5HGNA

Hexameric hiv-1 ca, apo form
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
205
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQTLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 uses dynamic capsid pores to import nucleotides and fuel encapsidated DNA synthesis.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein P24
total genus 73
structure length 205
sequence length 219
ec nomenclature
pdb deposition date 2016-01-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 5hgnA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 5hgnA02
3G1IA 2LF4A 3NTEA 4QNBA 2XV6A 3VRLC 1M9EC 2PWOA 2L6EA 4INBA 3P05A 4XRQA 2X83A 4XROA 2XGVA 4U0BA 2JO0A 2XXMA 2XGYA 3DS3A 2KODA 2M8NA 2M8PA 1M9CC 3G29A 3G0VA 1EIAA 2X2DD 1L6NA 3DS4A 4E92A 1EOQA 1QRJA 3MGEA 1P7NA 4XFZA 4LQWC 3G21A 4M0IA 4DGAC 2JYLA 2JYGA 3LRYA 2GOLB 1AK4C 2WLVB 1BAJA 4XFYA 1A43A 2PWMA 2PXRC 2JPRA 1A8OA 3DS0A 1EM9A 5HGLA 5I4TG 4NX4C 4PH0A 2KGFA 4DGEC 2Y4ZA 3DS1A 3G1GA 5HGMA 4PH1A 3H4EA 2XGUA 2M8LA 1AFVA 5HGNA 3G28A 2WLVA 4U0EA 4B4NA 2EIAA 3BP9A 2V4XA 4U0DA 4XFXA 2X82A 5HGKA 3DS5A 1G03A 3DPHA 3DTJA 5HGOA 3G26A 4HTWA 1D1DA 4U0AA 3H47A 4U0FA 1M9YC 5DCKA 4COPA 4PH3A 4U0CA 1M9XC 1M9FC 1U7KA 2BUOA 1E6JP 2GONA 4COCA 4PH2A 2XT1A 3DS2A 5JPAA 1GWPA 1M9DC 4IPYA 4E91A 2ONTA 1AUMA 4J93A 4WYMA 2XDEA
chains in the Genus database with same CATH superfamily
2LF4A 2PWOA 1VQNP 2N5HA 7CEIA 5F2KA 2OTLP 4BPGA 3CC2P 1E0HA 3GKLC 2PNGA 1ZNVA 1MZ8A 1KLPA 2GYKA 2K92A 1M1KQ 2KODA 3CCSP 2P9XA 1ZMBA 1YJWP 4R0MA 1EIAA 2M5RA 4QKOA 2KOPA 2VLQA 1EOQA 2KORA 2BHVA 2LL8A 3MGEA 3CCUP 1IMQA 1GXGA 2JYLA 3EJEA 1BAJA 3WBHA 4H2YC 3CD6P 2PXRC 2JPRA 1A8OA 2KOOA 1KQSO 1IMPA 3EJDA 3RG2A 2KG6A 3G1GA 5HGMA 3H4EA 1AFVA 2KGAA 4H2WC 5HGNA 2CWOA 4U0EA 2OTJP 1CEIA 3BP9A 4U0DA 1QVFO 2X82A 3DS5A 4GR2A 2GZFA 3DPHA 2L4BA 5HGOA 2EG5A 1KD1Q 1K30A 1YIJP 1D1DA 2CNRA 2K0XA 4U0AA 2JB0A 3CC7P 1M9YC 3B5IA 1Z6MA 1HQBA 3E2DA 4GR6A 4PH2A 3DS2A 3B4QA 5JPAA 1M9DC 2LMLA 1RO0A 1M6NA 2XZ1C 2EHSA 4PXHB 1VQPP 2GZEA 2KG9A 2KW2A 2N5IA 2AVAA 2L22A 4XROA 3CCLP 1YJ9P 2PEKA 1VHNA 2XGVA 1HY8A 1Q81Q 2JO0A 2Z44A 2LTEA 2XGYA 1RO2A 3NY7B 4DG9A 2LIWA 1VQ6P 2M8PA 1VQOP 2QA4P 5KP6B 1VQ9P 2GZJA 2Z46A 2FQ2A 2X2BA 3DS4A 3U43A 1JJ2O 4E92A 2MVVA 2NO8A 4XFZA 2MR8A 4M0IA 3LRYA 1VQ4P 1M90Q 4XFYA 5KP8B 1A43A 2PWMA 2K5XA 2PEQA 1GPJA 1VKUA 2KGFA 2FAEA 3CCQP 2AFEA 2JU1A 2ROQA 4PH1A 2KGEA 3GJNA 3G28A 5BS2A 2GZIA 2EIAA 2N98A 2KGDA 1L0IA 2XZ0D 5HGKA 2KOQA 2KG8A 3DTJA 1DV5A 2GZGA 2DNWA 2WPTA 2MD9A 4U0FA 2KWLA 3LMOA 4COPA 4PH3A 4U0CA 2KGCA 1IUQA 1NJIQ 1E6JP 2PEJA 2XT1A 4PWVB 1GWPA 1N8RQ 1M74A 5EJDA 3EJBA 1UJZA 2KR5A 2XDEA 3CCVP 3NTEA 4QNBA 2FHSC 2XV6A 3VRLC 2L6EA 3P05A 2EHTA 2X83A 4U0BA 2XXMA 3CCJP 2LIUA 2FADA 2FQ0A 2PEIA 2M8NA 2QEXP 3M1MA 2DGYA 3HZQA 1UNKA 2EFJA 2X2DD 4MRTC 2QNWA 5HVCA 5HV8A 1YI2P 1VQ5P 4LQWC 3CXCO 1K9MQ 4DGAC 2FQ1A 2JYGA 3CCRP 2WLVB 3CMEP 1KC8Q 3CCMP 2JQ4A 5HGLA 1S72P 2VLNA 5I4TG 4NX4C 4HKGA 4PH0A 1W2BO 2K0DX 2MR7A 2LKIA 1T8KA 1QVGO 4B4NA 1L0HA 4XFXA 2PENA 1M6EX 3GZMA 1G03A 2FVFA 4UHPB 2CGQA 4F37A 3G4SP 2K2QA 2PY8A 3G26A 1YITP 4HTWA 5KP7B 1GXHA 3H47A 2JAZA 1X3OA 5DCKA 1Q86Q 2BUOA 2GONA 3CMAP 2E1MA 2L9FA 4BPFA 2ONTA 5F2NA 1ACPA 1Q82Q 2PEMA 2GDXA 4WYMA 2CQ8A 1DNYA 4NEOA 5EW5E 3G1IA 2MF4A 2FACA 1M9EC 4CA3A 2N50A 4INBA 2K93A 4XRQA 1YHQP 2GDWA 5CZDB 1FR2A 2VLOA 3DS3A 2MVUA 2L0QA 2LOLA 3I55P 2JBGA 1M9CC 1AF8A 3G29A 2K0YA 1AYIA 3G0VA 2GDYA 3RG6C 1L6NA 3H0DA 2MY5A 3Q20A 2JU2A 2FVAA 5F2OA 1K73Q 2N6YA 4IZ6A 1QRJA 3HYBA 1P7NA 2CG5B 3CE7A 2AF8A 2AFDA 3G21A 1BXIA 2GOLB 1AK4C 3CC4P 2VLPA 5BS1A 3GZLA 1Q7YQ 3DS0A 1EM9A 3OW2O 1VQMP 2ERHA 2PEOA 2LPKA 2N6ZA 2VSQA 4DGEC 2Y4ZA 3DS1A 3G71P 2XGUA 2M8LA 2WLVA 2V4XA 1VQLP 3CPWO 1OR5A 1VQ8P 1VQKP 1EMVA 1K8AQ 4H2XC 2KOSA 1YJNP 1NQ4A 1M9XC 1M9FC 1U7KA 2JGPA 4BPHA 4COCA 3G6EP 4IPYA 4E91A 2FVEA 1AUMA 2K94A 4J93A 1F80D 1RNIA 3I56P 3CCEP 2OARA 2Z45A 1VQ7P
chains in the Genus database with same CATH topology
3G1IA 2LF4A 3NTEA 4QNBA 2XV6A 3VRLC 1M9EC 2PWOA 2L6EA 1VQNP 4INBA 3P05A 4XRQA 5F2KA 2OTLP 1YHQP 3CC2P 2X83A 4XROA 3CCLP 1YJ9P 2PEKA 2XGVA 1Q81Q 4U0BA 2JO0A 2XXMA 2Z44A 3CCJP 2XGYA 1RO2A 3DS3A 1M1KQ 1VQ6P 2PEIA 2KODA 2M8NA 2M8PA 1VQOP 3I55P 2QA4P 3CCSP 2QEXP 1M9CC 3G29A 3M1MA 1VQ9P 2DGYA 3G0VA 2P9XA 1ZMBA 1YJWP 1EIAA 3RG6C 3HZQA 2EFJA 2Z46A 2X2DD 1L6NA 3DS4A 3H0DA 1JJ2O 4E92A 1EOQA 3Q20A 5F2OA 1K73Q 2BHVA 1QRJA 3MGEA 1VQ5P 3HYBA 3CCUP 1P7NA 1YI2P 4XFZA 1QVFO 4LQWC 3G21A 3CXCO 4M0IA 1K9MQ 4DGAC 2JYLA 2JYGA 3LRYA 3CCRP 1VQ4P 2GOLB 1AK4C 3CC4P 2WLVB 1BAJA 1M90Q 3CMEP 3WBHA 4XFYA 5BS1A 1A43A 2PWMA 2PXRC 1KC8Q 2JPRA 1A8OA 3CCMP 3CD6P 1Q7YQ 3DS0A 1EM9A 3OW2O 5HGLA 1S72P 1KQSO 5I4TG 1VQMP 4NX4C 2PEOA 2PEQA 4PH0A 1W2BO 2KGFA 3CCQP 4DGEC 2Y4ZA 3DS1A 3G1GA 5HGMA 3G71P 4PH1A 3H4EA 2XGUA 2M8LA 1AFVA 5HGNA 3G28A 2WLVA 2CWOA 4U0EA 5BS2A 1QVGO 2OTJP 4B4NA 2EIAA 3BP9A 2V4XA 4U0DA 4XFXA 2X82A 5HGKA 1M6EX 2PENA 3DS5A 4GR2A 1VQLP 1G03A 3DPHA 3DTJA 3CPWO 5HGOA 3G4SP 1VQ8P 2EG5A 2PY8A 3G26A 1K30A 1KD1Q 1VQKP 1YIJP 1K8AQ 1YITP 4HTWA 1D1DA 4U0AA 3H47A 4U0FA 1YJNP 3CC7P 1M9YC 5DCKA 1Q86Q 3B5IA 4PH3A 4COPA 4U0CA 1M9XC 1M9FC 1IUQA 1NJIQ 1U7KA 3E2DA 2BUOA 1E6JP 2GONA 4GR6A 4COCA 2PEJA 3CMAP 4PH2A 2E1MA 2XT1A 3DS2A 3G6EP 5JPAA 1GWPA 1M9DC 4IPYA 4E91A 2ONTA 5F2NA 1M74A 1N8RQ 1AUMA 1Q82Q 2PEMA 4J93A 1RO0A 1M6NA 1RNIA 4WYMA 1VQPP 3I56P 3CCEP 2OARA 2Z45A 2XDEA 3CCVP 1VQ7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1I A;  2LF4 A;  3NTE A;  4QNB A;  2XV6 A;  3VRL C;  1M9E C;  2PWO A;  2L6E A;  4INB A;  3P05 A;  4XRQ A;  2X83 A;  4XRO A;  2XGV A;  4U0B A;  2JO0 A;  2XXM A;  2XGY A;  3DS3 A;  2KOD A;  2M8N A;  2M8P A;  1M9C C;  3G29 A;  3G0V A;  1EIA A;  2X2D D;  1L6N A;  3DS4 A;  4E92 A;  1EOQ A;  1QRJ A;  3MGE A;  1P7N A;  4XFZ A;  4LQW C;  3G21 A;  4M0I A;  4DGA C;  2JYL A;  2JYG A;  3LRY A;  2GOL B;  1AK4 C;  2WLV B;  1BAJ A;  4XFY A;  1A43 A;  2PWM A;  2PXR C;  2JPR A;  1A8O A;  3DS0 A;  1EM9 A;  5HGL A;  5I4T G;  4NX4 C;  4PH0 A;  2KGF A;  4DGE C;  2Y4Z A;  3DS1 A;  3G1G A;  5HGM A;  4PH1 A;  3H4E A;  2XGU A;  2M8L A;  1AFV A;  5HGN A;  3G28 A;  2WLV A;  4U0E A;  4B4N A;  2EIA A;  3BP9 A;  2V4X A;  4U0D A;  4XFX A;  2X82 A;  5HGK A;  3DS5 A;  1G03 A;  3DPH A;  3DTJ A;  5HGO A;  3G26 A;  4HTW A;  1D1D A;  4U0A A;  3H47 A;  4U0F A;  1M9Y C;  5DCK A;  4COP A;  4PH3 A;  4U0C A;  1M9X C;  1M9F C;  1U7K A;  2BUO A;  1E6J P;  2GON A;  4COC A;  4PH2 A;  2XT1 A;  3DS2 A;  5JPA A;  1GWP A;  1M9D C;  4IPY A;  4E91 A;  2ONT A;  1AUM A;  4J93 A;  4WYM A;  2XDE A; 
#chains in the Genus database with same CATH topology
 2LF4 A;  2PWO A;  1VQN P;  2N5H A;  7CEI A;  5F2K A;  2OTL P;  4BPG A;  3CC2 P;  1E0H A;  3GKL C;  2PNG A;  1ZNV A;  1MZ8 A;  1KLP A;  2GYK A;  2K92 A;  1M1K Q;  2KOD A;  3CCS P;  2P9X A;  1ZMB A;  1YJW P;  4R0M A;  1EIA A;  2M5R A;  4QKO A;  2KOP A;  2VLQ A;  1EOQ A;  2KOR A;  2BHV A;  2LL8 A;  3MGE A;  3CCU P;  1IMQ A;  1GXG A;  2JYL A;  3EJE A;  1BAJ A;  3WBH A;  4H2Y C;  3CD6 P;  2PXR C;  2JPR A;  1A8O A;  2KOO A;  1KQS O;  1IMP A;  3EJD A;  3RG2 A;  2KG6 A;  3G1G A;  5HGM A;  3H4E A;  1AFV A;  2KGA A;  4H2W C;  5HGN A;  2CWO A;  4U0E A;  2OTJ P;  1CEI A;  3BP9 A;  4U0D A;  1QVF O;  2X82 A;  3DS5 A;  4GR2 A;  2GZF A;  3DPH A;  2L4B A;  5HGO A;  2EG5 A;  1KD1 Q;  1K30 A;  1YIJ P;  1D1D A;  2CNR A;  2K0X A;  4U0A A;  2JB0 A;  3CC7 P;  1M9Y C;  3B5I A;  1Z6M A;  1HQB A;  3E2D A;  4GR6 A;  4PH2 A;  3DS2 A;  3B4Q A;  5JPA A;  1M9D C;  2LML A;  1RO0 A;  1M6N A;  2XZ1 C;  2EHS A;  4PXH B;  1VQP P;  2GZE A;  2KG9 A;  2KW2 A;  2N5I A;  2AVA A;  2L22 A;  4XRO A;  3CCL P;  1YJ9 P;  2PEK A;  1VHN A;  2XGV A;  1HY8 A;  1Q81 Q;  2JO0 A;  2Z44 A;  2LTE A;  2XGY A;  1RO2 A;  3NY7 B;  4DG9 A;  2LIW A;  1VQ6 P;  2M8P A;  1VQO P;  2QA4 P;  5KP6 B;  1VQ9 P;  2GZJ A;  2Z46 A;  2FQ2 A;  2X2B A;  3DS4 A;  3U43 A;  1JJ2 O;  4E92 A;  2MVV A;  2NO8 A;  4XFZ A;  2MR8 A;  4M0I A;  3LRY A;  1VQ4 P;  1M90 Q;  4XFY A;  5KP8 B;  1A43 A;  2PWM A;  2K5X A;  2PEQ A;  1GPJ A;  1VKU A;  2KGF A;  2FAE A;  3CCQ P;  2AFE A;  2JU1 A;  2ROQ A;  4PH1 A;  2KGE A;  3GJN A;  3G28 A;  5BS2 A;  2GZI A;  2EIA A;  2N98 A;  2KGD A;  1L0I A;  2XZ0 D;  5HGK A;  2KOQ A;  2KG8 A;  3DTJ A;  1DV5 A;  2GZG A;  2DNW A;  2WPT A;  2MD9 A;  4U0F A;  2KWL A;  3LMO A;  4COP A;  4PH3 A;  4U0C A;  2KGC A;  1IUQ A;  1NJI Q;  1E6J P;  2PEJ A;  2XT1 A;  4PWV B;  1GWP A;  1N8R Q;  1M74 A;  5EJD A;  3EJB A;  1UJZ A;  2KR5 A;  2XDE A;  3CCV P;  3NTE A;  4QNB A;  2FHS C;  2XV6 A;  3VRL C;  2L6E A;  3P05 A;  2EHT A;  2X83 A;  4U0B A;  2XXM A;  3CCJ P;  2LIU A;  2FAD A;  2FQ0 A;  2PEI A;  2M8N A;  2QEX P;  3M1M A;  2DGY A;  3HZQ A;  1UNK A;  2EFJ A;  2X2D D;  4MRT C;  2QNW A;  5HVC A;  5HV8 A;  1YI2 P;  1VQ5 P;  4LQW C;  3CXC O;  1K9M Q;  4DGA C;  2FQ1 A;  2JYG A;  3CCR P;  2WLV B;  3CME P;  1KC8 Q;  3CCM P;  2JQ4 A;  5HGL A;  1S72 P;  2VLN A;  5I4T G;  4NX4 C;  4HKG A;  4PH0 A;  1W2B O;  2K0D X;  2MR7 A;  2LKI A;  1T8K A;  1QVG O;  4B4N A;  1L0H A;  4XFX A;  2PEN A;  1M6E X;  3GZM A;  1G03 A;  2FVF A;  4UHP B;  2CGQ A;  4F37 A;  3G4S P;  2K2Q A;  2PY8 A;  3G26 A;  1YIT P;  4HTW A;  5KP7 B;  1GXH A;  3H47 A;  2JAZ A;  1X3O A;  5DCK A;  1Q86 Q;  2BUO A;  2GON A;  3CMA P;  2E1M A;  2L9F A;  4BPF A;  2ONT A;  5F2N A;  1ACP A;  1Q82 Q;  2PEM A;  2GDX A;  4WYM A;  2CQ8 A;  1DNY A;  4NEO A;  5EW5 E;  3G1I A;  2MF4 A;  2FAC A;  1M9E C;  4CA3 A;  2N50 A;  4INB A;  2K93 A;  4XRQ A;  1YHQ P;  2GDW A;  5CZD B;  1FR2 A;  2VLO A;  3DS3 A;  2MVU A;  2L0Q A;  2LOL A;  3I55 P;  2JBG A;  1M9C C;  1AF8 A;  3G29 A;  2K0Y A;  1AYI A;  3G0V A;  2GDY A;  3RG6 C;  1L6N A;  3H0D A;  2MY5 A;  3Q20 A;  2JU2 A;  2FVA A;  5F2O A;  1K73 Q;  2N6Y A;  4IZ6 A;  1QRJ A;  3HYB A;  1P7N A;  2CG5 B;  3CE7 A;  2AF8 A;  2AFD A;  3G21 A;  1BXI A;  2GOL B;  1AK4 C;  3CC4 P;  2VLP A;  5BS1 A;  3GZL A;  1Q7Y Q;  3DS0 A;  1EM9 A;  3OW2 O;  1VQM P;  2ERH A;  2PEO A;  2LPK A;  2N6Z A;  2VSQ A;  4DGE C;  2Y4Z A;  3DS1 A;  3G71 P;  2XGU A;  2M8L A;  2WLV A;  2V4X A;  1VQL P;  3CPW O;  1OR5 A;  1VQ8 P;  1VQK P;  1EMV A;  1K8A Q;  4H2X C;  2KOS A;  1YJN P;  1NQ4 A;  1M9X C;  1M9F C;  1U7K A;  2JGP A;  4BPH A;  4COC A;  3G6E P;  4IPY A;  4E91 A;  2FVE A;  1AUM A;  2K94 A;  4J93 A;  1F80 D;  1RNI A;  3I56 P;  3CCE P;  2OAR A;  2Z45 A;  1VQ7 P; 
#chains in the Genus database with same CATH homology
 3G1I A;  2LF4 A;  3NTE A;  4QNB A;  2XV6 A;  3VRL C;  1M9E C;  2PWO A;  2L6E A;  1VQN P;  4INB A;  3P05 A;  4XRQ A;  5F2K A;  2OTL P;  1YHQ P;  3CC2 P;  2X83 A;  4XRO A;  3CCL P;  1YJ9 P;  2PEK A;  2XGV A;  1Q81 Q;  4U0B A;  2JO0 A;  2XXM A;  2Z44 A;  3CCJ P;  2XGY A;  1RO2 A;  3DS3 A;  1M1K Q;  1VQ6 P;  2PEI A;  2KOD A;  2M8N A;  2M8P A;  1VQO P;  3I55 P;  2QA4 P;  3CCS P;  2QEX P;  1M9C C;  3G29 A;  3M1M A;  1VQ9 P;  2DGY A;  3G0V A;  2P9X A;  1ZMB A;  1YJW P;  1EIA A;  3RG6 C;  3HZQ A;  2EFJ A;  2Z46 A;  2X2D D;  1L6N A;  3DS4 A;  3H0D A;  1JJ2 O;  4E92 A;  1EOQ A;  3Q20 A;  5F2O A;  1K73 Q;  2BHV A;  1QRJ A;  3MGE A;  1VQ5 P;  3HYB A;  3CCU P;  1P7N A;  1YI2 P;  4XFZ A;  1QVF O;  4LQW C;  3G21 A;  3CXC O;  4M0I A;  1K9M Q;  4DGA C;  2JYL A;  2JYG A;  3LRY A;  3CCR P;  1VQ4 P;  2GOL B;  1AK4 C;  3CC4 P;  2WLV B;  1BAJ A;  1M90 Q;  3CME P;  3WBH A;  4XFY A;  5BS1 A;  1A43 A;  2PWM A;  2PXR C;  1KC8 Q;  2JPR A;  1A8O A;  3CCM P;  3CD6 P;  1Q7Y Q;  3DS0 A;  1EM9 A;  3OW2 O;  5HGL A;  1S72 P;  1KQS O;  5I4T G;  1VQM P;  4NX4 C;  2PEO A;  2PEQ A;  4PH0 A;  1W2B O;  2KGF A;  3CCQ P;  4DGE C;  2Y4Z A;  3DS1 A;  3G1G A;  5HGM A;  3G71 P;  4PH1 A;  3H4E A;  2XGU A;  2M8L A;  1AFV A;  5HGN A;  3G28 A;  2WLV A;  2CWO A;  4U0E A;  5BS2 A;  1QVG O;  2OTJ P;  4B4N A;  2EIA A;  3BP9 A;  2V4X A;  4U0D A;  4XFX A;  2X82 A;  5HGK A;  1M6E X;  2PEN A;  3DS5 A;  4GR2 A;  1VQL P;  1G03 A;  3DPH A;  3DTJ A;  3CPW O;  5HGO A;  3G4S P;  1VQ8 P;  2EG5 A;  2PY8 A;  3G26 A;  1K30 A;  1KD1 Q;  1VQK P;  1YIJ P;  1K8A Q;  1YIT P;  4HTW A;  1D1D A;  4U0A A;  3H47 A;  4U0F A;  1YJN P;  3CC7 P;  1M9Y C;  5DCK A;  1Q86 Q;  3B5I A;  4PH3 A;  4COP A;  4U0C A;  1M9X C;  1M9F C;  1IUQ A;  1NJI Q;  1U7K A;  3E2D A;  2BUO A;  1E6J P;  2GON A;  4GR6 A;  4COC A;  2PEJ A;  3CMA P;  4PH2 A;  2E1M A;  2XT1 A;  3DS2 A;  3G6E P;  5JPA A;  1GWP A;  1M9D C;  4IPY A;  4E91 A;  2ONT A;  5F2N A;  1M74 A;  1N8R Q;  1AUM A;  1Q82 Q;  2PEM A;  4J93 A;  1RO0 A;  1M6N A;  1RNI A;  4WYM A;  1VQP P;  3I56 P;  3CCE P;  2OAR A;  2Z45 A;  2XDE A;  3CCV P;  1VQ7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...