5HGNA

Hexameric hiv-1 ca, apo form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
205
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein P24
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 73
structure length 205
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgnA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgnA02
2LF4A 3P05A 2PWMA 2XXMA 4DGEC 3DS4A 4B4NA 3G26A 2GONA 1AFVA 4QNBA 4U0BA 2JYLA 4NX4C 3DS5A 5HGKA 4PH2A 4U0CA 2KGFA 2WLVB 4J93A 1EOQA 3VRLC 2X83A 3NTEA 4XFYA 1E6JP 4M0IA 2M8PA 2XT1A 2XGYA 3DS3A 4DGAC 3DTJA 4LQWC 1A43A 3BP9A 1M9DC 4E91A 2M8LA 2PXRC 1BAJA 2KODA 1G03A 1L6NA 4PH3A 4IPYA 2V4XA 4XROA 1U7KA 3G1IA 1M9XC 4U0AA 2L6EA 2EIAA 1M9FC 5HGLA 3DS1A 2JO0A 2GOLB 2JPRA 1QRJA 5HGMA 4PH0A 2Y4ZA 4U0DA 4XFXA 1D1DA 4HTWA 3DS0A 2X2DD 2BUOA 5JPAA 1A8OA 3H47A 4COPA 1M9EC 4XFZA 3H4EA 3G21A 2XDEA 3G29A 1P7NA 2WLVA 1EM9A 4U0FA 1AK4C 3LRYA 4WYMA 4E92A 1EIAA 3G0VA 4PH1A 3MGEA 5DCKA 2JYGA 4INBA 2M8NA 5HGOA 3DPHA 3G1GA 4COCA 2X82A 1M9CC 1AUMA 2XGUA 5I4TG 2PWOA 4XRQA 2XV6A 2ONTA 2XGVA 5HGNA 3G28A 1M9YC 4U0EA 1GWPA 3DS2A
chains in the Genus database with same CATH superfamily
1M90Q 3CC4P 5BS2A 1GXGA 2MR8A 4HKGA 2KW2A 2KGCA 2GZIA 2JYLA 3DS5A 2K94A 3RG2A 2LOLA 3H0DA 2XGYA 2MY5A 4DGAC 2M5RA 2M8LA 2MF4A 3NY7B 2MR7A 3Q20A 3GKLC 2KODA 1GPJA 2V4XA 1U7KA 2MD9A 2K0DX 2QA4P 4U0AA 2MVVA 1X3OA 1YI2P 1VQ8P 2CWOA 2FAEA 3EJDA 2ERHA 1DV5A 1Q82Q 4XFXA 1N8RQ 1VQNP 2JU1A 1RNIA 1K73Q 2KORA 3H47A 4BPGA 2GZJA 3CCEP 2FQ2A 1RO2A 1KD1Q 1VKUA 1QVGO 2L0QA 3CCJP 1P7NA 2WLVA 1AK4C 3LRYA 4WYMA 2AVAA 2OTJP 4INBA 2M8NA 1EMVA 3GZLA 3I56P 2JB0A 1RO0A 2N98A 3HYBA 1W2BO 2X82A 1S72P 1ACPA 5HVCA 3EJBA 1KC8Q 2XV6A 4BPFA 2ONTA 3CCLP 4QKOA 1DNYA 2K5XA 4DGEC 1VHNA 2N6ZA 2QNWA 3CMEP 2KOPA 1YHQP 4PWVB 2WLVB 1M6NA 2QEXP 3NTEA 4M0IA 3CCUP 1BXIA 2JAZA 1OR5A 3DS3A 4LQWC 2KOSA 1A43A 2PEQA 2PNGA 4CA3A 1VQ4P 4E91A 2PXRC 1L6NA 3B4QA 3CXCO 4IPYA 4XROA 2XZ0D 2FACA 5EJDA 1T8KA 1E0HA 2K92A 1FR2A 2K0YA 2FHSC 3G71P 1JJ2O 4NEOA 1VQOP 4PH0A 2KR5A 2KGEA 5F2NA 2FVFA 3OW2O 4COPA 1M1KQ 3CE7A 1IUQA 3G21A 4GR2A 2KOQA 3EJEA 1EM9A 2K93A 2Z46A 2PENA 1VQPP 2E1MA 5KP7B 3G0VA 1IMQA 4PH1A 5DCKA 2JYGA 2P9XA 1YJWP 1NQ4A 1YITP 1M9CC 2FVEA 2NO8A 2XZ1C 2BHVA 2OTLP 2LMLA 2XGVA 5HGNA 3CC2P 1ZNVA 2MVUA 3CMAP 3DS2A 4UHPB 2LF4A 4PXHB 2FQ0A 4H2WC 2JQ4A 3RG6C 2LIWA 2GONA 2JU2A 4QNBA 2Z45A 4NX4C 2LIUA 2KGFA 3U43A 1Q7YQ 3VRLC 3G4SP 2KWLA 2GZFA 7CEIA 3CCMP 5EW5E 2EG5A 1E6JP 2XT1A 3M1MA 3HZQA 2JBGA 1Q81Q 1AYIA 2GZEA 4GR6A 3CC7P 1M9DC 2K0XA 2EFJA 1BAJA 2WPTA 4PH3A 1K8AQ 2PEIA 2PY8A 1MZ8A 2VLPA 2OARA 3G1IA 2EIAA 2GOLB 2JPRA 1QRJA 5HGMA 1HQBA 2KOOA 2Y4ZA 2EHSA 1ZMBA 1D1DA 4HTWA 3DS0A 1VQKP 2X2DD 2BUOA 1VQ7P 1A8OA 4MRTC 2VLOA 2DNWA 2CG5B 4XFZA 3H4EA 2XDEA 1L0HA 1AF8A 1KQSO 1Z6MA 2N50A 2AFDA 1IMPA 5F2OA 2JGPA 3MGEA 3CCRP 5HGOA 3GJNA 3DPHA 2N5HA 3G1GA 4COCA 1VQMP 2LTEA 2VSQA 1GXHA 1HY8A 2CNRA 2LKIA 2FVAA 2XGUA 2CGQA 5I4TG 2PWOA 2FQ1A 2K2QA 3CPWO 1VQLP 2EHTA 1YIJP 1M9YC 4U0EA 2GDWA 3P05A 2PWMA 1YJNP 2XXMA 4H2XC 3DS4A 2KGDA 2Z44A 4B4NA 4DG9A 3G26A 1AFVA 2PEKA 3CCQP 4U0BA 5HGKA 4PH2A 4F37A 4U0CA 2DGYA 2LPKA 1K30A 4J93A 1EOQA 2X83A 2PEJA 2KG6A 4XFYA 2KG9A 2M8PA 5KP6B 3DTJA 2VLNA 4BPHA 3GZMA 1NJIQ 3BP9A 1YJ9P 3E2DA 1G03A 3B5IA 3WBHA 3G6EP 2PEOA 1K9MQ 1VQ6P 3CCSP 1M9XC 2FADA 2L6EA 1M6EX 2GDYA 1M9FC 5HGLA 3DS1A 5BS1A 1L0IA 4R0MA 2JO0A 1VQ9P 5KP8B 2GYKA 4U0DA 2L9FA 4IZ6A 4H2YC 5CZDB 5JPAA 1VQ5P 1UJZA 2X2BA 2L22A 3CD6P 1M9EC 1F80D 2ROQA 1M74A 3G29A 1KLPA 2GDXA 2L4BA 2KG8A 4U0FA 3CCVP 2PEMA 5HV8A 4E92A 1EIAA 2N6YA 2AF8A 3I55P 1QVFO 2VLQA 2AFEA 2N5IA 2LL8A 3LMOA 1CEIA 1Q86Q 1AUMA 2KGAA 2CQ8A 4XRQA 2GZGA 3G28A 1UNKA 5F2KA 1GWPA
chains in the Genus database with same CATH topology
2LF4A 1M90Q 3CC4P 3P05A 2PWMA 1YJNP 2XXMA 4DGEC 5BS2A 3DS4A 2Z44A 3RG6C 4B4NA 3G26A 2GONA 3CMEP 1AFVA 4QNBA 2PEKA 3CCQP 2Z45A 4U0BA 2JYLA 4NX4C 3DS5A 5HGKA 1YHQP 4PH2A 4U0CA 2DGYA 2KGFA 2WLVB 1M6NA 2QEXP 1K30A 4J93A 1EOQA 1Q7YQ 3VRLC 2X83A 3G4SP 2PEJA 3NTEA 3CCMP 4XFYA 2EG5A 1E6JP 4M0IA 3CCUP 2M8PA 3H0DA 2XT1A 3M1MA 2XGYA 3DS3A 3HZQA 4DGAC 1Q81Q 3DTJA 4LQWC 1A43A 2PEQA 4GR6A 3CC7P 1NJIQ 3BP9A 1VQ4P 1M9DC 4E91A 2M8LA 2PXRC 3Q20A 1YJ9P 2EFJA 1BAJA 2KODA 3E2DA 1G03A 1L6NA 4PH3A 1K8AQ 3CXCO 3B5IA 4IPYA 3WBHA 2PEIA 2V4XA 4XROA 3G6EP 2PY8A 1U7KA 2PEOA 1K9MQ 1VQ6P 3CCSP 2OARA 3G1IA 1M9XC 2QA4P 4U0AA 2L6EA 1M6EX 2EIAA 1M9FC 5HGLA 3DS1A 5BS1A 1YI2P 1VQ8P 2JO0A 2GOLB 2JPRA 1VQ9P 1QRJA 3G71P 2CWOA 1JJ2O 5HGMA 1VQOP 4PH0A 2Y4ZA 1ZMBA 4U0DA 4XFXA 1Q82Q 1D1DA 1N8RQ 4HTWA 3DS0A 1VQKP 2X2DD 2BUOA 5JPAA 1VQNP 1RNIA 5F2NA 1A8OA 1VQ5P 1K73Q 1VQ7P 3H47A 3OW2O 4COPA 3CCEP 1M1KQ 3CD6P 1RO2A 1M9EC 4XFZA 1IUQA 1KD1Q 3H4EA 3G21A 1M74A 1QVGO 4GR2A 2XDEA 3G29A 1P7NA 3CCJP 2WLVA 1EM9A 2Z46A 4U0FA 1AK4C 3CCVP 2PENA 2PEMA 3LRYA 4WYMA 4E92A 1VQPP 2E1MA 1EIAA 1KQSO 3G0VA 5F2OA 2OTJP 3I55P 4PH1A 1QVFO 3MGEA 5DCKA 2JYGA 4INBA 3CCRP 2M8NA 5HGOA 3I56P 2P9XA 3DPHA 3G1GA 1YJWP 4COCA 1RO0A 1VQMP 3HYBA 1W2BO 2X82A 1YITP 1M9CC 1Q86Q 1AUMA 2XGUA 1S72P 5I4TG 1KC8Q 2PWOA 2BHVA 4XRQA 2XV6A 2OTLP 2ONTA 2XGVA 5HGNA 3G28A 3CPWO 1VQLP 3CC2P 5F2KA 1YIJP 3CCLP 1M9YC 4U0EA 1GWPA 3CMAP 3DS2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LF4 A;  3P05 A;  2PWM A;  2XXM A;  4DGE C;  3DS4 A;  4B4N A;  3G26 A;  2GON A;  1AFV A;  4QNB A;  4U0B A;  2JYL A;  4NX4 C;  3DS5 A;  5HGK A;  4PH2 A;  4U0C A;  2KGF A;  2WLV B;  4J93 A;  1EOQ A;  3VRL C;  2X83 A;  3NTE A;  4XFY A;  1E6J P;  4M0I A;  2M8P A;  2XT1 A;  2XGY A;  3DS3 A;  4DGA C;  3DTJ A;  4LQW C;  1A43 A;  3BP9 A;  1M9D C;  4E91 A;  2M8L A;  2PXR C;  1BAJ A;  2KOD A;  1G03 A;  1L6N A;  4PH3 A;  4IPY A;  2V4X A;  4XRO A;  1U7K A;  3G1I A;  1M9X C;  4U0A A;  2L6E A;  2EIA A;  1M9F C;  5HGL A;  3DS1 A;  2JO0 A;  2GOL B;  2JPR A;  1QRJ A;  5HGM A;  4PH0 A;  2Y4Z A;  4U0D A;  4XFX A;  1D1D A;  4HTW A;  3DS0 A;  2X2D D;  2BUO A;  5JPA A;  1A8O A;  3H47 A;  4COP A;  1M9E C;  4XFZ A;  3H4E A;  3G21 A;  2XDE A;  3G29 A;  1P7N A;  2WLV A;  1EM9 A;  4U0F A;  1AK4 C;  3LRY A;  4WYM A;  4E92 A;  1EIA A;  3G0V A;  4PH1 A;  3MGE A;  5DCK A;  2JYG A;  4INB A;  2M8N A;  5HGO A;  3DPH A;  3G1G A;  4COC A;  2X82 A;  1M9C C;  1AUM A;  2XGU A;  5I4T G;  2PWO A;  4XRQ A;  2XV6 A;  2ONT A;  2XGV A;  5HGN A;  3G28 A;  1M9Y C;  4U0E A;  1GWP A;  3DS2 A; 
#chains in the Genus database with same CATH topology
 1M90 Q;  3CC4 P;  5BS2 A;  1GXG A;  2MR8 A;  4HKG A;  2KW2 A;  2KGC A;  2GZI A;  2JYL A;  3DS5 A;  2K94 A;  3RG2 A;  2LOL A;  3H0D A;  2XGY A;  2MY5 A;  4DGA C;  2M5R A;  2M8L A;  2MF4 A;  3NY7 B;  2MR7 A;  3Q20 A;  3GKL C;  2KOD A;  1GPJ A;  2V4X A;  1U7K A;  2MD9 A;  2K0D X;  2QA4 P;  4U0A A;  2MVV A;  1X3O A;  1YI2 P;  1VQ8 P;  2CWO A;  2FAE A;  3EJD A;  2ERH A;  1DV5 A;  1Q82 Q;  4XFX A;  1N8R Q;  1VQN P;  2JU1 A;  1RNI A;  1K73 Q;  2KOR A;  3H47 A;  4BPG A;  2GZJ A;  3CCE P;  2FQ2 A;  1RO2 A;  1KD1 Q;  1VKU A;  1QVG O;  2L0Q A;  3CCJ P;  1P7N A;  2WLV A;  1AK4 C;  3LRY A;  4WYM A;  2AVA A;  2OTJ P;  4INB A;  2M8N A;  1EMV A;  3GZL A;  3I56 P;  2JB0 A;  1RO0 A;  2N98 A;  3HYB A;  1W2B O;  2X82 A;  1S72 P;  1ACP A;  5HVC A;  3EJB A;  1KC8 Q;  2XV6 A;  4BPF A;  2ONT A;  3CCL P;  4QKO A;  1DNY A;  2K5X A;  4DGE C;  1VHN A;  2N6Z A;  2QNW A;  3CME P;  2KOP A;  1YHQ P;  4PWV B;  2WLV B;  1M6N A;  2QEX P;  3NTE A;  4M0I A;  3CCU P;  1BXI A;  2JAZ A;  1OR5 A;  3DS3 A;  4LQW C;  2KOS A;  1A43 A;  2PEQ A;  2PNG A;  4CA3 A;  1VQ4 P;  4E91 A;  2PXR C;  1L6N A;  3B4Q A;  3CXC O;  4IPY A;  4XRO A;  2XZ0 D;  2FAC A;  5EJD A;  1T8K A;  1E0H A;  2K92 A;  1FR2 A;  2K0Y A;  2FHS C;  3G71 P;  1JJ2 O;  4NEO A;  1VQO P;  4PH0 A;  2KR5 A;  2KGE A;  5F2N A;  2FVF A;  3OW2 O;  4COP A;  1M1K Q;  3CE7 A;  1IUQ A;  3G21 A;  4GR2 A;  2KOQ A;  3EJE A;  1EM9 A;  2K93 A;  2Z46 A;  2PEN A;  1VQP P;  2E1M A;  5KP7 B;  3G0V A;  1IMQ A;  4PH1 A;  5DCK A;  2JYG A;  2P9X A;  1YJW P;  1NQ4 A;  1YIT P;  1M9C C;  2FVE A;  2NO8 A;  2XZ1 C;  2BHV A;  2OTL P;  2LML A;  2XGV A;  5HGN A;  3CC2 P;  1ZNV A;  2MVU A;  3CMA P;  3DS2 A;  4UHP B;  2LF4 A;  4PXH B;  2FQ0 A;  4H2W C;  2JQ4 A;  3RG6 C;  2LIW A;  2GON A;  2JU2 A;  4QNB A;  2Z45 A;  4NX4 C;  2LIU A;  2KGF A;  3U43 A;  1Q7Y Q;  3VRL C;  3G4S P;  2KWL A;  2GZF A;  7CEI A;  3CCM P;  5EW5 E;  2EG5 A;  1E6J P;  2XT1 A;  3M1M A;  3HZQ A;  2JBG A;  1Q81 Q;  1AYI A;  2GZE A;  4GR6 A;  3CC7 P;  1M9D C;  2K0X A;  2EFJ A;  1BAJ A;  2WPT A;  4PH3 A;  1K8A Q;  2PEI A;  2PY8 A;  1MZ8 A;  2VLP A;  2OAR A;  3G1I A;  2EIA A;  2GOL B;  2JPR A;  1QRJ A;  5HGM A;  1HQB A;  2KOO A;  2Y4Z A;  2EHS A;  1ZMB A;  1D1D A;  4HTW A;  3DS0 A;  1VQK P;  2X2D D;  2BUO A;  1VQ7 P;  1A8O A;  4MRT C;  2VLO A;  2DNW A;  2CG5 B;  4XFZ A;  3H4E A;  2XDE A;  1L0H A;  1AF8 A;  1KQS O;  1Z6M A;  2N50 A;  2AFD A;  1IMP A;  5F2O A;  2JGP A;  3MGE A;  3CCR P;  5HGO A;  3GJN A;  3DPH A;  2N5H A;  3G1G A;  4COC A;  1VQM P;  2LTE A;  2VSQ A;  1GXH A;  1HY8 A;  2CNR A;  2LKI A;  2FVA A;  2XGU A;  2CGQ A;  5I4T G;  2PWO A;  2FQ1 A;  2K2Q A;  3CPW O;  1VQL P;  2EHT A;  1YIJ P;  1M9Y C;  4U0E A;  2GDW A;  3P05 A;  2PWM A;  1YJN P;  2XXM A;  4H2X C;  3DS4 A;  2KGD A;  2Z44 A;  4B4N A;  4DG9 A;  3G26 A;  1AFV A;  2PEK A;  3CCQ P;  4U0B A;  5HGK A;  4PH2 A;  4F37 A;  4U0C A;  2DGY A;  2LPK A;  1K30 A;  4J93 A;  1EOQ A;  2X83 A;  2PEJ A;  2KG6 A;  4XFY A;  2KG9 A;  2M8P A;  5KP6 B;  3DTJ A;  2VLN A;  4BPH A;  3GZM A;  1NJI Q;  3BP9 A;  1YJ9 P;  3E2D A;  1G03 A;  3B5I A;  3WBH A;  3G6E P;  2PEO A;  1K9M Q;  1VQ6 P;  3CCS P;  1M9X C;  2FAD A;  2L6E A;  1M6E X;  2GDY A;  1M9F C;  5HGL A;  3DS1 A;  5BS1 A;  1L0I A;  4R0M A;  2JO0 A;  1VQ9 P;  5KP8 B;  2GYK A;  4U0D A;  2L9F A;  4IZ6 A;  4H2Y C;  5CZD B;  5JPA A;  1VQ5 P;  1UJZ A;  2X2B A;  2L22 A;  3CD6 P;  1M9E C;  1F80 D;  2ROQ A;  1M74 A;  3G29 A;  1KLP A;  2GDX A;  2L4B A;  2KG8 A;  4U0F A;  3CCV P;  2PEM A;  5HV8 A;  4E92 A;  1EIA A;  2N6Y A;  2AF8 A;  3I55 P;  1QVF O;  2VLQ A;  2AFE A;  2N5I A;  2LL8 A;  3LMO A;  1CEI A;  1Q86 Q;  1AUM A;  2KGA A;  2CQ8 A;  4XRQ A;  2GZG A;  3G28 A;  1UNK A;  5F2K A;  1GWP A; 
#chains in the Genus database with same CATH homology
 2LF4 A;  1M90 Q;  3CC4 P;  3P05 A;  2PWM A;  1YJN P;  2XXM A;  4DGE C;  5BS2 A;  3DS4 A;  2Z44 A;  3RG6 C;  4B4N A;  3G26 A;  2GON A;  3CME P;  1AFV A;  4QNB A;  2PEK A;  3CCQ P;  2Z45 A;  4U0B A;  2JYL A;  4NX4 C;  3DS5 A;  5HGK A;  1YHQ P;  4PH2 A;  4U0C A;  2DGY A;  2KGF A;  2WLV B;  1M6N A;  2QEX P;  1K30 A;  4J93 A;  1EOQ A;  1Q7Y Q;  3VRL C;  2X83 A;  3G4S P;  2PEJ A;  3NTE A;  3CCM P;  4XFY A;  2EG5 A;  1E6J P;  4M0I A;  3CCU P;  2M8P A;  3H0D A;  2XT1 A;  3M1M A;  2XGY A;  3DS3 A;  3HZQ A;  4DGA C;  1Q81 Q;  3DTJ A;  4LQW C;  1A43 A;  2PEQ A;  4GR6 A;  3CC7 P;  1NJI Q;  3BP9 A;  1VQ4 P;  1M9D C;  4E91 A;  2M8L A;  2PXR C;  3Q20 A;  1YJ9 P;  2EFJ A;  1BAJ A;  2KOD A;  3E2D A;  1G03 A;  1L6N A;  4PH3 A;  1K8A Q;  3CXC O;  3B5I A;  4IPY A;  3WBH A;  2PEI A;  2V4X A;  4XRO A;  3G6E P;  2PY8 A;  1U7K A;  2PEO A;  1K9M Q;  1VQ6 P;  3CCS P;  2OAR A;  3G1I A;  1M9X C;  2QA4 P;  4U0A A;  2L6E A;  1M6E X;  2EIA A;  1M9F C;  5HGL A;  3DS1 A;  5BS1 A;  1YI2 P;  1VQ8 P;  2JO0 A;  2GOL B;  2JPR A;  1VQ9 P;  1QRJ A;  3G71 P;  2CWO A;  1JJ2 O;  5HGM A;  1VQO P;  4PH0 A;  2Y4Z A;  1ZMB A;  4U0D A;  4XFX A;  1Q82 Q;  1D1D A;  1N8R Q;  4HTW A;  3DS0 A;  1VQK P;  2X2D D;  2BUO A;  5JPA A;  1VQN P;  1RNI A;  5F2N A;  1A8O A;  1VQ5 P;  1K73 Q;  1VQ7 P;  3H47 A;  3OW2 O;  4COP A;  3CCE P;  1M1K Q;  3CD6 P;  1RO2 A;  1M9E C;  4XFZ A;  1IUQ A;  1KD1 Q;  3H4E A;  3G21 A;  1M74 A;  1QVG O;  4GR2 A;  2XDE A;  3G29 A;  1P7N A;  3CCJ P;  2WLV A;  1EM9 A;  2Z46 A;  4U0F A;  1AK4 C;  3CCV P;  2PEN A;  2PEM A;  3LRY A;  4WYM A;  4E92 A;  1VQP P;  2E1M A;  1EIA A;  1KQS O;  3G0V A;  5F2O A;  2OTJ P;  3I55 P;  4PH1 A;  1QVF O;  3MGE A;  5DCK A;  2JYG A;  4INB A;  3CCR P;  2M8N A;  5HGO A;  3I56 P;  2P9X A;  3DPH A;  3G1G A;  1YJW P;  4COC A;  1RO0 A;  1VQM P;  3HYB A;  1W2B O;  2X82 A;  1YIT P;  1M9C C;  1Q86 Q;  1AUM A;  2XGU A;  1S72 P;  5I4T G;  1KC8 Q;  2PWO A;  2BHV A;  4XRQ A;  2XV6 A;  2OTL P;  2ONT A;  2XGV A;  5HGN A;  3G28 A;  3CPW O;  1VQL P;  3CC2 P;  5F2K A;  1YIJ P;  3CCL P;  1M9Y C;  4U0E A;  1GWP A;  3CMA P;  3DS2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...