4U0CA

Hexameric hiv-1 ca in complex with nup153 peptide, p6 crystal form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
210
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKTETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 74
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0cA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0cA02
2WLVA 2JYGA 3DS5A 3G21A 2BUOA 4XFYA 1L6NA 2V4XA 5I4TG 2XGYA 4B4NA 2JYLA 5JPAA 3DS4A 2L6EA 1AFVA 4NX4C 3DS0A 3LRYA 1P7NA 4U0AA 3DS2A 4E91A 3H4EA 3DS3A 4PH1A 1A8OA 2XV6A 2PXRC 3H47A 4DGAC 1D1DA 2XDEA 4E92A 2XXMA 4U0BA 2KGFA 1EM9A 3DPHA 1U7KA 2XGVA 4U0FA 1BAJA 3G1IA 1QRJA 2ONTA 4INBA 1AUMA 1G03A 5HGOA 3P05A 1M9YC 2M8NA 2JPRA 3DS1A 1A43A 1EIAA 4COPA 4XFZA 2Y4ZA 1GWPA 2GONA 1E6JP 5HGNA 2PWOA 2XT1A 3G28A 3G29A 1M9EC 4XROA 5HGMA 2WLVB 2JO0A 4J93A 3DTJA 4U0DA 4LQWC 4DGEC 3VRLC 4COCA 2M8LA 4HTWA 4PH2A 1M9XC 2X82A 2PWMA 2XGUA 4U0EA 2M8PA 5DCKA 4QNBA 4PH3A 1M9CC 1M9DC 2EIAA 5HGKA 3G1GA 4IPYA 2X2DD 2GOLB 2X83A 3MGEA 1M9FC 4WYMA 3NTEA 4M0IA 3BP9A 5HGLA 1EOQA 2LF4A 4PH0A 2KODA 4XFXA 4XRQA 4U0CA 1AK4C 3G0VA 3G26A
chains in the Genus database with same CATH superfamily
4DG9A 3DS5A 2KGEA 2MVVA 2V4XA 2L22A 5EW5E 1VQ5P 2JYLA 5JPAA 4GR6A 2L6EA 1Q86Q 4CA3A 2L4BA 3DS2A 3RG6C 1Z6MA 2CWOA 4E91A 2KORA 1UJZA 1L0IA 3DS3A 1M6NA 2XV6A 1VQ4P 3H47A 3LMOA 1D1DA 3CCQP 2EHTA 2FVEA 1NQ4A 2FHSC 1U7KA 2AF8A 1BAJA 2K5XA 1OR5A 2N50A 4QKOA 4INBA 3GJNA 1ZNVA 1M9YC 2KOSA 1W2BO 2JPRA 5F2KA 1EIAA 1VQPP 2Y4ZA 1E6JP 1YHQP 2FACA 3EJBA 1YJWP 2PWOA 3H0DA 1IUQA 1VQ9P 1M9EC 1BXIA 2FADA 1K30A 2VLOA 2MR8A 2WPTA 3DTJA 2M8LA 1RNIA 1JJ2O 2XGUA 1YJNP 1YIJP 4PWVB 1M9DC 2FAEA 2X83A 2P9XA 2N6YA 3HZQA 2K94A 3CCSP 3NTEA 1KLPA 2LF4A 2KGAA 2N5IA 2N98A 4H2YC 4XRQA 4U0CA 1VQNP 2JQ4A 2PEMA 1M1KQ 3G21A 1MZ8A 5F2NA 2BUOA 3G6EP 1L6NA 4F37A 4H2WC 2N5HA 2FQ2A 5I4TG 5F2OA 2XGYA 1VQ8P 2PNGA 4MRTC 4B4NA 3DS4A 3DS0A 1AFVA 4NX4C 4U0AA 1VHNA 1T8KA 1ZMBA 1KC8Q 4PH1A 2PXRC 1VQLP 3NY7B 1K73Q 2CNRA 2XDEA 2VSQA 4E92A 2LL8A 2FQ0A 4NEOA 1X3OA 2VLQA 3G71P 2ONTA 3CCLP 1RO2A 3CCUP 1G03A 5BS2A 3I56P 2LIUA 1GWPA 2CG5B 1VQ6P 3CMEP 3EJEA 2GZFA 3I55P 1IMQA 2L9FA 5KP7B 4HKGA 3CMAP 4LQWC 2MVUA 2KGCA 1EMVA 2OARA 2GZEA 1UNKA 1K8AQ 1VQ7P 2VLNA 1M9XC 1N8RQ 2PWMA 4U0EA 2JGPA 2KOOA 4QNBA 2EIAA 5HGKA 3G1GA 2X2DD 2GOLB 2K0YA 1M9FC 1K9MQ 2K0XA 4BPHA 3BP9A 5HGLA 2KODA 2MF4A 2LTEA 2GDWA 2MR7A 2K2QA 4BPGA 1YI2P 4UHPB 2JYGA 2KW2A 1HY8A 2KG8A 2LKIA 1Q82Q 1VQOP 2MY5A 3EJDA 1ACPA 2KR5A 4BPFA 2AFEA 3H4EA 3RG2A 2N6ZA 2OTLP 2PEOA 3CCRP 5BS1A 2L0QA 1M74A 1M90Q 2NO8A 3WBHA 2JAZA 2KWLA 4U0BA 2JU1A 2KGFA 1EM9A 3DPHA 3CCVP 1E0HA 2AVAA 3CD6P 1YITP 2XGVA 2Z45A 2FVFA 3M1MA 3G1IA 1QRJA 2Z46A 3Q20A 1AUMA 2GZIA 2EHSA 2QNWA 2K93A 2M8NA 5KP8B 3OW2O 1A43A 4COPA 2GONA 2DNWA 2XT1A 3GZLA 2AFDA 2EFJA 4XROA 2PENA 5HGMA 2WLVB 1S72P 2PY8A 2CQ8A 3G4SP 4U0DA 2X2BA 1IMPA 4DGEC 3VRLC 2GDXA 2PEJA 2QA4P 4COCA 5HV8A 4HTWA 1F80D 2KOPA 2KGDA 2KG9A 1QVFO 2X82A 2M8PA 2GZGA 5DCKA 1KQSO 2PEQA 4PH3A 1DNYA 2OTJP 2E1MA 2EG5A 2ROQA 2VLPA 2QEXP 1YJ9P 1VQKP 3HYBA 2M5RA 3CC4P 1AK4C 3G0VA 3G26A 2JU2A 2LMLA 2WLVA 5EJDA 3CPWO 2GZJA 1QVGO 1CEIA 1GXHA 1HQBA 4XFYA 3B5IA 3CXCO 5CZDB 4IZ6A 1GXGA 3LRYA 1P7NA 3CCJP 1M6EX 5HVCA 1A8OA 4R0MA 1RO0A 2Z44A 4DGAC 1AF8A 2GDYA 2BHVA 2XXMA 1DV5A 2K92A 4U0FA 2CGQA 2PEKA 1Q7YQ 3GKLC 5HGOA 2PEIA 2GYKA 3P05A 2JB0A 3CE7A 3E2DA 3GZMA 3DS1A 4XFZA 3CCMP 1AYIA 5HGNA 2FQ1A 2LIWA 3G28A 3G29A 3B4QA 1GPJA 1Q81Q 2ERHA 2LPKA 3U43A 2JO0A 4J93A 2XZ1C 1NJIQ 1FR2A 2FVAA 2MD9A 1KD1Q 7CEIA 3CC7P 4H2XC 2JBGA 4PH2A 2DGYA 2KOQA 1M9CC 4IPYA 3CCEP 4GR2A 3MGEA 2XZ0D 1VQMP 3CC2P 4WYMA 1VKUA 2KG6A 4M0IA 2LOLA 1EOQA 4PH0A 5KP6B 4XFXA 4PXHB 1L0HA 2K0DX
chains in the Genus database with same CATH topology
1YI2P 2WLVA 1M1KQ 2JYGA 3DS5A 3G21A 3CPWO 5F2NA 1QVGO 2BUOA 3G6EP 4XFYA 1L6NA 3B5IA 2V4XA 3CXCO 5I4TG 1Q82Q 5F2OA 2XGYA 1VQ8P 1VQOP 1VQ5P 4B4NA 2JYLA 5JPAA 3DS4A 2L6EA 1AFVA 4NX4C 3DS0A 3LRYA 4GR6A 1Q86Q 1P7NA 4U0AA 3CCJP 3DS2A 3RG6C 2CWOA 4E91A 3H4EA 1M6EX 1ZMBA 2OTLP 3DS3A 1M6NA 4PH1A 1KC8Q 1A8OA 2XV6A 2PXRC 2PEOA 3CCRP 3H47A 1VQ4P 5BS1A 1VQLP 1RO0A 1K73Q 1M74A 2Z44A 4DGAC 1D1DA 3CCQP 1M90Q 2XDEA 4E92A 2BHVA 3WBHA 2XXMA 4U0BA 2KGFA 1EM9A 3DPHA 3CCVP 1U7KA 3CD6P 1YITP 2XGVA 4U0FA 1BAJA 2Z45A 3M1MA 3G1IA 1QRJA 2Z46A 3G71P 2ONTA 3CCLP 4INBA 1RO2A 2PEKA 3Q20A 1AUMA 3CCUP 1Q7YQ 1G03A 5HGOA 5BS2A 2PEIA 3I56P 3P05A 1M9YC 1W2BO 3E2DA 2M8NA 2JPRA 5F2KA 3OW2O 3DS1A 1A43A 1EIAA 4COPA 4XFZA 1VQPP 2Y4ZA 1GWPA 2GONA 1E6JP 3CCMP 1YHQP 5HGNA 1YJWP 2PWOA 2XT1A 3G28A 3H0DA 1IUQA 1VQ9P 3G29A 1VQ6P 1Q81Q 1M9EC 2EFJA 1K30A 4XROA 2PENA 3CMEP 5HGMA 2WLVB 2JO0A 3I55P 1S72P 2PY8A 4J93A 3G4SP 1NJIQ 3DTJA 3CMAP 1KD1Q 4U0DA 4LQWC 3CC7P 4DGEC 3VRLC 2OARA 2PEJA 2QA4P 4COCA 2M8LA 4HTWA 1K8AQ 1VQ7P 1RNIA 4PH2A 1QVFO 1M9XC 2X82A 1N8RQ 2PWMA 1JJ2O 2XGUA 1YJNP 1YIJP 4U0EA 2M8PA 5DCKA 4QNBA 2DGYA 1KQSO 2PEQA 4PH3A 1M9CC 1M9DC 2EIAA 5HGKA 3G1GA 4IPYA 3CCEP 4GR2A 2E1MA 2OTJP 2X2DD 2GOLB 2X83A 3MGEA 2EG5A 2P9XA 1VQMP 3HZQA 3CCSP 3CC2P 1M9FC 4WYMA 1K9MQ 3NTEA 4M0IA 2QEXP 3BP9A 5HGLA 1EOQA 1YJ9P 2LF4A 4PH0A 2KODA 4XFXA 4XRQA 1VQKP 3HYBA 4U0CA 3CC4P 1VQNP 1AK4C 2PEMA 3G0VA 3G26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLV A;  2JYG A;  3DS5 A;  3G21 A;  2BUO A;  4XFY A;  1L6N A;  2V4X A;  5I4T G;  2XGY A;  4B4N A;  2JYL A;  5JPA A;  3DS4 A;  2L6E A;  1AFV A;  4NX4 C;  3DS0 A;  3LRY A;  1P7N A;  4U0A A;  3DS2 A;  4E91 A;  3H4E A;  3DS3 A;  4PH1 A;  1A8O A;  2XV6 A;  2PXR C;  3H47 A;  4DGA C;  1D1D A;  2XDE A;  4E92 A;  2XXM A;  4U0B A;  2KGF A;  1EM9 A;  3DPH A;  1U7K A;  2XGV A;  4U0F A;  1BAJ A;  3G1I A;  1QRJ A;  2ONT A;  4INB A;  1AUM A;  1G03 A;  5HGO A;  3P05 A;  1M9Y C;  2M8N A;  2JPR A;  3DS1 A;  1A43 A;  1EIA A;  4COP A;  4XFZ A;  2Y4Z A;  1GWP A;  2GON A;  1E6J P;  5HGN A;  2PWO A;  2XT1 A;  3G28 A;  3G29 A;  1M9E C;  4XRO A;  5HGM A;  2WLV B;  2JO0 A;  4J93 A;  3DTJ A;  4U0D A;  4LQW C;  4DGE C;  3VRL C;  4COC A;  2M8L A;  4HTW A;  4PH2 A;  1M9X C;  2X82 A;  2PWM A;  2XGU A;  4U0E A;  2M8P A;  5DCK A;  4QNB A;  4PH3 A;  1M9C C;  1M9D C;  2EIA A;  5HGK A;  3G1G A;  4IPY A;  2X2D D;  2GOL B;  2X83 A;  3MGE A;  1M9F C;  4WYM A;  3NTE A;  4M0I A;  3BP9 A;  5HGL A;  1EOQ A;  2LF4 A;  4PH0 A;  2KOD A;  4XFX A;  4XRQ A;  4U0C A;  1AK4 C;  3G0V A;  3G26 A; 
#chains in the Genus database with same CATH topology
 4DG9 A;  3DS5 A;  2KGE A;  2MVV A;  2V4X A;  2L22 A;  5EW5 E;  1VQ5 P;  2JYL A;  5JPA A;  4GR6 A;  2L6E A;  1Q86 Q;  4CA3 A;  2L4B A;  3DS2 A;  3RG6 C;  1Z6M A;  2CWO A;  4E91 A;  2KOR A;  1UJZ A;  1L0I A;  3DS3 A;  1M6N A;  2XV6 A;  1VQ4 P;  3H47 A;  3LMO A;  1D1D A;  3CCQ P;  2EHT A;  2FVE A;  1NQ4 A;  2FHS C;  1U7K A;  2AF8 A;  1BAJ A;  2K5X A;  1OR5 A;  2N50 A;  4QKO A;  4INB A;  3GJN A;  1ZNV A;  1M9Y C;  2KOS A;  1W2B O;  2JPR A;  5F2K A;  1EIA A;  1VQP P;  2Y4Z A;  1E6J P;  1YHQ P;  2FAC A;  3EJB A;  1YJW P;  2PWO A;  3H0D A;  1IUQ A;  1VQ9 P;  1M9E C;  1BXI A;  2FAD A;  1K30 A;  2VLO A;  2MR8 A;  2WPT A;  3DTJ A;  2M8L A;  1RNI A;  1JJ2 O;  2XGU A;  1YJN P;  1YIJ P;  4PWV B;  1M9D C;  2FAE A;  2X83 A;  2P9X A;  2N6Y A;  3HZQ A;  2K94 A;  3CCS P;  3NTE A;  1KLP A;  2LF4 A;  2KGA A;  2N5I A;  2N98 A;  4H2Y C;  4XRQ A;  4U0C A;  1VQN P;  2JQ4 A;  2PEM A;  1M1K Q;  3G21 A;  1MZ8 A;  5F2N A;  2BUO A;  3G6E P;  1L6N A;  4F37 A;  4H2W C;  2N5H A;  2FQ2 A;  5I4T G;  5F2O A;  2XGY A;  1VQ8 P;  2PNG A;  4MRT C;  4B4N A;  3DS4 A;  3DS0 A;  1AFV A;  4NX4 C;  4U0A A;  1VHN A;  1T8K A;  1ZMB A;  1KC8 Q;  4PH1 A;  2PXR C;  1VQL P;  3NY7 B;  1K73 Q;  2CNR A;  2XDE A;  2VSQ A;  4E92 A;  2LL8 A;  2FQ0 A;  4NEO A;  1X3O A;  2VLQ A;  3G71 P;  2ONT A;  3CCL P;  1RO2 A;  3CCU P;  1G03 A;  5BS2 A;  3I56 P;  2LIU A;  1GWP A;  2CG5 B;  1VQ6 P;  3CME P;  3EJE A;  2GZF A;  3I55 P;  1IMQ A;  2L9F A;  5KP7 B;  4HKG A;  3CMA P;  4LQW C;  2MVU A;  2KGC A;  1EMV A;  2OAR A;  2GZE A;  1UNK A;  1K8A Q;  1VQ7 P;  2VLN A;  1M9X C;  1N8R Q;  2PWM A;  4U0E A;  2JGP A;  2KOO A;  4QNB A;  2EIA A;  5HGK A;  3G1G A;  2X2D D;  2GOL B;  2K0Y A;  1M9F C;  1K9M Q;  2K0X A;  4BPH A;  3BP9 A;  5HGL A;  2KOD A;  2MF4 A;  2LTE A;  2GDW A;  2MR7 A;  2K2Q A;  4BPG A;  1YI2 P;  4UHP B;  2JYG A;  2KW2 A;  1HY8 A;  2KG8 A;  2LKI A;  1Q82 Q;  1VQO P;  2MY5 A;  3EJD A;  1ACP A;  2KR5 A;  4BPF A;  2AFE A;  3H4E A;  3RG2 A;  2N6Z A;  2OTL P;  2PEO A;  3CCR P;  5BS1 A;  2L0Q A;  1M74 A;  1M90 Q;  2NO8 A;  3WBH A;  2JAZ A;  2KWL A;  4U0B A;  2JU1 A;  2KGF A;  1EM9 A;  3DPH A;  3CCV P;  1E0H A;  2AVA A;  3CD6 P;  1YIT P;  2XGV A;  2Z45 A;  2FVF A;  3M1M A;  3G1I A;  1QRJ A;  2Z46 A;  3Q20 A;  1AUM A;  2GZI A;  2EHS A;  2QNW A;  2K93 A;  2M8N A;  5KP8 B;  3OW2 O;  1A43 A;  4COP A;  2GON A;  2DNW A;  2XT1 A;  3GZL A;  2AFD A;  2EFJ A;  4XRO A;  2PEN A;  5HGM A;  2WLV B;  1S72 P;  2PY8 A;  2CQ8 A;  3G4S P;  4U0D A;  2X2B A;  1IMP A;  4DGE C;  3VRL C;  2GDX A;  2PEJ A;  2QA4 P;  4COC A;  5HV8 A;  4HTW A;  1F80 D;  2KOP A;  2KGD A;  2KG9 A;  1QVF O;  2X82 A;  2M8P A;  2GZG A;  5DCK A;  1KQS O;  2PEQ A;  4PH3 A;  1DNY A;  2OTJ P;  2E1M A;  2EG5 A;  2ROQ A;  2VLP A;  2QEX P;  1YJ9 P;  1VQK P;  3HYB A;  2M5R A;  3CC4 P;  1AK4 C;  3G0V A;  3G26 A;  2JU2 A;  2LML A;  2WLV A;  5EJD A;  3CPW O;  2GZJ A;  1QVG O;  1CEI A;  1GXH A;  1HQB A;  4XFY A;  3B5I A;  3CXC O;  5CZD B;  4IZ6 A;  1GXG A;  3LRY A;  1P7N A;  3CCJ P;  1M6E X;  5HVC A;  1A8O A;  4R0M A;  1RO0 A;  2Z44 A;  4DGA C;  1AF8 A;  2GDY A;  2BHV A;  2XXM A;  1DV5 A;  2K92 A;  4U0F A;  2CGQ A;  2PEK A;  1Q7Y Q;  3GKL C;  5HGO A;  2PEI A;  2GYK A;  3P05 A;  2JB0 A;  3CE7 A;  3E2D A;  3GZM A;  3DS1 A;  4XFZ A;  3CCM P;  1AYI A;  5HGN A;  2FQ1 A;  2LIW A;  3G28 A;  3G29 A;  3B4Q A;  1GPJ A;  1Q81 Q;  2ERH A;  2LPK A;  3U43 A;  2JO0 A;  4J93 A;  2XZ1 C;  1NJI Q;  1FR2 A;  2FVA A;  2MD9 A;  1KD1 Q;  7CEI A;  3CC7 P;  4H2X C;  2JBG A;  4PH2 A;  2DGY A;  2KOQ A;  1M9C C;  4IPY A;  3CCE P;  4GR2 A;  3MGE A;  2XZ0 D;  1VQM P;  3CC2 P;  4WYM A;  1VKU A;  2KG6 A;  4M0I A;  2LOL A;  1EOQ A;  4PH0 A;  5KP6 B;  4XFX A;  4PXH B;  1L0H A;  2K0D X; 
#chains in the Genus database with same CATH homology
 1YI2 P;  2WLV A;  1M1K Q;  2JYG A;  3DS5 A;  3G21 A;  3CPW O;  5F2N A;  1QVG O;  2BUO A;  3G6E P;  4XFY A;  1L6N A;  3B5I A;  2V4X A;  3CXC O;  5I4T G;  1Q82 Q;  5F2O A;  2XGY A;  1VQ8 P;  1VQO P;  1VQ5 P;  4B4N A;  2JYL A;  5JPA A;  3DS4 A;  2L6E A;  1AFV A;  4NX4 C;  3DS0 A;  3LRY A;  4GR6 A;  1Q86 Q;  1P7N A;  4U0A A;  3CCJ P;  3DS2 A;  3RG6 C;  2CWO A;  4E91 A;  3H4E A;  1M6E X;  1ZMB A;  2OTL P;  3DS3 A;  1M6N A;  4PH1 A;  1KC8 Q;  1A8O A;  2XV6 A;  2PXR C;  2PEO A;  3CCR P;  3H47 A;  1VQ4 P;  5BS1 A;  1VQL P;  1RO0 A;  1K73 Q;  1M74 A;  2Z44 A;  4DGA C;  1D1D A;  3CCQ P;  1M90 Q;  2XDE A;  4E92 A;  2BHV A;  3WBH A;  2XXM A;  4U0B A;  2KGF A;  1EM9 A;  3DPH A;  3CCV P;  1U7K A;  3CD6 P;  1YIT P;  2XGV A;  4U0F A;  1BAJ A;  2Z45 A;  3M1M A;  3G1I A;  1QRJ A;  2Z46 A;  3G71 P;  2ONT A;  3CCL P;  4INB A;  1RO2 A;  2PEK A;  3Q20 A;  1AUM A;  3CCU P;  1Q7Y Q;  1G03 A;  5HGO A;  5BS2 A;  2PEI A;  3I56 P;  3P05 A;  1M9Y C;  1W2B O;  3E2D A;  2M8N A;  2JPR A;  5F2K A;  3OW2 O;  3DS1 A;  1A43 A;  1EIA A;  4COP A;  4XFZ A;  1VQP P;  2Y4Z A;  1GWP A;  2GON A;  1E6J P;  3CCM P;  1YHQ P;  5HGN A;  1YJW P;  2PWO A;  2XT1 A;  3G28 A;  3H0D A;  1IUQ A;  1VQ9 P;  3G29 A;  1VQ6 P;  1Q81 Q;  1M9E C;  2EFJ A;  1K30 A;  4XRO A;  2PEN A;  3CME P;  5HGM A;  2WLV B;  2JO0 A;  3I55 P;  1S72 P;  2PY8 A;  4J93 A;  3G4S P;  1NJI Q;  3DTJ A;  3CMA P;  1KD1 Q;  4U0D A;  4LQW C;  3CC7 P;  4DGE C;  3VRL C;  2OAR A;  2PEJ A;  2QA4 P;  4COC A;  2M8L A;  4HTW A;  1K8A Q;  1VQ7 P;  1RNI A;  4PH2 A;  1QVF O;  1M9X C;  2X82 A;  1N8R Q;  2PWM A;  1JJ2 O;  2XGU A;  1YJN P;  1YIJ P;  4U0E A;  2M8P A;  5DCK A;  4QNB A;  2DGY A;  1KQS O;  2PEQ A;  4PH3 A;  1M9C C;  1M9D C;  2EIA A;  5HGK A;  3G1G A;  4IPY A;  3CCE P;  4GR2 A;  2E1M A;  2OTJ P;  2X2D D;  2GOL B;  2X83 A;  3MGE A;  2EG5 A;  2P9X A;  1VQM P;  3HZQ A;  3CCS P;  3CC2 P;  1M9F C;  4WYM A;  1K9M Q;  3NTE A;  4M0I A;  2QEX P;  3BP9 A;  5HGL A;  1EOQ A;  1YJ9 P;  2LF4 A;  4PH0 A;  2KOD A;  4XFX A;  4XRQ A;  1VQK P;  3HYB A;  4U0C A;  3CC4 P;  1VQN P;  1AK4 C;  2PEM A;  3G0V A;  3G26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...