3H47 A;  4U0E A;  1YJN P;  3DS4 A;  1VQ9 P;  2OAR A;  2DGY A;  2X2D D;  2PEN A;  1S72 P;  1QVG O;  1RNI A;  4J93 A;  2E1M A;  3DS5 A;  3VRL C;  1JJ2 O;  1M1K Q;  3CCL P;  4PH2 A;  2EIA A;  3NTE A;  4QNB A;  2JYG A;  2PY8 A;  3DS3 A;  5I4T G;  3DS1 A;  3CD6 P;  3CCU P;  3B5I A;  2BHV A;  1RO0 A;  4E91 A;  3P05 A;  1M6N A;  2KGF A;  5BS1 A;  1KD1 Q;  1KC8 Q;  2M8P A;  1AUM A;  2LF4 A;  1YHQ P;  4DGA C;  3G0V A;  1AFV A;  3CXC O;  2Z44 A;  3DTJ A;  3OW2 O;  4XRO A;  2OTJ P;  2PEK A;  5BS2 A;  1M6E X;  2GON A;  1VQO P;  1M90 Q;  3CMA P;  1K30 A;  3G1I A;  1M9X C;  2PEM A;  4WYM A;  3CCQ P;  1M9C C;  4XFY A;  1QVF O;  1VQN P;  3CPW O;  3G21 A;  1M74 A;  2M8N A;  1Q86 Q;  1M9E C;  1P7N A;  1VQL P;  4U0A A;  3G1G A;  3Q20 A;  3CCJ P;  1L6N A;  1VQM P;  4GR6 A;  1ZMB A;  1YIT P;  3HZQ A;  1M9Y C;  4PH0 A;  1VQ6 P;  3M1M A;  3MGE A;  3H0D A;  3G26 A;  2JO0 A;  3G71 P;  2ONT A;  3G29 A;  1YJW P;  3G28 A;  2M8L A;  3CC2 P;  2XGY A;  2Z45 A;  5F2O A;  1VQP P;  4E92 A;  1GWP A;  1YIJ P;  1YJ9 P;  1Q82 Q;  3HYB A;  4IPY A;  2GOL B;  1QRJ A;  2PEI A;  1VQ7 P;  3LRY A;  4XRQ A;  2PWO A;  1EM9 A;  1E6J P;  4PH3 A;  4HTW A;  1RO2 A;  1VQK P;  3CCR P;  4U0B A;  3CCS P;  4B4N A;  4XFX A;  2X83 A;  5HGL A;  1EIA A;  1D1D A;  1N8R Q;  2PEO A;  3BP9 A;  1Q81 Q;  2JYL A;  4PH1 A;  3CCV P;  5HGN A;  1G03 A;  2Z46 A;  4COC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...