4U0CA

Hexameric hiv-1 ca in complex with nup153 peptide, p6 crystal form
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
219
structure length
210
Chain Sequence
b'PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKTETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
molecule tags Viral protein
source organism Human immunodeficiency virus type 1 group m subtype b
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
total genus 74
structure length 210
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0cA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0cA02
2EIAA 4PH2A 3G28A 3NTEA 3DS3A 2JO0A 5HGLA 3G29A 2JYLA 1M9FC 5HGNA 2XGUA 1EOQA 4PH3A 3G1IA 1M9EC 4U0AA 3H47A 3G26A 2PWOA 4XFYA 4PH1A 3DTJA 5HGOA 4XFZA 4XFXA 3DS5A 3G0VA 2WLVB 3VRLC 1EM9A 3LRYA 1EIAA 2X83A 4U0DA 3DS2A 2XGVA 2V4XA 2ONTA 5I4TG 2PXRC 4E92A 5HGKA 1M9YC 1E6JP 1M9DC 2GONA 5HGMA 2L6EA 4XROA 1P7NA 1U7KA 1AFVA 3MGEA 2X82A 2GOLB 2XV6A 4U0BA 4B4NA 2M8LA 1M9XC 2M8NA 4U0CA 2JPRA 1BAJA 5JPAA 3P05A 2XXMA 1D1DA 5DCKA 3G21A 3DS4A 2X2DD 4E91A 4LQWC 4COCA 1M9CC 4HTWA 4NX4C 4J93A 4XRQA 2WLVA 1AK4C 2BUOA 1G03A 3DS1A 3DPHA 1AUMA 4U0EA 2Y4ZA 4DGEC 3DS0A 2JYGA 4QNBA 4M0IA 2M8PA 2XDEA 4INBA 4PH0A 4U0FA 4IPYA 3BP9A 4COPA 3G1GA 2KGFA 2LF4A 2KODA 3H4EA 1A43A 2XT1A 2PWMA 4DGAC 1QRJA 2XGYA 4WYMA 1GWPA 1A8OA 1L6NA
chains in the Genus database with same CATH superfamily
4PH2A 4BPHA 1K8AQ 2L0QA 1K9MQ 3NTEA 2AFEA 2Z44A 5HGNA 2XGUA 1KC8Q 4U0AA 2FHSC 3G26A 4XFYA 4BPGA 4PH1A 5CZDB 1IMQA 3EJBA 2K94A 2VLPA 2KOOA 1EM9A 1NQ4A 3LRYA 2LMLA 2X83A 2EFJA 1VQKP 2XGVA 2K0DX 2PY8A 2N5IA 4PWVB 2LTEA 2PXRC 3CCEP 3NY7B 2FADA 2L6EA 4XROA 1P7NA 2PEQA 2XZ0D 2CQ8A 2MVUA 4B4NA 4NEOA 2GDWA 5BS1A 1IMPA 3I55P 3CMEP 1MZ8A 2KOQA 5DCKA 3G21A 1YIJP 4GR2A 1K73Q 5HV8A 1RNIA 2L4BA 4HTWA 2EHSA 1VQLP 1F80D 4H2YC 2Y4ZA 4QKOA 2DGYA 2K0YA 1RO0A 2N50A 5KP6B 4INBA 4U0FA 3CC7P 2K2QA 3RG6C 3CMAP 2Z45A 4GR6A 1A43A 2N5HA 2FAEA 2XGYA 1ZNVA 1S72P 2GYKA 1GWPA 1VQPP 2P9XA 5KP8B 2MR7A 2KORA 3DS3A 1VQMP 1IUQA 2GDXA 1EOQA 1YJNP 4PH3A 3G1IA 3H47A 4BPFA 2PWOA 2FVAA 3DTJA 3G0VA 4XFZA 2OTLP 3WBHA 2MY5A 1VQ6P 2WLVB 2KWLA 1X3OA 3DS2A 2WPTA 2V4XA 5I4TG 3GJNA 5HGMA 2K93A 2DNWA 2K0XA 1AFVA 3CCSP 4U0BA 2M8LA 2M5RA 7CEIA 4HKGA 1M90Q 2M8NA 1CEIA 1HY8A 2JPRA 1BXIA 3P05A 2XXMA 2X2DD 3H0DA 2KG8A 4COCA 4NX4C 5KP7B 1Q7YQ 2WLVA 1M6NA 3EJEA 2BUOA 2JU2A 3DS1A 1AUMA 2VLOA 2CG5B 3DS0A 3E2DA 3CCMP 1N8RQ 4QNBA 2FVFA 2L22A 2M8PA 2JGPA 1KQSO 2K5XA 4PH0A 2JQ4A 2FACA 4F37A 4COPA 1GXHA 3CCQP 1VHNA 1Q86Q 2LOLA 2EG5A 1AF8A 1GPJA 1JJ2O 2AFDA 4DGAC 2KW2A 4UHPB 1M74A 1DNYA 3M1MA 2OARA 1YJ9P 1VQ8P 1L6NA 4DG9A 2N6YA 1YJWP 2EIAA 3G28A 2PENA 3OW2O 1W2BO 2ROQA 4R0MA 2JYLA 1M9FC 1YI2P 3G71P 1YHQP 2K92A 1M9EC 1VQNP 2NO8A 3CC2P 2GZIA 2CWOA 5HGOA 4XFXA 3DS5A 4MRTC 3VRLC 1YITP 1Q81Q 3RG2A 1VQOP 1VQ7P 2LIWA 5HGKA 2FQ2A 1M9YC 2PEKA 3HZQA 2MD9A 3B4QA 4PXHB 1VQ4P 2PEJA 2KGEA 3MGEA 2X82A 3CCRP 2GDYA 2KGAA 1M6EX 1E0HA 2GZEA 1UNKA 2JB0A 1M9XC 1ACPA 3G6EP 2LL8A 1BAJA 1K30A 1FR2A 2KG9A 3LMOA 2KG6A 2KR5A 2GZJA 1L0IA 1M9CC 1VQ9P 1AK4C 2PEIA 4DGEC 2FQ1A 4H2WC 2KGCA 2KOPA 3GZMA 1QVGO 4M0IA 2BHVA 3CPWO 2PEOA 2LKIA 3GZLA 2AF8A 4IPYA 3BP9A 3G1GA 1EMVA 3CXCO 2LF4A 2KODA 3H4EA 3G4SP 2PWMA 2LIUA 1QRJA 4WYMA 2XZ1C 3CE7A 1A8OA 1VQ5P 2CGQA 1GXGA 2E1MA 2JAZA 3GKLC 4IZ6A 2JO0A 2VLQA 5HGLA 3G29A 5EJDA 3CD6P 3CCJP 1Q82Q 3CC4P 1L0HA 1Z6MA 1T8KA 1KLPA 2FQ0A 2GZGA 1EIAA 4U0DA 5EW5E 2GZFA 2ONTA 2PEMA 2QA4P 2X2BA 4H2XC 2MVVA 4E92A 5F2OA 2VSQA 5HVCA 1E6JP 1M9DC 1UJZA 2GONA 1HQBA 3CCUP 2AVAA 1U7KA 3EJDA 2GOLB 3U43A 2XV6A 2L9FA 4U0CA 3B5IA 5JPAA 2QNWA 3CCVP 1D1DA 5BS2A 1NJIQ 3DS4A 4E91A 1RO2A 2N6ZA 2QEXP 2JBGA 4LQWC 2KGDA 2FVEA 1OR5A 2LPKA 4J93A 4XRQA 2CNRA 1G03A 1KD1Q 3DPHA 3Q20A 4U0EA 1QVFO 1DV5A 2OTJP 2JYGA 1ZMBA 2VLNA 1M1KQ 2MR8A 2JU1A 5F2KA 2KOSA 1AYIA 2XDEA 3I56P 2Z46A 3HYBA 2PNGA 2N98A 2KGFA 3CCLP 2MF4A 5F2NA 2ERHA 2XT1A 1VKUA 4CA3A 2EHTA
chains in the Genus database with same CATH topology
2EIAA 4PH2A 3G28A 2E1MA 2PENA 1K8AQ 1K9MQ 3OW2O 1W2BO 3NTEA 3DS3A 1VQMP 2JO0A 5HGLA 3G29A 2JYLA 1M9FC 1IUQA 2Z44A 5HGNA 2XGUA 1EOQA 3CD6P 1YJNP 4PH3A 3G1IA 3G71P 3CCJP 1YHQP 1YI2P 1Q82Q 1KC8Q 3CC4P 1M9EC 4U0AA 1VQNP 3H47A 3CC2P 3G26A 2PWOA 4XFYA 4PH1A 3DTJA 2CWOA 5HGOA 4XFZA 4XFXA 3DS5A 3G0VA 2OTLP 3WBHA 1VQ6P 2WLVB 3VRLC 1EM9A 3LRYA 1YITP 1EIAA 2X83A 4U0DA 1Q81Q 2EFJA 1VQKP 3DS2A 2XGVA 2PY8A 1VQOP 2V4XA 2ONTA 1VQ7P 2PEMA 5I4TG 2QA4P 2PXRC 3CCEP 4E92A 5HGKA 5F2OA 1M9YC 1E6JP 1M9DC 2PEKA 3HZQA 2GONA 5HGMA 2L6EA 4XROA 3CCUP 1P7NA 1VQ4P 2PEJA 2PEQA 1U7KA 1AFVA 3MGEA 2X82A 2GOLB 3CCRP 2XV6A 3CCSP 4U0BA 4B4NA 2M8LA 1M6EX 1M9XC 1M90Q 2M8NA 4U0CA 3G6EP 3B5IA 5BS1A 2JPRA 1BAJA 1K30A 3I55P 5JPAA 3CMEP 3P05A 2XXMA 3CCVP 1D1DA 1YJWP 5DCKA 5BS2A 3G21A 1NJIQ 1YIJP 3DS4A 2X2DD 4GR2A 4E91A 3H0DA 1RO2A 1K73Q 2QEXP 4LQWC 1RNIA 4COCA 1M9CC 1VQ9P 4HTWA 4NX4C 4J93A 4XRQA 2WLVA 1Q7YQ 1AK4C 1M6NA 1VQLP 2BUOA 1G03A 3DS1A 1KD1Q 3DPHA 3Q20A 2PEIA 1AUMA 4U0EA 2Y4ZA 1QVFO 4DGEC 2OTJP 1QVGO 3DS0A 3E2DA 3CCMP 1N8RQ 2JYGA 2DGYA 4QNBA 4M0IA 1ZMBA 2M8PA 1M1KQ 2BHVA 3CPWO 1RO0A 2PEOA 5F2KA 1KQSO 2XDEA 3I56P 4INBA 2Z46A 4PH0A 4U0FA 3HYBA 4IPYA 3CC7P 3BP9A 4COPA 3G1GA 2KGFA 3CXCO 3CCLP 2LF4A 3RG6C 3CMAP 1VQPP 2Z45A 3CCQP 1Q86Q 2KODA 4GR6A 5F2NA 3H4EA 1A43A 2EG5A 3G4SP 1JJ2O 2XT1A 2PWMA 4DGAC 1M74A 1QRJA 2XGYA 4WYMA 3M1MA 1S72P 2OARA 1GWPA 1YJ9P 1A8OA 1VQ8P 1VQ5P 1L6NA 2P9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIA A;  4PH2 A;  3G28 A;  3NTE A;  3DS3 A;  2JO0 A;  5HGL A;  3G29 A;  2JYL A;  1M9F C;  5HGN A;  2XGU A;  1EOQ A;  4PH3 A;  3G1I A;  1M9E C;  4U0A A;  3H47 A;  3G26 A;  2PWO A;  4XFY A;  4PH1 A;  3DTJ A;  5HGO A;  4XFZ A;  4XFX A;  3DS5 A;  3G0V A;  2WLV B;  3VRL C;  1EM9 A;  3LRY A;  1EIA A;  2X83 A;  4U0D A;  3DS2 A;  2XGV A;  2V4X A;  2ONT A;  5I4T G;  2PXR C;  4E92 A;  5HGK A;  1M9Y C;  1E6J P;  1M9D C;  2GON A;  5HGM A;  2L6E A;  4XRO A;  1P7N A;  1U7K A;  1AFV A;  3MGE A;  2X82 A;  2GOL B;  2XV6 A;  4U0B A;  4B4N A;  2M8L A;  1M9X C;  2M8N A;  4U0C A;  2JPR A;  1BAJ A;  5JPA A;  3P05 A;  2XXM A;  1D1D A;  5DCK A;  3G21 A;  3DS4 A;  2X2D D;  4E91 A;  4LQW C;  4COC A;  1M9C C;  4HTW A;  4NX4 C;  4J93 A;  4XRQ A;  2WLV A;  1AK4 C;  2BUO A;  1G03 A;  3DS1 A;  3DPH A;  1AUM A;  4U0E A;  2Y4Z A;  4DGE C;  3DS0 A;  2JYG A;  4QNB A;  4M0I A;  2M8P A;  2XDE A;  4INB A;  4PH0 A;  4U0F A;  4IPY A;  3BP9 A;  4COP A;  3G1G A;  2KGF A;  2LF4 A;  2KOD A;  3H4E A;  1A43 A;  2XT1 A;  2PWM A;  4DGA C;  1QRJ A;  2XGY A;  4WYM A;  1GWP A;  1A8O A;  1L6N A; 
#chains in the Genus database with same CATH topology
 4PH2 A;  4BPH A;  1K8A Q;  2L0Q A;  1K9M Q;  3NTE A;  2AFE A;  2Z44 A;  5HGN A;  2XGU A;  1KC8 Q;  4U0A A;  2FHS C;  3G26 A;  4XFY A;  4BPG A;  4PH1 A;  5CZD B;  1IMQ A;  3EJB A;  2K94 A;  2VLP A;  2KOO A;  1EM9 A;  1NQ4 A;  3LRY A;  2LML A;  2X83 A;  2EFJ A;  1VQK P;  2XGV A;  2K0D X;  2PY8 A;  2N5I A;  4PWV B;  2LTE A;  2PXR C;  3CCE P;  3NY7 B;  2FAD A;  2L6E A;  4XRO A;  1P7N A;  2PEQ A;  2XZ0 D;  2CQ8 A;  2MVU A;  4B4N A;  4NEO A;  2GDW A;  5BS1 A;  1IMP A;  3I55 P;  3CME P;  1MZ8 A;  2KOQ A;  5DCK A;  3G21 A;  1YIJ P;  4GR2 A;  1K73 Q;  5HV8 A;  1RNI A;  2L4B A;  4HTW A;  2EHS A;  1VQL P;  1F80 D;  4H2Y C;  2Y4Z A;  4QKO A;  2DGY A;  2K0Y A;  1RO0 A;  2N50 A;  5KP6 B;  4INB A;  4U0F A;  3CC7 P;  2K2Q A;  3RG6 C;  3CMA P;  2Z45 A;  4GR6 A;  1A43 A;  2N5H A;  2FAE A;  2XGY A;  1ZNV A;  1S72 P;  2GYK A;  1GWP A;  1VQP P;  2P9X A;  5KP8 B;  2MR7 A;  2KOR A;  3DS3 A;  1VQM P;  1IUQ A;  2GDX A;  1EOQ A;  1YJN P;  4PH3 A;  3G1I A;  3H47 A;  4BPF A;  2PWO A;  2FVA A;  3DTJ A;  3G0V A;  4XFZ A;  2OTL P;  3WBH A;  2MY5 A;  1VQ6 P;  2WLV B;  2KWL A;  1X3O A;  3DS2 A;  2WPT A;  2V4X A;  5I4T G;  3GJN A;  5HGM A;  2K93 A;  2DNW A;  2K0X A;  1AFV A;  3CCS P;  4U0B A;  2M8L A;  2M5R A;  7CEI A;  4HKG A;  1M90 Q;  2M8N A;  1CEI A;  1HY8 A;  2JPR A;  1BXI A;  3P05 A;  2XXM A;  2X2D D;  3H0D A;  2KG8 A;  4COC A;  4NX4 C;  5KP7 B;  1Q7Y Q;  2WLV A;  1M6N A;  3EJE A;  2BUO A;  2JU2 A;  3DS1 A;  1AUM A;  2VLO A;  2CG5 B;  3DS0 A;  3E2D A;  3CCM P;  1N8R Q;  4QNB A;  2FVF A;  2L22 A;  2M8P A;  2JGP A;  1KQS O;  2K5X A;  4PH0 A;  2JQ4 A;  2FAC A;  4F37 A;  4COP A;  1GXH A;  3CCQ P;  1VHN A;  1Q86 Q;  2LOL A;  2EG5 A;  1AF8 A;  1GPJ A;  1JJ2 O;  2AFD A;  4DGA C;  2KW2 A;  4UHP B;  1M74 A;  1DNY A;  3M1M A;  2OAR A;  1YJ9 P;  1VQ8 P;  1L6N A;  4DG9 A;  2N6Y A;  1YJW P;  2EIA A;  3G28 A;  2PEN A;  3OW2 O;  1W2B O;  2ROQ A;  4R0M A;  2JYL A;  1M9F C;  1YI2 P;  3G71 P;  1YHQ P;  2K92 A;  1M9E C;  1VQN P;  2NO8 A;  3CC2 P;  2GZI A;  2CWO A;  5HGO A;  4XFX A;  3DS5 A;  4MRT C;  3VRL C;  1YIT P;  1Q81 Q;  3RG2 A;  1VQO P;  1VQ7 P;  2LIW A;  5HGK A;  2FQ2 A;  1M9Y C;  2PEK A;  3HZQ A;  2MD9 A;  3B4Q A;  4PXH B;  1VQ4 P;  2PEJ A;  2KGE A;  3MGE A;  2X82 A;  3CCR P;  2GDY A;  2KGA A;  1M6E X;  1E0H A;  2GZE A;  1UNK A;  2JB0 A;  1M9X C;  1ACP A;  3G6E P;  2LL8 A;  1BAJ A;  1K30 A;  1FR2 A;  2KG9 A;  3LMO A;  2KG6 A;  2KR5 A;  2GZJ A;  1L0I A;  1M9C C;  1VQ9 P;  1AK4 C;  2PEI A;  4DGE C;  2FQ1 A;  4H2W C;  2KGC A;  2KOP A;  3GZM A;  1QVG O;  4M0I A;  2BHV A;  3CPW O;  2PEO A;  2LKI A;  3GZL A;  2AF8 A;  4IPY A;  3BP9 A;  3G1G A;  1EMV A;  3CXC O;  2LF4 A;  2KOD A;  3H4E A;  3G4S P;  2PWM A;  2LIU A;  1QRJ A;  4WYM A;  2XZ1 C;  3CE7 A;  1A8O A;  1VQ5 P;  2CGQ A;  1GXG A;  2E1M A;  2JAZ A;  3GKL C;  4IZ6 A;  2JO0 A;  2VLQ A;  5HGL A;  3G29 A;  5EJD A;  3CD6 P;  3CCJ P;  1Q82 Q;  3CC4 P;  1L0H A;  1Z6M A;  1T8K A;  1KLP A;  2FQ0 A;  2GZG A;  1EIA A;  4U0D A;  5EW5 E;  2GZF A;  2ONT A;  2PEM A;  2QA4 P;  2X2B A;  4H2X C;  2MVV A;  4E92 A;  5F2O A;  2VSQ A;  5HVC A;  1E6J P;  1M9D C;  1UJZ A;  2GON A;  1HQB A;  3CCU P;  2AVA A;  1U7K A;  3EJD A;  2GOL B;  3U43 A;  2XV6 A;  2L9F A;  4U0C A;  3B5I A;  5JPA A;  2QNW A;  3CCV P;  1D1D A;  5BS2 A;  1NJI Q;  3DS4 A;  4E91 A;  1RO2 A;  2N6Z A;  2QEX P;  2JBG A;  4LQW C;  2KGD A;  2FVE A;  1OR5 A;  2LPK A;  4J93 A;  4XRQ A;  2CNR A;  1G03 A;  1KD1 Q;  3DPH A;  3Q20 A;  4U0E A;  1QVF O;  1DV5 A;  2OTJ P;  2JYG A;  1ZMB A;  2VLN A;  1M1K Q;  2MR8 A;  2JU1 A;  5F2K A;  2KOS A;  1AYI A;  2XDE A;  3I56 P;  2Z46 A;  3HYB A;  2PNG A;  2N98 A;  2KGF A;  3CCL P;  2MF4 A;  5F2N A;  2ERH A;  2XT1 A;  1VKU A;  4CA3 A;  2EHT A; 
#chains in the Genus database with same CATH homology
 2EIA A;  4PH2 A;  3G28 A;  2E1M A;  2PEN A;  1K8A Q;  1K9M Q;  3OW2 O;  1W2B O;  3NTE A;  3DS3 A;  1VQM P;  2JO0 A;  5HGL A;  3G29 A;  2JYL A;  1M9F C;  1IUQ A;  2Z44 A;  5HGN A;  2XGU A;  1EOQ A;  3CD6 P;  1YJN P;  4PH3 A;  3G1I A;  3G71 P;  3CCJ P;  1YHQ P;  1YI2 P;  1Q82 Q;  1KC8 Q;  3CC4 P;  1M9E C;  4U0A A;  1VQN P;  3H47 A;  3CC2 P;  3G26 A;  2PWO A;  4XFY A;  4PH1 A;  3DTJ A;  2CWO A;  5HGO A;  4XFZ A;  4XFX A;  3DS5 A;  3G0V A;  2OTL P;  3WBH A;  1VQ6 P;  2WLV B;  3VRL C;  1EM9 A;  3LRY A;  1YIT P;  1EIA A;  2X83 A;  4U0D A;  1Q81 Q;  2EFJ A;  1VQK P;  3DS2 A;  2XGV A;  2PY8 A;  1VQO P;  2V4X A;  2ONT A;  1VQ7 P;  2PEM A;  5I4T G;  2QA4 P;  2PXR C;  3CCE P;  4E92 A;  5HGK A;  5F2O A;  1M9Y C;  1E6J P;  1M9D C;  2PEK A;  3HZQ A;  2GON A;  5HGM A;  2L6E A;  4XRO A;  3CCU P;  1P7N A;  1VQ4 P;  2PEJ A;  2PEQ A;  1U7K A;  1AFV A;  3MGE A;  2X82 A;  2GOL B;  3CCR P;  2XV6 A;  3CCS P;  4U0B A;  4B4N A;  2M8L A;  1M6E X;  1M9X C;  1M90 Q;  2M8N A;  4U0C A;  3G6E P;  3B5I A;  5BS1 A;  2JPR A;  1BAJ A;  1K30 A;  3I55 P;  5JPA A;  3CME P;  3P05 A;  2XXM A;  3CCV P;  1D1D A;  1YJW P;  5DCK A;  5BS2 A;  3G21 A;  1NJI Q;  1YIJ P;  3DS4 A;  2X2D D;  4GR2 A;  4E91 A;  3H0D A;  1RO2 A;  1K73 Q;  2QEX P;  4LQW C;  1RNI A;  4COC A;  1M9C C;  1VQ9 P;  4HTW A;  4NX4 C;  4J93 A;  4XRQ A;  2WLV A;  1Q7Y Q;  1AK4 C;  1M6N A;  1VQL P;  2BUO A;  1G03 A;  3DS1 A;  1KD1 Q;  3DPH A;  3Q20 A;  2PEI A;  1AUM A;  4U0E A;  2Y4Z A;  1QVF O;  4DGE C;  2OTJ P;  1QVG O;  3DS0 A;  3E2D A;  3CCM P;  1N8R Q;  2JYG A;  2DGY A;  4QNB A;  4M0I A;  1ZMB A;  2M8P A;  1M1K Q;  2BHV A;  3CPW O;  1RO0 A;  2PEO A;  5F2K A;  1KQS O;  2XDE A;  3I56 P;  4INB A;  2Z46 A;  4PH0 A;  4U0F A;  3HYB A;  4IPY A;  3CC7 P;  3BP9 A;  4COP A;  3G1G A;  2KGF A;  3CXC O;  3CCL P;  2LF4 A;  3RG6 C;  3CMA P;  1VQP P;  2Z45 A;  3CCQ P;  1Q86 Q;  2KOD A;  4GR6 A;  5F2N A;  3H4E A;  1A43 A;  2EG5 A;  3G4S P;  1JJ2 O;  2XT1 A;  2PWM A;  4DGA C;  1M74 A;  1QRJ A;  2XGY A;  4WYM A;  3M1M A;  1S72 P;  2OAR A;  1GWP A;  1YJ9 P;  1A8O A;  1VQ8 P;  1VQ5 P;  1L6N A;  2P9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...