4U0CA

Hexameric hiv-1 ca in complex with nup153 peptide, p6 crystal form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
210
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 74
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0cA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0cA02
2GONA 1M9YC 4U0BA 3LRYA 4LQWC 3G26A 4XFXA 2V4XA 1BAJA 4PH0A 3DS2A 4PH3A 4INBA 4DGEC 2JYLA 4XFYA 4IPYA 4XFZA 3VRLC 4U0FA 3DS1A 2JPRA 3H4EA 4J93A 4NX4C 2XGYA 1EIAA 3G1IA 1M9DC 4U0DA 1AUMA 2PWOA 2BUOA 1P7NA 4COPA 5HGNA 3G0VA 3P05A 1M9EC 4XROA 4DGAC 1EOQA 4U0CA 4COCA 1AFVA 4E91A 3BP9A 2X82A 3G29A 2KGFA 1M9CC 1G03A 2EIAA 2PWMA 3DS5A 1M9XC 2X83A 1EM9A 5JPAA 3MGEA 2WLVA 2GOLB 1L6NA 1E6JP 1AK4C 4B4NA 3G21A 5HGKA 3G1GA 2JYGA 4QNBA 2JO0A 2L6EA 2XGUA 3DS0A 2XXMA 2KODA 3NTEA 2ONTA 1U7KA 2WLVB 1D1DA 2M8PA 3DS3A 4XRQA 2XDEA 1GWPA 1QRJA 4HTWA 3H47A 5HGOA 2XGVA 2PXRC 5I4TG 2XV6A 1A8OA 4PH2A 3DTJA 3DS4A 1M9FC 2X2DD 4E92A 3DPHA 2M8LA 2LF4A 4U0EA 2M8NA 5HGLA 4PH1A 4U0AA 5HGMA 4M0IA 2Y4ZA 5DCKA 3G28A 4WYMA 2XT1A 1A43A
chains in the Genus database with same CATH superfamily
1KD1Q 1M9YC 1K73Q 2AVAA 4U0BA 4LQWC 2AFDA 3G26A 1BAJA 1VQMP 4PH0A 3DS2A 2QA4P 3CCMP 2GZIA 1NQ4A 2JYLA 1UJZA 3CMEP 3VRLC 1L0HA 4MRTC 2K0DX 4UHPB 2WPTA 2KG8A 2AFEA 3B4QA 7CEIA 3CD6P 2E1MA 3CXCO 1KLPA 3Q20A 3P05A 1AFVA 5EW5E 2X82A 2K5XA 1VQNP 1QVFO 1M9CC 2FQ1A 3CCLP 1ACPA 5F2OA 2EIAA 3M1MA 3DS5A 2KOQA 3I55P 1K30A 2KR5A 2WLVA 3GZLA 1Q81Q 1YI2P 2KOPA 4B4NA 1T8KA 1KQSO 2KOOA 1DV5A 5KP8B 3E2DA 2MY5A 4DG9A 2GYKA 3HYBA 2JO0A 2MD9A 2N6ZA 3EJEA 2XGUA 2KGDA 3DS0A 2KODA 1S72P 2AF8A 1Q7YQ 1Q82Q 1MZ8A 3CCJP 4HTWA 1Z6MA 2XGVA 2XV6A 1ZMBA 2K2QA 2X2DD 3CCVP 2LF4A 3GKLC 4U0EA 2FAEA 2FHSC 1AF8A 2XT1A 4H2YC 3RG6C 4R0MA 1VQPP 2KORA 2KOSA 2K93A 2PNGA 2PY8A 4PH3A 1VQ5P 1VQKP 2GZEA 4DGEC 2DNWA 2VLQA 5EJDA 3EJBA 2VLOA 3U43A 4IPYA 1FR2A 4U0FA 3DS1A 2FACA 3H4EA 4NX4C 1X3OA 1EIAA 3G1IA 1M9DC 1AYIA 3CCQP 1HQBA 4COPA 1VQ7P 2Z45A 3GZMA 1N8RQ 2KGFA 2PEOA 2EG5A 2LIWA 2XZ1C 4NEOA 2PWMA 2X83A 2OARA 1M74A 2FVEA 1AK4C 1UNKA 1IMQA 2LKIA 1RO2A 2OTLP 4BPGA 2LMLA 5F2KA 5CZDB 2K0YA 2N6YA 3G1GA 1K9MQ 2XZ0D 2L6EA 3G6EP 1YJWP 1HY8A 2ONTA 4CA3A 3CMAP 2L22A 1YJNP 5HGOA 1VQ8P 2FQ2A 4HKGA 1EMVA 3LMOA 2Z44A 3DTJA 3DS4A 1M9FC 2GZGA 2JB0A 4F37A 5HGLA 2Y4ZA 4PXHB 1VQ4P 1VQLP 3G28A 4WYMA 2N5IA 2GONA 1IUQA 3LRYA 4XFXA 1M90Q 2KW2A 5BS1A 3CC7P 2KWLA 3NY7B 1GXGA 2KG6A 4XFZA 1CEIA 3CC4P 2JU1A 3CCRP 4BPHA 2CG5B 1Q86Q 1AUMA 2BUOA 2PEIA 1P7NA 5HGNA 2CGQA 2JQ4A 3B5IA 1M9EC 4XROA 4DGAC 2FQ0A 1EOQA 2KG9A 1VQ9P 2EHTA 5BS2A 2LL8A 2KGAA 1NJIQ 2M5RA 2PEKA 2CNRA 1OR5A 3CPWO 2L9FA 1VKUA 1EM9A 5JPAA 2NO8A 1YITP 3MGEA 2BHVA 2JAZA 2GOLB 2VLPA 1E6JP 1ZNVA 3G21A 2CWOA 3RG2A 5HGKA 2PEMA 1M1KQ 2MR8A 1KC8Q 2JYGA 4QNBA 2PEQA 2ROQA 3H0DA 2LTEA 4QKOA 1M6EX 1E0HA 3NTEA 1U7KA 2PENA 2JBGA 1VHNA 5HVCA 1GPJA 1QVGO 1QRJA 3EJDA 1YIJP 2GZJA 4H2XC 2KGEA 1A8OA 4PH2A 4PWVB 2P9XA 3CCUP 4E92A 3DPHA 3CCSP 2Z46A 1M6NA 2QEXP 2PEJA 1RNIA 3CCEP 5DCKA 3CE7A 1A43A 3HZQA 2LOLA 2V4XA 2DGYA 4H2WC 4INBA 2FADA 1IMPA 2MVUA 2FVFA 2L4BA 2MR7A 2VLNA 5KP7B 4XFYA 2GDXA 3CC2P 2JPRA 4J93A 2XGYA 2K92A 1GXHA 2JGPA 2GDWA 4GR2A 2X2BA 2N5HA 4U0DA 2LPKA 2PWOA 2GZFA 3G0VA 1RO0A 1VQOP 3I56P 1YJ9P 4U0CA 4COCA 4E91A 3BP9A 3G29A 1BXIA 2EHSA 3G4SP 1G03A 4BPFA 2L0QA 1L0IA 1M9XC 2VSQA 4GR6A 3GJNA 3WBHA 1K8AQ 1W2BO 2EFJA 2MVVA 1L6NA 2JU2A 2OTJP 5KP6B 2KGCA 2LIUA 2K0XA 1F80D 2FVAA 2XXMA 2WLVB 1D1DA 2M8PA 5HV8A 3DS3A 1YHQP 2ERHA 4XRQA 2XDEA 2CQ8A 1DNYA 1GWPA 2MF4A 3H47A 2PXRC 5I4TG 2QNWA 2K94A 4IZ6A 2N98A 2M8LA 2M8NA 5F2NA 4PH1A 4U0AA 5HGMA 2GDYA 4M0IA 2N50A 1JJ2O 1VQ6P 3G71P 3OW2O
chains in the Genus database with same CATH topology
1VQPP 2GONA 1KD1Q 1M9YC 3HZQA 1K73Q 1IUQA 4U0BA 3LRYA 4LQWC 3G26A 4XFXA 2V4XA 1BAJA 2DGYA 1VQMP 2PY8A 4PH0A 3DS2A 4PH3A 1VQ5P 2QA4P 4INBA 1VQKP 4DGEC 3CCMP 1M90Q 5BS1A 3CC7P 2JYLA 4XFYA 4IPYA 3CC2P 4XFZA 3VRLC 3CMEP 4U0FA 3DS1A 2JPRA 3H4EA 4J93A 3CC4P 4NX4C 3CCRP 2XGYA 1EIAA 3G1IA 1M9DC 4GR2A 1Q86Q 3CD6P 4U0DA 1AUMA 2PWOA 2BUOA 2E1MA 3CCQP 2PEIA 1P7NA 4COPA 5HGNA 3CXCO 1VQ7P 3B5IA 3Q20A 3G0VA 2Z45A 3P05A 1RO0A 1VQOP 1M9EC 4XROA 4DGAC 3I56P 1EOQA 1YJ9P 4U0CA 4COCA 1AFVA 4E91A 1VQ9P 3BP9A 1N8RQ 2X82A 3G29A 1VQNP 2KGFA 2PEOA 5BS2A 3G4SP 1QVFO 1M9CC 1G03A 2EG5A 1NJIQ 3CCLP 2PEKA 5F2OA 2EIAA 3M1MA 2PWMA 3DS5A 3CPWO 1M9XC 4GR6A 2X83A 3WBHA 1EM9A 3I55P 5JPAA 1K30A 1K8AQ 1YITP 1W2BO 2EFJA 2OARA 3MGEA 2BHVA 1M74A 2WLVA 2GOLB 1L6NA 1Q81Q 1YI2P 1E6JP 1AK4C 4B4NA 3G21A 2CWOA 1KQSO 2OTJP 5HGKA 2PEMA 1M1KQ 1RO2A 2OTLP 5F2KA 3E2DA 3G1GA 1KC8Q 1K9MQ 2JYGA 4QNBA 2JO0A 2PEQA 2L6EA 3HYBA 3H0DA 3G6EP 2XGUA 1M6EX 2XXMA 2KODA 3DS0A 1YJWP 3NTEA 2ONTA 1U7KA 2WLVB 1D1DA 2M8PA 1S72P 3DS3A 1YHQP 4XRQA 2PENA 2XDEA 3CMAP 1Q7YQ 1Q82Q 1GWPA 1QVGO 1QRJA 1YJNP 3CCJP 4HTWA 3H47A 5HGOA 1YIJP 1VQ8P 2XGVA 2PXRC 5I4TG 2XV6A 2Z44A 1A8OA 4PH2A 1ZMBA 3DTJA 3DS4A 2P9XA 3CCUP 1M9FC 2X2DD 4E92A 3DPHA 3CCSP 2Z46A 2M8LA 1M6NA 3CCVP 2LF4A 4U0EA 2QEXP 2M8NA 5HGLA 5F2NA 4PH1A 4U0AA 5HGMA 4M0IA 2Y4ZA 2PEJA 1RNIA 1JJ2O 1VQ4P 3CCEP 5DCKA 3G28A 1VQLP 4WYMA 2XT1A 3RG6C 1VQ6P 3G71P 3OW2O 1A43A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GON A;  1M9Y C;  4U0B A;  3LRY A;  4LQW C;  3G26 A;  4XFX A;  2V4X A;  1BAJ A;  4PH0 A;  3DS2 A;  4PH3 A;  4INB A;  4DGE C;  2JYL A;  4XFY A;  4IPY A;  4XFZ A;  3VRL C;  4U0F A;  3DS1 A;  2JPR A;  3H4E A;  4J93 A;  4NX4 C;  2XGY A;  1EIA A;  3G1I A;  1M9D C;  4U0D A;  1AUM A;  2PWO A;  2BUO A;  1P7N A;  4COP A;  5HGN A;  3G0V A;  3P05 A;  1M9E C;  4XRO A;  4DGA C;  1EOQ A;  4U0C A;  4COC A;  1AFV A;  4E91 A;  3BP9 A;  2X82 A;  3G29 A;  2KGF A;  1M9C C;  1G03 A;  2EIA A;  2PWM A;  3DS5 A;  1M9X C;  2X83 A;  1EM9 A;  5JPA A;  3MGE A;  2WLV A;  2GOL B;  1L6N A;  1E6J P;  1AK4 C;  4B4N A;  3G21 A;  5HGK A;  3G1G A;  2JYG A;  4QNB A;  2JO0 A;  2L6E A;  2XGU A;  3DS0 A;  2XXM A;  2KOD A;  3NTE A;  2ONT A;  1U7K A;  2WLV B;  1D1D A;  2M8P A;  3DS3 A;  4XRQ A;  2XDE A;  1GWP A;  1QRJ A;  4HTW A;  3H47 A;  5HGO A;  2XGV A;  2PXR C;  5I4T G;  2XV6 A;  1A8O A;  4PH2 A;  3DTJ A;  3DS4 A;  1M9F C;  2X2D D;  4E92 A;  3DPH A;  2M8L A;  2LF4 A;  4U0E A;  2M8N A;  5HGL A;  4PH1 A;  4U0A A;  5HGM A;  4M0I A;  2Y4Z A;  5DCK A;  3G28 A;  4WYM A;  2XT1 A;  1A43 A; 
#chains in the Genus database with same CATH topology
 1KD1 Q;  1M9Y C;  1K73 Q;  2AVA A;  4U0B A;  4LQW C;  2AFD A;  3G26 A;  1BAJ A;  1VQM P;  4PH0 A;  3DS2 A;  2QA4 P;  3CCM P;  2GZI A;  1NQ4 A;  2JYL A;  1UJZ A;  3CME P;  3VRL C;  1L0H A;  4MRT C;  2K0D X;  4UHP B;  2WPT A;  2KG8 A;  2AFE A;  3B4Q A;  7CEI A;  3CD6 P;  2E1M A;  3CXC O;  1KLP A;  3Q20 A;  3P05 A;  1AFV A;  5EW5 E;  2X82 A;  2K5X A;  1VQN P;  1QVF O;  1M9C C;  2FQ1 A;  3CCL P;  1ACP A;  5F2O A;  2EIA A;  3M1M A;  3DS5 A;  2KOQ A;  3I55 P;  1K30 A;  2KR5 A;  2WLV A;  3GZL A;  1Q81 Q;  1YI2 P;  2KOP A;  4B4N A;  1T8K A;  1KQS O;  2KOO A;  1DV5 A;  5KP8 B;  3E2D A;  2MY5 A;  4DG9 A;  2GYK A;  3HYB A;  2JO0 A;  2MD9 A;  2N6Z A;  3EJE A;  2XGU A;  2KGD A;  3DS0 A;  2KOD A;  1S72 P;  2AF8 A;  1Q7Y Q;  1Q82 Q;  1MZ8 A;  3CCJ P;  4HTW A;  1Z6M A;  2XGV A;  2XV6 A;  1ZMB A;  2K2Q A;  2X2D D;  3CCV P;  2LF4 A;  3GKL C;  4U0E A;  2FAE A;  2FHS C;  1AF8 A;  2XT1 A;  4H2Y C;  3RG6 C;  4R0M A;  1VQP P;  2KOR A;  2KOS A;  2K93 A;  2PNG A;  2PY8 A;  4PH3 A;  1VQ5 P;  1VQK P;  2GZE A;  4DGE C;  2DNW A;  2VLQ A;  5EJD A;  3EJB A;  2VLO A;  3U43 A;  4IPY A;  1FR2 A;  4U0F A;  3DS1 A;  2FAC A;  3H4E A;  4NX4 C;  1X3O A;  1EIA A;  3G1I A;  1M9D C;  1AYI A;  3CCQ P;  1HQB A;  4COP A;  1VQ7 P;  2Z45 A;  3GZM A;  1N8R Q;  2KGF A;  2PEO A;  2EG5 A;  2LIW A;  2XZ1 C;  4NEO A;  2PWM A;  2X83 A;  2OAR A;  1M74 A;  2FVE A;  1AK4 C;  1UNK A;  1IMQ A;  2LKI A;  1RO2 A;  2OTL P;  4BPG A;  2LML A;  5F2K A;  5CZD B;  2K0Y A;  2N6Y A;  3G1G A;  1K9M Q;  2XZ0 D;  2L6E A;  3G6E P;  1YJW P;  1HY8 A;  2ONT A;  4CA3 A;  3CMA P;  2L22 A;  1YJN P;  5HGO A;  1VQ8 P;  2FQ2 A;  4HKG A;  1EMV A;  3LMO A;  2Z44 A;  3DTJ A;  3DS4 A;  1M9F C;  2GZG A;  2JB0 A;  4F37 A;  5HGL A;  2Y4Z A;  4PXH B;  1VQ4 P;  1VQL P;  3G28 A;  4WYM A;  2N5I A;  2GON A;  1IUQ A;  3LRY A;  4XFX A;  1M90 Q;  2KW2 A;  5BS1 A;  3CC7 P;  2KWL A;  3NY7 B;  1GXG A;  2KG6 A;  4XFZ A;  1CEI A;  3CC4 P;  2JU1 A;  3CCR P;  4BPH A;  2CG5 B;  1Q86 Q;  1AUM A;  2BUO A;  2PEI A;  1P7N A;  5HGN A;  2CGQ A;  2JQ4 A;  3B5I A;  1M9E C;  4XRO A;  4DGA C;  2FQ0 A;  1EOQ A;  2KG9 A;  1VQ9 P;  2EHT A;  5BS2 A;  2LL8 A;  2KGA A;  1NJI Q;  2M5R A;  2PEK A;  2CNR A;  1OR5 A;  3CPW O;  2L9F A;  1VKU A;  1EM9 A;  5JPA A;  2NO8 A;  1YIT P;  3MGE A;  2BHV A;  2JAZ A;  2GOL B;  2VLP A;  1E6J P;  1ZNV A;  3G21 A;  2CWO A;  3RG2 A;  5HGK A;  2PEM A;  1M1K Q;  2MR8 A;  1KC8 Q;  2JYG A;  4QNB A;  2PEQ A;  2ROQ A;  3H0D A;  2LTE A;  4QKO A;  1M6E X;  1E0H A;  3NTE A;  1U7K A;  2PEN A;  2JBG A;  1VHN A;  5HVC A;  1GPJ A;  1QVG O;  1QRJ A;  3EJD A;  1YIJ P;  2GZJ A;  4H2X C;  2KGE A;  1A8O A;  4PH2 A;  4PWV B;  2P9X A;  3CCU P;  4E92 A;  3DPH A;  3CCS P;  2Z46 A;  1M6N A;  2QEX P;  2PEJ A;  1RNI A;  3CCE P;  5DCK A;  3CE7 A;  1A43 A;  3HZQ A;  2LOL A;  2V4X A;  2DGY A;  4H2W C;  4INB A;  2FAD A;  1IMP A;  2MVU A;  2FVF A;  2L4B A;  2MR7 A;  2VLN A;  5KP7 B;  4XFY A;  2GDX A;  3CC2 P;  2JPR A;  4J93 A;  2XGY A;  2K92 A;  1GXH A;  2JGP A;  2GDW A;  4GR2 A;  2X2B A;  2N5H A;  4U0D A;  2LPK A;  2PWO A;  2GZF A;  3G0V A;  1RO0 A;  1VQO P;  3I56 P;  1YJ9 P;  4U0C A;  4COC A;  4E91 A;  3BP9 A;  3G29 A;  1BXI A;  2EHS A;  3G4S P;  1G03 A;  4BPF A;  2L0Q A;  1L0I A;  1M9X C;  2VSQ A;  4GR6 A;  3GJN A;  3WBH A;  1K8A Q;  1W2B O;  2EFJ A;  2MVV A;  1L6N A;  2JU2 A;  2OTJ P;  5KP6 B;  2KGC A;  2LIU A;  2K0X A;  1F80 D;  2FVA A;  2XXM A;  2WLV B;  1D1D A;  2M8P A;  5HV8 A;  3DS3 A;  1YHQ P;  2ERH A;  4XRQ A;  2XDE A;  2CQ8 A;  1DNY A;  1GWP A;  2MF4 A;  3H47 A;  2PXR C;  5I4T G;  2QNW A;  2K94 A;  4IZ6 A;  2N98 A;  2M8L A;  2M8N A;  5F2N A;  4PH1 A;  4U0A A;  5HGM A;  2GDY A;  4M0I A;  2N50 A;  1JJ2 O;  1VQ6 P;  3G71 P;  3OW2 O; 
#chains in the Genus database with same CATH homology
 1VQP P;  2GON A;  1KD1 Q;  1M9Y C;  3HZQ A;  1K73 Q;  1IUQ A;  4U0B A;  3LRY A;  4LQW C;  3G26 A;  4XFX A;  2V4X A;  1BAJ A;  2DGY A;  1VQM P;  2PY8 A;  4PH0 A;  3DS2 A;  4PH3 A;  1VQ5 P;  2QA4 P;  4INB A;  1VQK P;  4DGE C;  3CCM P;  1M90 Q;  5BS1 A;  3CC7 P;  2JYL A;  4XFY A;  4IPY A;  3CC2 P;  4XFZ A;  3VRL C;  3CME P;  4U0F A;  3DS1 A;  2JPR A;  3H4E A;  4J93 A;  3CC4 P;  4NX4 C;  3CCR P;  2XGY A;  1EIA A;  3G1I A;  1M9D C;  4GR2 A;  1Q86 Q;  3CD6 P;  4U0D A;  1AUM A;  2PWO A;  2BUO A;  2E1M A;  3CCQ P;  2PEI A;  1P7N A;  4COP A;  5HGN A;  3CXC O;  1VQ7 P;  3B5I A;  3Q20 A;  3G0V A;  2Z45 A;  3P05 A;  1RO0 A;  1VQO P;  1M9E C;  4XRO A;  4DGA C;  3I56 P;  1EOQ A;  1YJ9 P;  4U0C A;  4COC A;  1AFV A;  4E91 A;  1VQ9 P;  3BP9 A;  1N8R Q;  2X82 A;  3G29 A;  1VQN P;  2KGF A;  2PEO A;  5BS2 A;  3G4S P;  1QVF O;  1M9C C;  1G03 A;  2EG5 A;  1NJI Q;  3CCL P;  2PEK A;  5F2O A;  2EIA A;  3M1M A;  2PWM A;  3DS5 A;  3CPW O;  1M9X C;  4GR6 A;  2X83 A;  3WBH A;  1EM9 A;  3I55 P;  5JPA A;  1K30 A;  1K8A Q;  1YIT P;  1W2B O;  2EFJ A;  2OAR A;  3MGE A;  2BHV A;  1M74 A;  2WLV A;  2GOL B;  1L6N A;  1Q81 Q;  1YI2 P;  1E6J P;  1AK4 C;  4B4N A;  3G21 A;  2CWO A;  1KQS O;  2OTJ P;  5HGK A;  2PEM A;  1M1K Q;  1RO2 A;  2OTL P;  5F2K A;  3E2D A;  3G1G A;  1KC8 Q;  1K9M Q;  2JYG A;  4QNB A;  2JO0 A;  2PEQ A;  2L6E A;  3HYB A;  3H0D A;  3G6E P;  2XGU A;  1M6E X;  2XXM A;  2KOD A;  3DS0 A;  1YJW P;  3NTE A;  2ONT A;  1U7K A;  2WLV B;  1D1D A;  2M8P A;  1S72 P;  3DS3 A;  1YHQ P;  4XRQ A;  2PEN A;  2XDE A;  3CMA P;  1Q7Y Q;  1Q82 Q;  1GWP A;  1QVG O;  1QRJ A;  1YJN P;  3CCJ P;  4HTW A;  3H47 A;  5HGO A;  1YIJ P;  1VQ8 P;  2XGV A;  2PXR C;  5I4T G;  2XV6 A;  2Z44 A;  1A8O A;  4PH2 A;  1ZMB A;  3DTJ A;  3DS4 A;  2P9X A;  3CCU P;  1M9F C;  2X2D D;  4E92 A;  3DPH A;  3CCS P;  2Z46 A;  2M8L A;  1M6N A;  3CCV P;  2LF4 A;  4U0E A;  2QEX P;  2M8N A;  5HGL A;  5F2N A;  4PH1 A;  4U0A A;  5HGM A;  4M0I A;  2Y4Z A;  2PEJ A;  1RNI A;  1JJ2 O;  1VQ4 P;  3CCE P;  5DCK A;  3G28 A;  1VQL P;  4WYM A;  2XT1 A;  3RG6 C;  1VQ6 P;  3G71 P;  3OW2 O;  1A43 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...