4U0CA

Hexameric hiv-1 ca in complex with nup153 peptide, p6 crystal form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
210
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 74
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0cA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0cA02
2XGVA 3MGEA 2ONTA 5DCKA 2XT1A 1E6JP 2PWOA 2XV6A 3DS2A 2V4XA 5HGKA 1L6NA 4PH1A 3G1IA 1AFVA 4M0IA 2XGYA 4QNBA 1AUMA 4U0BA 1EOQA 3DS3A 4PH2A 3G0VA 2X82A 3H4EA 3DS5A 2M8PA 4U0DA 2GOLB 4DGEC 4XFXA 3G29A 4NX4C 4COCA 4XROA 2X83A 1M9YC 3G28A 4LQWC 4XFYA 1GWPA 3NTEA 4B4NA 5HGOA 1P7NA 5HGMA 3DTJA 2Y4ZA 3VRLC 4U0CA 4WYMA 5HGLA 2LF4A 2KGFA 1M9CC 1EM9A 2GONA 2PWMA 2WLVA 1BAJA 4DGAC 4XRQA 2M8LA 1G03A 2KODA 3G1GA 2JPRA 2BUOA 3DPHA 2PXRC 5HGNA 1M9FC 4COPA 4J93A 1A8OA 1U7KA 2XDEA 2JYGA 2X2DD 3BP9A 4INBA 4E91A 1QRJA 1M9XC 4U0FA 3DS4A 3G26A 4IPYA 4E92A 2JO0A 4XFZA 1AK4C 4U0EA 4PH3A 4HTWA 5I4TG 2EIAA 2WLVB 1EIAA 3DS1A 3DS0A 2L6EA 2XGUA 3H47A 2M8NA 3P05A 3G21A 4PH0A 1M9DC 5JPAA 3LRYA 1M9EC 1D1DA 1A43A 2XXMA 2JYLA 4U0AA
chains in the Genus database with same CATH superfamily
2XGVA 3MGEA 5DCKA 2K5XA 5HGKA 2PEIA 5BS2A 3GKLC 2CG5B 4M0IA 3CXCO 2XGYA 4QNBA 4H2YC 1Z6MA 3DS3A 3G0VA 1VQ8P 3HYBA 2X82A 1NJIQ 5KP8B 4DGEC 2GDYA 3I56P 1GXHA 2Z44A 2BHVA 2JBGA 2AVAA 1GWPA 4XFYA 1VQ4P 3NTEA 4DG9A 3RG6C 1ZMBA 3DTJA 3HZQA 5F2NA 5HGLA 1K73Q 2N6YA 2GZIA 2K0DX 4R0MA 2WLVA 2GDXA 1ZNVA 4H2XC 1BAJA 1QVFO 2KR5A 2E1MA 2KORA 3CMAP 2XZ1C 1N8RQ 1T8KA 1VQNP 2N6ZA 2Z45A 3CCVP 2PEMA 5HV8A 2BUOA 2KGCA 1M9FC 2PEKA 4COPA 4J93A 3GZLA 2LTEA 2FVEA 2K2QA 2L22A 2FQ2A 3H0DA 3DS4A 4U0EA 4PH3A 2PEJA 1VQ6P 2PNGA 3DS0A 2WPTA 3CCLP 1KQSO 2VLOA 2DGYA 2M8NA 1VQ9P 1M74A 5CZDB 1M9DC 3LRYA 2EHSA 5KP7B 1D1DA 1A43A 2ONTA 2JB0A 2XT1A 1W2BO 1VQMP 1E6JP 4HKGA 1KC8Q 2V4XA 2KGAA 4PH1A 2GZEA 2AFDA 1AUMA 4U0BA 2LKIA 3LMOA 1YJNP 3E2DA 2GOLB 4COCA 4XROA 2PEOA 1OR5A 3B4QA 4B4NA 3B5IA 3G6EP 2LMLA 5KP6B 1P7NA 3CCSP 5HGMA 2K93A 2LF4A 2KGFA 1M9CC 1EM9A 1VKUA 1KD1Q 2FQ1A 3NY7B 3EJEA 3G1GA 2DNWA 1K9MQ 1Q7YQ 2JQ4A 3OW2O 1A8OA 1IMQA 1U7KA 2XDEA 2L0QA 2MVUA 1M9XC 3G26A 1VQ7P 3G4SP 4IPYA 2MF4A 1AK4C 1EMVA 4HTWA 2LL8A 2L9FA 1S72P 3RG2A 2CWOA 2VLQA 1VQOP 1CEIA 4MRTC 2QEXP 1YHQP 2XGUA 1YJ9P 4IZ6A 2ROQA 5JPAA 2LIUA 2XXMA 3CCQP 2JYLA 2KOQA 2XV6A 1K8AQ 1YIJP 1M6NA 1VHNA 2FVFA 3EJBA 2FACA 2VLNA 1AFVA 2AFEA 4H2WC 2MR7A 2P9XA 5F2KA 3WBHA 1AYIA 1GXGA 1EOQA 4PH2A 2KOPA 1VQLP 3H4EA 4U0DA 2MY5A 3G29A 4XFXA 4NX4C 2N98A 2JGPA 2LOLA 4LQWC 5EW5E 1Q81Q 2FQ0A 2CQ8A 3CPWO 2Y4ZA 2FVAA 2XZ0D 2OARA 4BPGA 1NQ4A 2KG6A 3M1MA 1GPJA 3GZMA 1MZ8A 2AF8A 4CA3A 3CCJP 3CC4P 3CE7A 3CMEP 2KG9A 3Q20A 1KLPA 3EJDA 2EG5A 3DPHA 1Q82Q 2JU1A 2PXRC 2GZFA 2FAEA 2KGEA 2KOOA 1AF8A 3BP9A 4INBA 4E91A 2N50A 1VQPP 4E92A 4PWVB 2JO0A 2MD9A 4XFZA 2K0YA 2WLVB 2OTLP 1Q86Q 2K0XA 4NEOA 3DS1A 1IMPA 4UHPB 2LIWA 3H47A 1RO2A 2FHSC 4BPFA 2QA4P 3G21A 1M90Q 1HQBA 2MR8A 1M6EX 4QKOA 2LPKA 1JJ2O 4U0AA 2GZJA 3CCUP 3I55P 2PWOA 3DS2A 2JAZA 1L6NA 2N5IA 3G1IA 2QNWA 2K92A 2GDWA 4PXHB 1ACPA 2KW2A 1E0HA 3G71P 2N5HA 1FR2A 2KG8A 2PY8A 1L0IA 1L0HA 2KGDA 3DS5A 2M8PA 1K30A 1UJZA 2PENA 2X83A 2GZGA 5BS1A 1M9YC 3G28A 4GR6A 7CEIA 2CGQA 2ERHA 1RNIA 2X2BA 5HGOA 2KWLA 2OTJP 3VRLC 4U0CA 4WYMA 2GYKA 1HY8A 1IUQA 2GONA 2VSQA 2PWMA 2PEQA 2M5RA 2Z46A 2NO8A 1VQ5P 2L4BA 4GR2A 1YI2P 4DGAC 4XRQA 2MVVA 2M8LA 1G03A 2KODA 4BPHA 3CCRP 1YITP 2VLPA 2JPRA 5HGNA 3U43A 5HVCA 5F2OA 3CCEP 2JYGA 2X2DD 3CCMP 1QRJA 4U0FA 1DV5A 2K94A 5EJDA 3CD6P 1RO0A 5I4TG 3GJNA 2EIAA 1BXIA 1YJWP 1X3OA 3CC2P 2CNRA 1EIAA 4F37A 2EFJA 2L6EA 3CC7P 2FADA 2JU2A 1VQKP 1M1KQ 3P05A 2KOSA 1UNKA 4PH0A 1QVGO 1DNYA 1M9EC 1F80D 2EHTA
chains in the Genus database with same CATH topology
2XGVA 3MGEA 2ONTA 5DCKA 2XT1A 1W2BO 3CCUP 1VQMP 1E6JP 3I55P 2PWOA 2XV6A 3DS2A 2V4XA 1KC8Q 1K8AQ 5HGKA 1L6NA 4PH1A 1YIJP 1M6NA 2PEIA 3G1IA 5BS2A 1AFVA 4M0IA 2P9XA 3CXCO 2XGYA 4QNBA 1AUMA 5F2KA 3WBHA 4U0BA 3G71P 1EOQA 3DS3A 4PH2A 2PY8A 3G0VA 1VQ8P 1VQLP 1YJNP 3HYBA 2X82A 1NJIQ 3H4EA 3DS5A 3E2DA 2M8PA 1K30A 4U0DA 2GOLB 4DGEC 4XFXA 3G29A 4NX4C 3I56P 4COCA 4XROA 2X83A 2PENA 2Z44A 5BS1A 1M9YC 2BHVA 2PEOA 3G28A 4LQWC 4XFYA 1GWPA 4GR6A 1VQ4P 3NTEA 3RG6C 4B4NA 1Q81Q 1RNIA 3B5IA 3G6EP 5HGOA 1P7NA 1ZMBA 3CCSP 3CPWO 5HGMA 3DTJA 2OTJP 2Y4ZA 3HZQA 5F2NA 3VRLC 4U0CA 4WYMA 5HGLA 2OARA 2LF4A 1K73Q 2KGFA 1M9CC 1EM9A 1KD1Q 1IUQA 2GONA 3M1MA 2PWMA 2WLVA 2PEQA 2Z46A 1VQ5P 1BAJA 4GR2A 1YI2P 1QVFO 4DGAC 4XRQA 2E1MA 3CMAP 3CCJP 2M8LA 1N8RQ 3CC4P 1G03A 2KODA 1YITP 3CCRP 3CMEP 1VQNP 2Z45A 3G1GA 3Q20A 3CCVP 2PEMA 2JPRA 2BUOA 2EG5A 3DPHA 1K9MQ 1Q82Q 2PXRC 5HGNA 1Q7YQ 1M9FC 2PEKA 4COPA 4J93A 5F2OA 3OW2O 1A8OA 1U7KA 2XDEA 3CCEP 2JYGA 2X2DD 3BP9A 4INBA 4E91A 3CCMP 1QRJA 1M9XC 4U0FA 3H0DA 3DS4A 1VQPP 3G26A 1VQ7P 3G4SP 4IPYA 4E92A 2JO0A 4XFZA 1AK4C 4U0EA 4PH3A 4HTWA 3CD6P 2PEJA 1RO0A 5I4TG 1S72P 2EIAA 2WLVB 1VQ6P 2CWOA 2OTLP 1Q86Q 1VQOP 1YJWP 3CC2P 1EIAA 3DS1A 3DS0A 2EFJA 3CCLP 1KQSO 2QEXP 2L6EA 1YHQP 3CC7P 2XGUA 3H47A 1RO2A 2DGYA 2M8NA 1YJ9P 1VQKP 1M1KQ 1VQ9P 1M74A 3P05A 2QA4P 3G21A 1M90Q 4PH0A 1QVGO 1M9DC 5JPAA 1M6EX 3LRYA 1M9EC 1D1DA 1A43A 2XXMA 1JJ2O 3CCQP 2JYLA 4U0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGV A;  3MGE A;  2ONT A;  5DCK A;  2XT1 A;  1E6J P;  2PWO A;  2XV6 A;  3DS2 A;  2V4X A;  5HGK A;  1L6N A;  4PH1 A;  3G1I A;  1AFV A;  4M0I A;  2XGY A;  4QNB A;  1AUM A;  4U0B A;  1EOQ A;  3DS3 A;  4PH2 A;  3G0V A;  2X82 A;  3H4E A;  3DS5 A;  2M8P A;  4U0D A;  2GOL B;  4DGE C;  4XFX A;  3G29 A;  4NX4 C;  4COC A;  4XRO A;  2X83 A;  1M9Y C;  3G28 A;  4LQW C;  4XFY A;  1GWP A;  3NTE A;  4B4N A;  5HGO A;  1P7N A;  5HGM A;  3DTJ A;  2Y4Z A;  3VRL C;  4U0C A;  4WYM A;  5HGL A;  2LF4 A;  2KGF A;  1M9C C;  1EM9 A;  2GON A;  2PWM A;  2WLV A;  1BAJ A;  4DGA C;  4XRQ A;  2M8L A;  1G03 A;  2KOD A;  3G1G A;  2JPR A;  2BUO A;  3DPH A;  2PXR C;  5HGN A;  1M9F C;  4COP A;  4J93 A;  1A8O A;  1U7K A;  2XDE A;  2JYG A;  2X2D D;  3BP9 A;  4INB A;  4E91 A;  1QRJ A;  1M9X C;  4U0F A;  3DS4 A;  3G26 A;  4IPY A;  4E92 A;  2JO0 A;  4XFZ A;  1AK4 C;  4U0E A;  4PH3 A;  4HTW A;  5I4T G;  2EIA A;  2WLV B;  1EIA A;  3DS1 A;  3DS0 A;  2L6E A;  2XGU A;  3H47 A;  2M8N A;  3P05 A;  3G21 A;  4PH0 A;  1M9D C;  5JPA A;  3LRY A;  1M9E C;  1D1D A;  1A43 A;  2XXM A;  2JYL A;  4U0A A; 
#chains in the Genus database with same CATH topology
 2XGV A;  3MGE A;  5DCK A;  2K5X A;  5HGK A;  2PEI A;  5BS2 A;  3GKL C;  2CG5 B;  4M0I A;  3CXC O;  2XGY A;  4QNB A;  4H2Y C;  1Z6M A;  3DS3 A;  3G0V A;  1VQ8 P;  3HYB A;  2X82 A;  1NJI Q;  5KP8 B;  4DGE C;  2GDY A;  3I56 P;  1GXH A;  2Z44 A;  2BHV A;  2JBG A;  2AVA A;  1GWP A;  4XFY A;  1VQ4 P;  3NTE A;  4DG9 A;  3RG6 C;  1ZMB A;  3DTJ A;  3HZQ A;  5F2N A;  5HGL A;  1K73 Q;  2N6Y A;  2GZI A;  2K0D X;  4R0M A;  2WLV A;  2GDX A;  1ZNV A;  4H2X C;  1BAJ A;  1QVF O;  2KR5 A;  2E1M A;  2KOR A;  3CMA P;  2XZ1 C;  1N8R Q;  1T8K A;  1VQN P;  2N6Z A;  2Z45 A;  3CCV P;  2PEM A;  5HV8 A;  2BUO A;  2KGC A;  1M9F C;  2PEK A;  4COP A;  4J93 A;  3GZL A;  2LTE A;  2FVE A;  2K2Q A;  2L22 A;  2FQ2 A;  3H0D A;  3DS4 A;  4U0E A;  4PH3 A;  2PEJ A;  1VQ6 P;  2PNG A;  3DS0 A;  2WPT A;  3CCL P;  1KQS O;  2VLO A;  2DGY A;  2M8N A;  1VQ9 P;  1M74 A;  5CZD B;  1M9D C;  3LRY A;  2EHS A;  5KP7 B;  1D1D A;  1A43 A;  2ONT A;  2JB0 A;  2XT1 A;  1W2B O;  1VQM P;  1E6J P;  4HKG A;  1KC8 Q;  2V4X A;  2KGA A;  4PH1 A;  2GZE A;  2AFD A;  1AUM A;  4U0B A;  2LKI A;  3LMO A;  1YJN P;  3E2D A;  2GOL B;  4COC A;  4XRO A;  2PEO A;  1OR5 A;  3B4Q A;  4B4N A;  3B5I A;  3G6E P;  2LML A;  5KP6 B;  1P7N A;  3CCS P;  5HGM A;  2K93 A;  2LF4 A;  2KGF A;  1M9C C;  1EM9 A;  1VKU A;  1KD1 Q;  2FQ1 A;  3NY7 B;  3EJE A;  3G1G A;  2DNW A;  1K9M Q;  1Q7Y Q;  2JQ4 A;  3OW2 O;  1A8O A;  1IMQ A;  1U7K A;  2XDE A;  2L0Q A;  2MVU A;  1M9X C;  3G26 A;  1VQ7 P;  3G4S P;  4IPY A;  2MF4 A;  1AK4 C;  1EMV A;  4HTW A;  2LL8 A;  2L9F A;  1S72 P;  3RG2 A;  2CWO A;  2VLQ A;  1VQO P;  1CEI A;  4MRT C;  2QEX P;  1YHQ P;  2XGU A;  1YJ9 P;  4IZ6 A;  2ROQ A;  5JPA A;  2LIU A;  2XXM A;  3CCQ P;  2JYL A;  2KOQ A;  2XV6 A;  1K8A Q;  1YIJ P;  1M6N A;  1VHN A;  2FVF A;  3EJB A;  2FAC A;  2VLN A;  1AFV A;  2AFE A;  4H2W C;  2MR7 A;  2P9X A;  5F2K A;  3WBH A;  1AYI A;  1GXG A;  1EOQ A;  4PH2 A;  2KOP A;  1VQL P;  3H4E A;  4U0D A;  2MY5 A;  3G29 A;  4XFX A;  4NX4 C;  2N98 A;  2JGP A;  2LOL A;  4LQW C;  5EW5 E;  1Q81 Q;  2FQ0 A;  2CQ8 A;  3CPW O;  2Y4Z A;  2FVA A;  2XZ0 D;  2OAR A;  4BPG A;  1NQ4 A;  2KG6 A;  3M1M A;  1GPJ A;  3GZM A;  1MZ8 A;  2AF8 A;  4CA3 A;  3CCJ P;  3CC4 P;  3CE7 A;  3CME P;  2KG9 A;  3Q20 A;  1KLP A;  3EJD A;  2EG5 A;  3DPH A;  1Q82 Q;  2JU1 A;  2PXR C;  2GZF A;  2FAE A;  2KGE A;  2KOO A;  1AF8 A;  3BP9 A;  4INB A;  4E91 A;  2N50 A;  1VQP P;  4E92 A;  4PWV B;  2JO0 A;  2MD9 A;  4XFZ A;  2K0Y A;  2WLV B;  2OTL P;  1Q86 Q;  2K0X A;  4NEO A;  3DS1 A;  1IMP A;  4UHP B;  2LIW A;  3H47 A;  1RO2 A;  2FHS C;  4BPF A;  2QA4 P;  3G21 A;  1M90 Q;  1HQB A;  2MR8 A;  1M6E X;  4QKO A;  2LPK A;  1JJ2 O;  4U0A A;  2GZJ A;  3CCU P;  3I55 P;  2PWO A;  3DS2 A;  2JAZ A;  1L6N A;  2N5I A;  3G1I A;  2QNW A;  2K92 A;  2GDW A;  4PXH B;  1ACP A;  2KW2 A;  1E0H A;  3G71 P;  2N5H A;  1FR2 A;  2KG8 A;  2PY8 A;  1L0I A;  1L0H A;  2KGD A;  3DS5 A;  2M8P A;  1K30 A;  1UJZ A;  2PEN A;  2X83 A;  2GZG A;  5BS1 A;  1M9Y C;  3G28 A;  4GR6 A;  7CEI A;  2CGQ A;  2ERH A;  1RNI A;  2X2B A;  5HGO A;  2KWL A;  2OTJ P;  3VRL C;  4U0C A;  4WYM A;  2GYK A;  1HY8 A;  1IUQ A;  2GON A;  2VSQ A;  2PWM A;  2PEQ A;  2M5R A;  2Z46 A;  2NO8 A;  1VQ5 P;  2L4B A;  4GR2 A;  1YI2 P;  4DGA C;  4XRQ A;  2MVV A;  2M8L A;  1G03 A;  2KOD A;  4BPH A;  3CCR P;  1YIT P;  2VLP A;  2JPR A;  5HGN A;  3U43 A;  5HVC A;  5F2O A;  3CCE P;  2JYG A;  2X2D D;  3CCM P;  1QRJ A;  4U0F A;  1DV5 A;  2K94 A;  5EJD A;  3CD6 P;  1RO0 A;  5I4T G;  3GJN A;  2EIA A;  1BXI A;  1YJW P;  1X3O A;  3CC2 P;  2CNR A;  1EIA A;  4F37 A;  2EFJ A;  2L6E A;  3CC7 P;  2FAD A;  2JU2 A;  1VQK P;  1M1K Q;  3P05 A;  2KOS A;  1UNK A;  4PH0 A;  1QVG O;  1DNY A;  1M9E C;  1F80 D;  2EHT A; 
#chains in the Genus database with same CATH homology
 2XGV A;  3MGE A;  2ONT A;  5DCK A;  2XT1 A;  1W2B O;  3CCU P;  1VQM P;  1E6J P;  3I55 P;  2PWO A;  2XV6 A;  3DS2 A;  2V4X A;  1KC8 Q;  1K8A Q;  5HGK A;  1L6N A;  4PH1 A;  1YIJ P;  1M6N A;  2PEI A;  3G1I A;  5BS2 A;  1AFV A;  4M0I A;  2P9X A;  3CXC O;  2XGY A;  4QNB A;  1AUM A;  5F2K A;  3WBH A;  4U0B A;  3G71 P;  1EOQ A;  3DS3 A;  4PH2 A;  2PY8 A;  3G0V A;  1VQ8 P;  1VQL P;  1YJN P;  3HYB A;  2X82 A;  1NJI Q;  3H4E A;  3DS5 A;  3E2D A;  2M8P A;  1K30 A;  4U0D A;  2GOL B;  4DGE C;  4XFX A;  3G29 A;  4NX4 C;  3I56 P;  4COC A;  4XRO A;  2X83 A;  2PEN A;  2Z44 A;  5BS1 A;  1M9Y C;  2BHV A;  2PEO A;  3G28 A;  4LQW C;  4XFY A;  1GWP A;  4GR6 A;  1VQ4 P;  3NTE A;  3RG6 C;  4B4N A;  1Q81 Q;  1RNI A;  3B5I A;  3G6E P;  5HGO A;  1P7N A;  1ZMB A;  3CCS P;  3CPW O;  5HGM A;  3DTJ A;  2OTJ P;  2Y4Z A;  3HZQ A;  5F2N A;  3VRL C;  4U0C A;  4WYM A;  5HGL A;  2OAR A;  2LF4 A;  1K73 Q;  2KGF A;  1M9C C;  1EM9 A;  1KD1 Q;  1IUQ A;  2GON A;  3M1M A;  2PWM A;  2WLV A;  2PEQ A;  2Z46 A;  1VQ5 P;  1BAJ A;  4GR2 A;  1YI2 P;  1QVF O;  4DGA C;  4XRQ A;  2E1M A;  3CMA P;  3CCJ P;  2M8L A;  1N8R Q;  3CC4 P;  1G03 A;  2KOD A;  1YIT P;  3CCR P;  3CME P;  1VQN P;  2Z45 A;  3G1G A;  3Q20 A;  3CCV P;  2PEM A;  2JPR A;  2BUO A;  2EG5 A;  3DPH A;  1K9M Q;  1Q82 Q;  2PXR C;  5HGN A;  1Q7Y Q;  1M9F C;  2PEK A;  4COP A;  4J93 A;  5F2O A;  3OW2 O;  1A8O A;  1U7K A;  2XDE A;  3CCE P;  2JYG A;  2X2D D;  3BP9 A;  4INB A;  4E91 A;  3CCM P;  1QRJ A;  1M9X C;  4U0F A;  3H0D A;  3DS4 A;  1VQP P;  3G26 A;  1VQ7 P;  3G4S P;  4IPY A;  4E92 A;  2JO0 A;  4XFZ A;  1AK4 C;  4U0E A;  4PH3 A;  4HTW A;  3CD6 P;  2PEJ A;  1RO0 A;  5I4T G;  1S72 P;  2EIA A;  2WLV B;  1VQ6 P;  2CWO A;  2OTL P;  1Q86 Q;  1VQO P;  1YJW P;  3CC2 P;  1EIA A;  3DS1 A;  3DS0 A;  2EFJ A;  3CCL P;  1KQS O;  2QEX P;  2L6E A;  1YHQ P;  3CC7 P;  2XGU A;  3H47 A;  1RO2 A;  2DGY A;  2M8N A;  1YJ9 P;  1VQK P;  1M1K Q;  1VQ9 P;  1M74 A;  3P05 A;  2QA4 P;  3G21 A;  1M90 Q;  4PH0 A;  1QVG O;  1M9D C;  5JPA A;  1M6E X;  3LRY A;  1M9E C;  1D1D A;  1A43 A;  2XXM A;  1JJ2 O;  3CCQ P;  2JYL A;  4U0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...