5HGNA

Hexameric hiv-1 ca, apo form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
205
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 73
structure length 205
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgnA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgnA02
2JPRA 2ONTA 1M9XC 2XDEA 1M9DC 1A43A 1P7NA 1EM9A 4COCA 3DS0A 5HGMA 2XGVA 1L6NA 1EIAA 2M8PA 3P05A 4J93A 2XXMA 1E6JP 5DCKA 2X82A 3G28A 1QRJA 4XFZA 4WYMA 1AUMA 1AFVA 2KGFA 4LQWC 3G26A 4E92A 2JO0A 2GOLB 4HTWA 3G29A 1M9FC 2BUOA 4PH3A 1M9EC 2PWOA 3G0VA 3DS2A 5HGLA 2PWMA 2M8LA 2Y4ZA 4E91A 4U0FA 2X2DD 1M9YC 4B4NA 4DGAC 2KODA 4U0DA 4NX4C 5I4TG 3DTJA 3G1IA 2WLVA 2M8NA 1AK4C 4XFYA 4IPYA 3MGEA 4U0BA 4M0IA 5HGNA 4XRQA 2LF4A 3LRYA 4U0CA 4PH0A 4U0EA 1A8OA 4XFXA 2JYLA 3DS4A 1BAJA 2XGYA 4INBA 1M9CC 3H4EA 2GONA 5HGOA 3BP9A 3G1GA 3G21A 2X83A 1EOQA 2WLVB 3DS1A 1U7KA 3NTEA 3DS3A 1GWPA 4QNBA 2V4XA 2XGUA 4PH1A 2L6EA 2EIAA 3DS5A 2XT1A 1G03A 5JPAA 3H47A 5HGKA 1D1DA 4U0AA 4PH2A 4DGEC 4COPA 2PXRC 2XV6A 2JYGA 3DPHA 3VRLC 4XROA
chains in the Genus database with same CATH superfamily
1BXIA 1VKUA 2K94A 3M1MA 1M1KQ 1VQLP 1QVFO 3WBHA 1Q7YQ 2KG8A 1A43A 4COCA 2L4BA 4IZ6A 1EIAA 2XXMA 2JBGA 3G28A 2LIUA 1QRJA 5F2NA 2BHVA 5HV8A 3OW2O 3EJBA 2JO0A 3G29A 2JGPA 4BPGA 4PH3A 2N50A 1M9EC 2JQ4A 2PWMA 1AF8A 2MR8A 2KGEA 2FQ2A 4DG9A 2LKIA 1YJNP 1M9YC 1E0HA 5I4TG 3B5IA 3B4QA 1RO2A 4XFYA 2GYKA 4IPYA 3MGEA 1VQ6P 3G71P 1X3OA 5HGNA 3CCVP 4H2WC 5F2OA 2VLPA 1AYIA 2Z45A 2KR5A 4XFXA 2JYLA 1DNYA 2N6ZA 2XGYA 4INBA 1M9CC 5KP7B 4PXHB 2KW2A 3G21A 2PEOA 1Z6MA 2MF4A 2PNGA 1EOQA 2NO8A 2LL8A 1GWPA 3NY7B 3I56P 3GZMA 1VQ9P 2K2QA 2XZ0D 2EIAA 3DS5A 2XT1A 2M5RA 1UJZA 2L9FA 1VQ8P 4U0AA 3Q20A 4PH2A 3VRLC 4XROA 2FACA 2DNWA 1M74A 1F80D 3E2DA 4BPHA 1M9XC 1M9DC 2XGVA 1L6NA 1T8KA 2PENA 4J93A 2K0XA 5CZDB 1YJWP 4XFZA 1ACPA 2N6YA 2ROQA 4E92A 2GOLB 4HTWA 2MY5A 2BUOA 1YI2P 1M90Q 1N8RQ 2PWOA 3G0VA 2X2BA 2XZ1C 3EJEA 2KGCA 1NJIQ 1VQ5P 2K93A 3U43A 4U0FA 4BPFA 5KP8B 2KORA 1W2BO 1VHNA 4B4NA 4DGAC 2OTJP 4U0DA 4NX4C 4F37A 3G1IA 1YHQP 2OARA 2OTLP 2PEMA 4M0IA 1NQ4A 5BS1A 2PY8A 2E1MA 2CNRA 3LRYA 2CWOA 1OR5A 1A8OA 3CMEP 3I55P 1KC8Q 3GZLA 2GZFA 2LPKA 5HGOA 2GONA 3CCEP 3HYBA 2EFJA 3BP9A 1KLPA 3G1GA 4NEOA 2ERHA 3DS1A 1U7KA 3CCUP 1VQ7P 2GZEA 2K5XA 5KP6B 3CC4P 1YITP 1EMVA 2XGUA 2QA4P 1G03A 2AFDA 5JPAA 3H47A 2L0QA 1VQNP 1D1DA 1IMPA 2QNWA 4DGEC 2JYGA 3GJNA 2AF8A 1M6EX 3CCSP 2EHSA 2ONTA 2XDEA 3EJDA 2DGYA 1VQKP 1EM9A 3CD6P 3DS0A 7CEIA 4H2YC 5EJDA 3P05A 1CEIA 3G6EP 5DCKA 1IMQA 1Q82Q 2FQ0A 3RG2A 3CE7A 4GR6A 3RG6C 2N5HA 2KGFA 4LQWC 2FQ1A 2EHTA 1GPJA 1HQBA 2FVFA 3DS2A 5HGLA 1FR2A 2M8LA 2VLQA 2Y4ZA 4E91A 4QKOA 3CXCO 3CC2P 2N5IA 5EW5E 2JAZA 2KODA 4R0MA 2KG6A 2VSQA 2WLVA 1RO0A 3CCQP 1S72P 4U0BA 3LMOA 4XRQA 2K0DX 2K0YA 4U0CA 2KGDA 2GZGA 2X83A 2MVVA 2WLVB 2PEKA 2LOLA 2GDYA 3DS3A 1VQMP 2KOOA 2MD9A 1K30A 2VLOA 1M6NA 2LMLA 1RNIA 2V4XA 1YIJP 4PH1A 1K8AQ 2FVEA 2LIWA 1L0IA 2JU1A 1UNKA 4MRTC 4COPA 2PXRC 2XV6A 3DPHA 1ZMBA 2GZJA 2KOPA 1Q86Q 3H0DA 2JPRA 2CGQA 2KWLA 2L22A 4PWVB 2CQ8A 2KOSA 1P7NA 5HGMA 2M8PA 2EG5A 1E6JP 3CMAP 2X82A 1K73Q 1VQPP 2FVAA 4WYMA 1AUMA 2P9XA 1AFVA 3G26A 1KD1Q 3CCRP 3CCLP 1M9FC 3G4SP 1Q81Q 2MR7A 2Z44A 2QEXP 4CA3A 2JU2A 2X2DD 4GR2A 1MZ8A 2KGAA 3DTJA 3CCJP 2M8NA 4H2XC 1AK4C 2KG9A 3CCMP 1ZNVA 1YJ9P 1KQSO 2LF4A 2AVAA 1VQ4P 2LTEA 2N98A 2K92A 4PH0A 4U0EA 2AFEA 2GDWA 1JJ2O 2FHSC 1QVGO 3DS4A 2FADA 1BAJA 3H4EA 2WPTA 1IUQA 2PEJA 1HY8A 2VLNA 2Z46A 3CC7P 3NTEA 2KOQA 4HKGA 1GXHA 3HZQA 2GZIA 3CPWO 5HVCA 1L0HA 1DV5A 1GXGA 2PEQA 4QNBA 2L6EA 5BS2A 1VQOP 2MVUA 2GDXA 3GKLC 2JB0A 5HGKA 5F2KA 2PEIA 2FAEA 1K9MQ 4UHPB 2CG5B
chains in the Genus database with same CATH topology
2JPRA 3E2DA 1VQLP 2ONTA 3M1MA 1M1KQ 1QVFO 3WBHA 1M9XC 1Q7YQ 2XDEA 1M9DC 2DGYA 1A43A 1P7NA 1EM9A 1VQKP 4COCA 3CD6P 3DS0A 5HGMA 2XGVA 1L6NA 1EIAA 2M8PA 3P05A 2PENA 4J93A 2EG5A 2XXMA 1E6JP 3G6EP 5DCKA 3CMAP 1Q82Q 2X82A 3G28A 1K73Q 1QRJA 1VQPP 1YJWP 4GR6A 4XFZA 3RG6C 2P9XA 4WYMA 1AUMA 1AFVA 5F2NA 2KGFA 2BHVA 4LQWC 3G26A 3OW2O 1KD1Q 4E92A 3CCRP 2JO0A 2GOLB 4HTWA 3G29A 1M9FC 3CCLP 3G4SP 2BUOA 1Q81Q 4PH3A 1YI2P 1M9EC 1M90Q 2Z44A 2PWOA 3G0VA 3DS2A 5HGLA 1N8RQ 2PWMA 2M8LA 2Y4ZA 2QEXP 4E91A 1NJIQ 1VQ5P 4U0FA 2X2DD 3CXCO 1YJNP 3CC2P 1W2BO 4GR2A 1M9YC 4B4NA 4DGAC 2KODA 4U0DA 2OTJP 4NX4C 5I4TG 3B5IA 3DTJA 2WLVA 2M8NA 3G1IA 3CCJP 1RO2A 1YHQP 2OARA 2OTLP 1AK4C 4XFYA 2PEMA 4IPYA 3MGEA 1RO0A 3CCQP 1S72P 3CCMP 4U0BA 1VQ6P 3G71P 4M0IA 5HGNA 1YJ9P 1KQSO 4XRQA 3CCVP 5BS1A 2PY8A 2E1MA 2LF4A 3LRYA 5F2OA 1VQ4P 4U0CA 2Z45A 4PH0A 4U0EA 2CWOA 1A8OA 4XFXA 2JYLA 3I55P 1KC8Q 1JJ2O 3CMEP 1QVGO 3DS4A 1BAJA 2XGYA 4INBA 1M9CC 3H4EA 2GONA 5HGOA 3CCEP 1IUQA 3HYBA 2PEJA 2EFJA 3BP9A 3G1GA 3G21A 2X83A 2PEOA 2Z46A 1EOQA 3CC7P 2WLVB 2PEKA 3DS1A 1U7KA 3NTEA 3DS3A 3CCUP 1VQ7P 1VQMP 3HZQA 1GWPA 1K30A 3I56P 3CPWO 1M6NA 1RNIA 1YITP 2PEQA 3CC4P 4QNBA 1VQ9P 2V4XA 1YIJP 2XGUA 4PH1A 2L6EA 2EIAA 3DS5A 2QA4P 1K8AQ 2XT1A 5BS2A 1VQOP 1G03A 5JPAA 3H47A 1VQNP 1VQ8P 5HGKA 1D1DA 4U0AA 2PEIA 3Q20A 4PH2A 5F2KA 4DGEC 4COPA 2PXRC 2XV6A 2JYGA 3DPHA 3VRLC 1ZMBA 1K9MQ 1M6EX 4XROA 3CCSP 1Q86Q 3H0DA 1M74A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JPR A;  2ONT A;  1M9X C;  2XDE A;  1M9D C;  1A43 A;  1P7N A;  1EM9 A;  4COC A;  3DS0 A;  5HGM A;  2XGV A;  1L6N A;  1EIA A;  2M8P A;  3P05 A;  4J93 A;  2XXM A;  1E6J P;  5DCK A;  2X82 A;  3G28 A;  1QRJ A;  4XFZ A;  4WYM A;  1AUM A;  1AFV A;  2KGF A;  4LQW C;  3G26 A;  4E92 A;  2JO0 A;  2GOL B;  4HTW A;  3G29 A;  1M9F C;  2BUO A;  4PH3 A;  1M9E C;  2PWO A;  3G0V A;  3DS2 A;  5HGL A;  2PWM A;  2M8L A;  2Y4Z A;  4E91 A;  4U0F A;  2X2D D;  1M9Y C;  4B4N A;  4DGA C;  2KOD A;  4U0D A;  4NX4 C;  5I4T G;  3DTJ A;  3G1I A;  2WLV A;  2M8N A;  1AK4 C;  4XFY A;  4IPY A;  3MGE A;  4U0B A;  4M0I A;  5HGN A;  4XRQ A;  2LF4 A;  3LRY A;  4U0C A;  4PH0 A;  4U0E A;  1A8O A;  4XFX A;  2JYL A;  3DS4 A;  1BAJ A;  2XGY A;  4INB A;  1M9C C;  3H4E A;  2GON A;  5HGO A;  3BP9 A;  3G1G A;  3G21 A;  2X83 A;  1EOQ A;  2WLV B;  3DS1 A;  1U7K A;  3NTE A;  3DS3 A;  1GWP A;  4QNB A;  2V4X A;  2XGU A;  4PH1 A;  2L6E A;  2EIA A;  3DS5 A;  2XT1 A;  1G03 A;  5JPA A;  3H47 A;  5HGK A;  1D1D A;  4U0A A;  4PH2 A;  4DGE C;  4COP A;  2PXR C;  2XV6 A;  2JYG A;  3DPH A;  3VRL C;  4XRO A; 
#chains in the Genus database with same CATH topology
 1BXI A;  1VKU A;  2K94 A;  3M1M A;  1M1K Q;  1VQL P;  1QVF O;  3WBH A;  1Q7Y Q;  2KG8 A;  1A43 A;  4COC A;  2L4B A;  4IZ6 A;  1EIA A;  2XXM A;  2JBG A;  3G28 A;  2LIU A;  1QRJ A;  5F2N A;  2BHV A;  5HV8 A;  3OW2 O;  3EJB A;  2JO0 A;  3G29 A;  2JGP A;  4BPG A;  4PH3 A;  2N50 A;  1M9E C;  2JQ4 A;  2PWM A;  1AF8 A;  2MR8 A;  2KGE A;  2FQ2 A;  4DG9 A;  2LKI A;  1YJN P;  1M9Y C;  1E0H A;  5I4T G;  3B5I A;  3B4Q A;  1RO2 A;  4XFY A;  2GYK A;  4IPY A;  3MGE A;  1VQ6 P;  3G71 P;  1X3O A;  5HGN A;  3CCV P;  4H2W C;  5F2O A;  2VLP A;  1AYI A;  2Z45 A;  2KR5 A;  4XFX A;  2JYL A;  1DNY A;  2N6Z A;  2XGY A;  4INB A;  1M9C C;  5KP7 B;  4PXH B;  2KW2 A;  3G21 A;  2PEO A;  1Z6M A;  2MF4 A;  2PNG A;  1EOQ A;  2NO8 A;  2LL8 A;  1GWP A;  3NY7 B;  3I56 P;  3GZM A;  1VQ9 P;  2K2Q A;  2XZ0 D;  2EIA A;  3DS5 A;  2XT1 A;  2M5R A;  1UJZ A;  2L9F A;  1VQ8 P;  4U0A A;  3Q20 A;  4PH2 A;  3VRL C;  4XRO A;  2FAC A;  2DNW A;  1M74 A;  1F80 D;  3E2D A;  4BPH A;  1M9X C;  1M9D C;  2XGV A;  1L6N A;  1T8K A;  2PEN A;  4J93 A;  2K0X A;  5CZD B;  1YJW P;  4XFZ A;  1ACP A;  2N6Y A;  2ROQ A;  4E92 A;  2GOL B;  4HTW A;  2MY5 A;  2BUO A;  1YI2 P;  1M90 Q;  1N8R Q;  2PWO A;  3G0V A;  2X2B A;  2XZ1 C;  3EJE A;  2KGC A;  1NJI Q;  1VQ5 P;  2K93 A;  3U43 A;  4U0F A;  4BPF A;  5KP8 B;  2KOR A;  1W2B O;  1VHN A;  4B4N A;  4DGA C;  2OTJ P;  4U0D A;  4NX4 C;  4F37 A;  3G1I A;  1YHQ P;  2OAR A;  2OTL P;  2PEM A;  4M0I A;  1NQ4 A;  5BS1 A;  2PY8 A;  2E1M A;  2CNR A;  3LRY A;  2CWO A;  1OR5 A;  1A8O A;  3CME P;  3I55 P;  1KC8 Q;  3GZL A;  2GZF A;  2LPK A;  5HGO A;  2GON A;  3CCE P;  3HYB A;  2EFJ A;  3BP9 A;  1KLP A;  3G1G A;  4NEO A;  2ERH A;  3DS1 A;  1U7K A;  3CCU P;  1VQ7 P;  2GZE A;  2K5X A;  5KP6 B;  3CC4 P;  1YIT P;  1EMV A;  2XGU A;  2QA4 P;  1G03 A;  2AFD A;  5JPA A;  3H47 A;  2L0Q A;  1VQN P;  1D1D A;  1IMP A;  2QNW A;  4DGE C;  2JYG A;  3GJN A;  2AF8 A;  1M6E X;  3CCS P;  2EHS A;  2ONT A;  2XDE A;  3EJD A;  2DGY A;  1VQK P;  1EM9 A;  3CD6 P;  3DS0 A;  7CEI A;  4H2Y C;  5EJD A;  3P05 A;  1CEI A;  3G6E P;  5DCK A;  1IMQ A;  1Q82 Q;  2FQ0 A;  3RG2 A;  3CE7 A;  4GR6 A;  3RG6 C;  2N5H A;  2KGF A;  4LQW C;  2FQ1 A;  2EHT A;  1GPJ A;  1HQB A;  2FVF A;  3DS2 A;  5HGL A;  1FR2 A;  2M8L A;  2VLQ A;  2Y4Z A;  4E91 A;  4QKO A;  3CXC O;  3CC2 P;  2N5I A;  5EW5 E;  2JAZ A;  2KOD A;  4R0M A;  2KG6 A;  2VSQ A;  2WLV A;  1RO0 A;  3CCQ P;  1S72 P;  4U0B A;  3LMO A;  4XRQ A;  2K0D X;  2K0Y A;  4U0C A;  2KGD A;  2GZG A;  2X83 A;  2MVV A;  2WLV B;  2PEK A;  2LOL A;  2GDY A;  3DS3 A;  1VQM P;  2KOO A;  2MD9 A;  1K30 A;  2VLO A;  1M6N A;  2LML A;  1RNI A;  2V4X A;  1YIJ P;  4PH1 A;  1K8A Q;  2FVE A;  2LIW A;  1L0I A;  2JU1 A;  1UNK A;  4MRT C;  4COP A;  2PXR C;  2XV6 A;  3DPH A;  1ZMB A;  2GZJ A;  2KOP A;  1Q86 Q;  3H0D A;  2JPR A;  2CGQ A;  2KWL A;  2L22 A;  4PWV B;  2CQ8 A;  2KOS A;  1P7N A;  5HGM A;  2M8P A;  2EG5 A;  1E6J P;  3CMA P;  2X82 A;  1K73 Q;  1VQP P;  2FVA A;  4WYM A;  1AUM A;  2P9X A;  1AFV A;  3G26 A;  1KD1 Q;  3CCR P;  3CCL P;  1M9F C;  3G4S P;  1Q81 Q;  2MR7 A;  2Z44 A;  2QEX P;  4CA3 A;  2JU2 A;  2X2D D;  4GR2 A;  1MZ8 A;  2KGA A;  3DTJ A;  3CCJ P;  2M8N A;  4H2X C;  1AK4 C;  2KG9 A;  3CCM P;  1ZNV A;  1YJ9 P;  1KQS O;  2LF4 A;  2AVA A;  1VQ4 P;  2LTE A;  2N98 A;  2K92 A;  4PH0 A;  4U0E A;  2AFE A;  2GDW A;  1JJ2 O;  2FHS C;  1QVG O;  3DS4 A;  2FAD A;  1BAJ A;  3H4E A;  2WPT A;  1IUQ A;  2PEJ A;  1HY8 A;  2VLN A;  2Z46 A;  3CC7 P;  3NTE A;  2KOQ A;  4HKG A;  1GXH A;  3HZQ A;  2GZI A;  3CPW O;  5HVC A;  1L0H A;  1DV5 A;  1GXG A;  2PEQ A;  4QNB A;  2L6E A;  5BS2 A;  1VQO P;  2MVU A;  2GDX A;  3GKL C;  2JB0 A;  5HGK A;  5F2K A;  2PEI A;  2FAE A;  1K9M Q;  4UHP B;  2CG5 B; 
#chains in the Genus database with same CATH homology
 2JPR A;  3E2D A;  1VQL P;  2ONT A;  3M1M A;  1M1K Q;  1QVF O;  3WBH A;  1M9X C;  1Q7Y Q;  2XDE A;  1M9D C;  2DGY A;  1A43 A;  1P7N A;  1EM9 A;  1VQK P;  4COC A;  3CD6 P;  3DS0 A;  5HGM A;  2XGV A;  1L6N A;  1EIA A;  2M8P A;  3P05 A;  2PEN A;  4J93 A;  2EG5 A;  2XXM A;  1E6J P;  3G6E P;  5DCK A;  3CMA P;  1Q82 Q;  2X82 A;  3G28 A;  1K73 Q;  1QRJ A;  1VQP P;  1YJW P;  4GR6 A;  4XFZ A;  3RG6 C;  2P9X A;  4WYM A;  1AUM A;  1AFV A;  5F2N A;  2KGF A;  2BHV A;  4LQW C;  3G26 A;  3OW2 O;  1KD1 Q;  4E92 A;  3CCR P;  2JO0 A;  2GOL B;  4HTW A;  3G29 A;  1M9F C;  3CCL P;  3G4S P;  2BUO A;  1Q81 Q;  4PH3 A;  1YI2 P;  1M9E C;  1M90 Q;  2Z44 A;  2PWO A;  3G0V A;  3DS2 A;  5HGL A;  1N8R Q;  2PWM A;  2M8L A;  2Y4Z A;  2QEX P;  4E91 A;  1NJI Q;  1VQ5 P;  4U0F A;  2X2D D;  3CXC O;  1YJN P;  3CC2 P;  1W2B O;  4GR2 A;  1M9Y C;  4B4N A;  4DGA C;  2KOD A;  4U0D A;  2OTJ P;  4NX4 C;  5I4T G;  3B5I A;  3DTJ A;  2WLV A;  2M8N A;  3G1I A;  3CCJ P;  1RO2 A;  1YHQ P;  2OAR A;  2OTL P;  1AK4 C;  4XFY A;  2PEM A;  4IPY A;  3MGE A;  1RO0 A;  3CCQ P;  1S72 P;  3CCM P;  4U0B A;  1VQ6 P;  3G71 P;  4M0I A;  5HGN A;  1YJ9 P;  1KQS O;  4XRQ A;  3CCV P;  5BS1 A;  2PY8 A;  2E1M A;  2LF4 A;  3LRY A;  5F2O A;  1VQ4 P;  4U0C A;  2Z45 A;  4PH0 A;  4U0E A;  2CWO A;  1A8O A;  4XFX A;  2JYL A;  3I55 P;  1KC8 Q;  1JJ2 O;  3CME P;  1QVG O;  3DS4 A;  1BAJ A;  2XGY A;  4INB A;  1M9C C;  3H4E A;  2GON A;  5HGO A;  3CCE P;  1IUQ A;  3HYB A;  2PEJ A;  2EFJ A;  3BP9 A;  3G1G A;  3G21 A;  2X83 A;  2PEO A;  2Z46 A;  1EOQ A;  3CC7 P;  2WLV B;  2PEK A;  3DS1 A;  1U7K A;  3NTE A;  3DS3 A;  3CCU P;  1VQ7 P;  1VQM P;  3HZQ A;  1GWP A;  1K30 A;  3I56 P;  3CPW O;  1M6N A;  1RNI A;  1YIT P;  2PEQ A;  3CC4 P;  4QNB A;  1VQ9 P;  2V4X A;  1YIJ P;  2XGU A;  4PH1 A;  2L6E A;  2EIA A;  3DS5 A;  2QA4 P;  1K8A Q;  2XT1 A;  5BS2 A;  1VQO P;  1G03 A;  5JPA A;  3H47 A;  1VQN P;  1VQ8 P;  5HGK A;  1D1D A;  4U0A A;  2PEI A;  3Q20 A;  4PH2 A;  5F2K A;  4DGE C;  4COP A;  2PXR C;  2XV6 A;  2JYG A;  3DPH A;  3VRL C;  1ZMB A;  1K9M Q;  1M6E X;  4XRO A;  3CCS P;  1Q86 Q;  3H0D A;  1M74 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...