4U0FA

Hexameric hiv-1 ca in complex with bi-2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
201
Chain Sequence
b'PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
molecule tags Viral protein
source organism Human immunodeficiency virus type 1 group m subtype b
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
total genus 70
structure length 201
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0fA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0fA02
1M9DC 1E6JP 1M9CC 2X2DD 4U0CA 1AUMA 5DCKA 4J93A 4XFZA 5I4TG 2PWMA 2X82A 4U0AA 3DTJA 3G21A 3VRLC 2LF4A 4LQWC 3DS4A 3DS2A 1D1DA 2XT1A 2XGYA 2ONTA 4COCA 4COPA 1GWPA 1M9XC 2BUOA 4B4NA 4QNBA 5HGNA 4PH1A 1P7NA 4M0IA 3DS0A 4DGEC 1AK4C 3DS5A 4XFXA 2GONA 3H47A 2JYGA 4NX4C 4WYMA 4XFYA 3P05A 2EIAA 5HGOA 2V4XA 2M8LA 2Y4ZA 3DS1A 2XV6A 2XXMA 4PH0A 1M9YC 3G26A 2WLVA 2PWOA 3G0VA 5HGKA 4E92A 4U0DA 3G29A 4PH2A 2L6EA 2GOLB 3LRYA 3H4EA 1EM9A 2KGFA 2XGUA 1G03A 4U0EA 4E91A 2KODA 4XRQA 2XDEA 3MGEA 4U0FA 1QRJA 4DGAC 2JO0A 3BP9A 1M9FC 2JPRA 4XROA 3G1IA 2XGVA 2X83A 1M9EC 4U0BA 5HGMA 1EOQA 1A8OA 3DS3A 3NTEA 4INBA 1EIAA 1BAJA 1A43A 1L6NA 2M8NA 3DPHA 5JPAA 5HGLA 3G28A 2WLVB 2JYLA 4PH3A 1U7KA 3G1GA 1AFVA 4IPYA 4HTWA 2M8PA 2PXRC
chains in the Genus database with same CATH superfamily
2K92A 3NY7B 1E6JP 2GZEA 1VQ7P 4U0CA 4J93A 4XFZA 5I4TG 3CPWO 2KGCA 1K30A 2CNRA 4U0AA 3HYBA 5F2KA 2KGEA 5KP6B 2NO8A 3DS4A 1Q86Q 3DS2A 2XGYA 3M1MA 4COCA 5BS1A 2BUOA 2JU1A 4QNBA 3CE7A 1P7NA 4M0IA 4DGEC 1AK4C 3G6EP 3DS5A 2L4BA 2GZIA 2JYGA 1M6NA 2GZFA 2XZ1C 2EIAA 5HGOA 3CCRP 4H2XC 7CEIA 2XXMA 1K9MQ 2K2QA 2VSQA 3G26A 2WLVA 3Q20A 2FVAA 3G0VA 2MF4A 1UNKA 2AF8A 2GOLB 3LRYA 1L0HA 1IMQA 1QVGO 1Q7YQ 2XDEA 1KC8Q 3CCMP 3H0DA 3WBHA 2GDXA 1ACPA 2KOSA 4H2YC 2PEQA 2PEMA 2K0XA 4PXHB 1CEIA 5KP8B 5F2NA 3RG6C 1AYIA 1RO2A 2MVVA 4INBA 1BAJA 2AFDA 1YITP 4CA3A 1VQLP 3CC2P 3DPHA 3U43A 5JPAA 3G28A 2JYLA 1RO0A 4HTWA 1K73Q 1YJ9P 2N6YA 1IUQA 2KG6A 2M8PA 3CXCO 2PXRC 2LKIA 1M9CC 2FHSC 4R0MA 2FVEA 5DCKA 2LL8A 1F80D 2KWLA 1GPJA 4MRTC 2P9XA 1M1KQ 1E0HA 2N50A 4PWVB 3EJBA 5KP7B 2VLQA 2LF4A 4BPGA 4LQWC 2FVFA 1D1DA 2XT1A 2EG5A 2ONTA 1KLPA 1DNYA 2DNWA 3DS0A 3GJNA 3CC4P 1VQ8P 1VQNP 4XFXA 3H47A 4NX4C 3I56P 2VLNA 2GDYA 4XFYA 2MD9A 4F37A 2KOPA 3G4SP 2Y4ZA 2K94A 2XV6A 3G71P 1VQ5P 2FQ0A 3EJDA 1VKUA 5HGKA 4E92A 2QA4P 4U0DA 2KOQA 2PY8A 1NJIQ 2L6EA 2PNGA 2MR8A 1VQ4P 3LMOA 4BPHA 3H4EA 2Z44A 1EM9A 2ERHA 3MGEA 2L0QA 2PEIA 2CGQA 2FACA 5HV8A 3OW2O 1QRJA 1YHQP 2JO0A 1M9FC 2PEKA 3G1IA 5F2OA 2X83A 2Z46A 2KOOA 1M90Q 2KG9A 1MZ8A 1EIAA 2PENA 3GKLC 2FAEA 1L6NA 2M8NA 5BS2A 2ROQA 2JGPA 2LMLA 1W2BO 2WLVB 3CCVP 3B4QA 1HQBA 1ZNVA 2PEOA 1EMVA 1GXHA 4IPYA 2JBGA 2Z45A 1M9DC 2EHSA 1AUMA 2PWMA 2X82A 1YI2P 1L0IA 2KW2A 2CG5B 2GZGA 2AVAA 2JB0A 2CWOA 2WPTA 4BPFA 5EJDA 1GXGA 3GZMA 1X3OA 2L9FA 5EW5E 1KQSO 3HZQA 1VQPP 4UHPB 2MY5A 1ZMBA 2K93A 2KGDA 3P05A 2LPKA 3I55P 2V4XA 2M5RA 2M8LA 3DS1A 2DGYA 2K0YA 4PH0A 2LIUA 1VQOP 1DV5A 1S72P 4IZ6A 2PWOA 3CCUP 1IMPA 3G29A 4PH2A 3CCEP 2N98A 1YIJP 2GYKA 1HY8A 1QVFO 3CC7P 1BXIA 4U0EA 2MR7A 2OTLP 3CCSP 1N8RQ 2N5HA 3CCJP 2FADA 3BP9A 2CQ8A 2L22A 4DG9A 2X2BA 1M9EC 4U0BA 5HGMA 2KR5A 2LOLA 1VQ9P 1A8OA 3DS3A 3NTEA 1M6EX 2GDWA 1KD1Q 1Q81Q 5HGLA 2AFEA 4PH3A 3G1GA 1AFVA 2QNWA 2JU2A 1VHNA 2OTJP 2VLOA 3CMAP 2GZJA 2X2DD 2E1MA 2FQ2A 2LIWA 3CD6P 3DTJA 1VQ6P 3G21A 3VRLC 1VQKP 2XZ0D 4COPA 1GWPA 1M9XC 3CCQP 1YJWP 4B4NA 5HGNA 4PH1A 3B5IA 2FQ1A 1OR5A 1M74A 3CCLP 2GONA 2KORA 4WYMA 2EHTA 2K5XA 1M9YC 4NEOA 3RG2A 5HVCA 4GR6A 2EFJA 2JAZA 1T8KA 1YJNP 2MVUA 1FR2A 2LTEA 2OARA 2KGFA 2XGUA 2PEJA 1G03A 4E91A 2KODA 3E2DA 4H2WC 2KGAA 4XRQA 1JJ2O 4U0FA 4HKGA 4DGAC 2QEXP 1VQMP 2JPRA 4XROA 2XGVA 3CMEP 1RNIA 1AF8A 1EOQA 1NQ4A 2N5IA 2K0DX 2KG8A 1Z6MA 1K8AQ 1A43A 4GR2A 1U7KA 2VLPA 2JQ4A 2BHVA 4QKOA 1Q82Q 5CZDB 3GZLA 2N6ZA 3EJEA 1UJZA
chains in the Genus database with same CATH topology
1M9DC 1E6JP 3CMAP 1VQ7P 1M9CC 2X2DD 4U0CA 1AUMA 2E1MA 5DCKA 4J93A 4XFZA 5I4TG 3CPWO 2PWMA 2X82A 3CD6P 1K30A 4U0AA 2P9XA 3DTJA 1M1KQ 1YI2P 3HYBA 1VQ6P 3G21A 5F2KA 3VRLC 2LF4A 4LQWC 3DS4A 1Q86Q 3DS2A 1D1DA 2XT1A 2XGYA 2CWOA 3M1MA 1VQKP 2EG5A 2ONTA 4COCA 4COPA 5BS1A 1GWPA 1M9XC 2BUOA 3CCQP 1YJWP 4B4NA 4QNBA 5HGNA 4PH1A 3B5IA 1P7NA 4M0IA 3DS0A 4DGEC 1AK4C 3G6EP 1KQSO 3HZQA 1VQPP 3CC4P 3DS5A 1VQ8P 1VQNP 1M74A 4XFXA 3CCLP 2GONA 3H47A 1ZMBA 2JYGA 4NX4C 4WYMA 3I56P 1M6NA 4XFYA 3P05A 2EIAA 5HGOA 3CCRP 3I55P 2V4XA 3G4SP 2M8LA 2Y4ZA 3DS1A 2DGYA 2XV6A 2XXMA 4PH0A 1M9YC 3G71P 1VQ5P 1K9MQ 1VQOP 3G26A 2WLVA 4GR6A 3Q20A 1S72P 3CCUP 2PWOA 3G0VA 5HGKA 4E92A 2EFJA 2QA4P 4U0DA 3G29A 4PH2A 2PY8A 3CCEP 1YJNP 2L6EA 1NJIQ 2GOLB 3LRYA 1VQ4P 1YIJP 3H4EA 2OARA 2Z44A 1EM9A 2KGFA 2XGUA 1QVGO 1Q7YQ 3CC7P 2PEJA 1G03A 1QVFO 4U0EA 4E91A 2KODA 3E2DA 4XRQA 2XDEA 2OTLP 3CCSP 2PEIA 3MGEA 1JJ2O 3OW2O 4U0FA 1KC8Q 1QRJA 1N8RQ 4DGAC 3CCJP 3CCMP 3H0DA 2JO0A 3WBHA 2QEXP 1VQMP 1YHQP 3BP9A 1M9FC 2JPRA 2PEKA 2PEQA 4XROA 3G1IA 2XGVA 2X83A 2PEMA 5F2OA 1RNIA 3CMEP 2Z46A 1M9EC 4U0BA 5HGMA 1EOQA 1VQ9P 1M90Q 5F2NA 3RG6C 1A8OA 3DS3A 1RO2A 3NTEA 1M6EX 1K8AQ 4INBA 1EIAA 1BAJA 2PENA 1YITP 1KD1Q 1A43A 1Q81Q 1VQLP 1L6NA 2M8NA 5BS2A 3DPHA 3CC2P 5JPAA 5HGLA 3G28A 1W2BO 2WLVB 3CCVP 2JYLA 4PH3A 4GR2A 1U7KA 2PEOA 1RO0A 3G1GA 1AFVA 4IPYA 4HTWA 1K73Q 1YJ9P 2BHVA 2Z45A 1Q82Q 1IUQA 2OTJP 2M8PA 3CXCO 2PXRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9D C;  1E6J P;  1M9C C;  2X2D D;  4U0C A;  1AUM A;  5DCK A;  4J93 A;  4XFZ A;  5I4T G;  2PWM A;  2X82 A;  4U0A A;  3DTJ A;  3G21 A;  3VRL C;  2LF4 A;  4LQW C;  3DS4 A;  3DS2 A;  1D1D A;  2XT1 A;  2XGY A;  2ONT A;  4COC A;  4COP A;  1GWP A;  1M9X C;  2BUO A;  4B4N A;  4QNB A;  5HGN A;  4PH1 A;  1P7N A;  4M0I A;  3DS0 A;  4DGE C;  1AK4 C;  3DS5 A;  4XFX A;  2GON A;  3H47 A;  2JYG A;  4NX4 C;  4WYM A;  4XFY A;  3P05 A;  2EIA A;  5HGO A;  2V4X A;  2M8L A;  2Y4Z A;  3DS1 A;  2XV6 A;  2XXM A;  4PH0 A;  1M9Y C;  3G26 A;  2WLV A;  2PWO A;  3G0V A;  5HGK A;  4E92 A;  4U0D A;  3G29 A;  4PH2 A;  2L6E A;  2GOL B;  3LRY A;  3H4E A;  1EM9 A;  2KGF A;  2XGU A;  1G03 A;  4U0E A;  4E91 A;  2KOD A;  4XRQ A;  2XDE A;  3MGE A;  4U0F A;  1QRJ A;  4DGA C;  2JO0 A;  3BP9 A;  1M9F C;  2JPR A;  4XRO A;  3G1I A;  2XGV A;  2X83 A;  1M9E C;  4U0B A;  5HGM A;  1EOQ A;  1A8O A;  3DS3 A;  3NTE A;  4INB A;  1EIA A;  1BAJ A;  1A43 A;  1L6N A;  2M8N A;  3DPH A;  5JPA A;  5HGL A;  3G28 A;  2WLV B;  2JYL A;  4PH3 A;  1U7K A;  3G1G A;  1AFV A;  4IPY A;  4HTW A;  2M8P A;  2PXR C; 
#chains in the Genus database with same CATH topology
 2K92 A;  3NY7 B;  1E6J P;  2GZE A;  1VQ7 P;  4U0C A;  4J93 A;  4XFZ A;  5I4T G;  3CPW O;  2KGC A;  1K30 A;  2CNR A;  4U0A A;  3HYB A;  5F2K A;  2KGE A;  5KP6 B;  2NO8 A;  3DS4 A;  1Q86 Q;  3DS2 A;  2XGY A;  3M1M A;  4COC A;  5BS1 A;  2BUO A;  2JU1 A;  4QNB A;  3CE7 A;  1P7N A;  4M0I A;  4DGE C;  1AK4 C;  3G6E P;  3DS5 A;  2L4B A;  2GZI A;  2JYG A;  1M6N A;  2GZF A;  2XZ1 C;  2EIA A;  5HGO A;  3CCR P;  4H2X C;  7CEI A;  2XXM A;  1K9M Q;  2K2Q A;  2VSQ A;  3G26 A;  2WLV A;  3Q20 A;  2FVA A;  3G0V A;  2MF4 A;  1UNK A;  2AF8 A;  2GOL B;  3LRY A;  1L0H A;  1IMQ A;  1QVG O;  1Q7Y Q;  2XDE A;  1KC8 Q;  3CCM P;  3H0D A;  3WBH A;  2GDX A;  1ACP A;  2KOS A;  4H2Y C;  2PEQ A;  2PEM A;  2K0X A;  4PXH B;  1CEI A;  5KP8 B;  5F2N A;  3RG6 C;  1AYI A;  1RO2 A;  2MVV A;  4INB A;  1BAJ A;  2AFD A;  1YIT P;  4CA3 A;  1VQL P;  3CC2 P;  3DPH A;  3U43 A;  5JPA A;  3G28 A;  2JYL A;  1RO0 A;  4HTW A;  1K73 Q;  1YJ9 P;  2N6Y A;  1IUQ A;  2KG6 A;  2M8P A;  3CXC O;  2PXR C;  2LKI A;  1M9C C;  2FHS C;  4R0M A;  2FVE A;  5DCK A;  2LL8 A;  1F80 D;  2KWL A;  1GPJ A;  4MRT C;  2P9X A;  1M1K Q;  1E0H A;  2N50 A;  4PWV B;  3EJB A;  5KP7 B;  2VLQ A;  2LF4 A;  4BPG A;  4LQW C;  2FVF A;  1D1D A;  2XT1 A;  2EG5 A;  2ONT A;  1KLP A;  1DNY A;  2DNW A;  3DS0 A;  3GJN A;  3CC4 P;  1VQ8 P;  1VQN P;  4XFX A;  3H47 A;  4NX4 C;  3I56 P;  2VLN A;  2GDY A;  4XFY A;  2MD9 A;  4F37 A;  2KOP A;  3G4S P;  2Y4Z A;  2K94 A;  2XV6 A;  3G71 P;  1VQ5 P;  2FQ0 A;  3EJD A;  1VKU A;  5HGK A;  4E92 A;  2QA4 P;  4U0D A;  2KOQ A;  2PY8 A;  1NJI Q;  2L6E A;  2PNG A;  2MR8 A;  1VQ4 P;  3LMO A;  4BPH A;  3H4E A;  2Z44 A;  1EM9 A;  2ERH A;  3MGE A;  2L0Q A;  2PEI A;  2CGQ A;  2FAC A;  5HV8 A;  3OW2 O;  1QRJ A;  1YHQ P;  2JO0 A;  1M9F C;  2PEK A;  3G1I A;  5F2O A;  2X83 A;  2Z46 A;  2KOO A;  1M90 Q;  2KG9 A;  1MZ8 A;  1EIA A;  2PEN A;  3GKL C;  2FAE A;  1L6N A;  2M8N A;  5BS2 A;  2ROQ A;  2JGP A;  2LML A;  1W2B O;  2WLV B;  3CCV P;  3B4Q A;  1HQB A;  1ZNV A;  2PEO A;  1EMV A;  1GXH A;  4IPY A;  2JBG A;  2Z45 A;  1M9D C;  2EHS A;  1AUM A;  2PWM A;  2X82 A;  1YI2 P;  1L0I A;  2KW2 A;  2CG5 B;  2GZG A;  2AVA A;  2JB0 A;  2CWO A;  2WPT A;  4BPF A;  5EJD A;  1GXG A;  3GZM A;  1X3O A;  2L9F A;  5EW5 E;  1KQS O;  3HZQ A;  1VQP P;  4UHP B;  2MY5 A;  1ZMB A;  2K93 A;  2KGD A;  3P05 A;  2LPK A;  3I55 P;  2V4X A;  2M5R A;  2M8L A;  3DS1 A;  2DGY A;  2K0Y A;  4PH0 A;  2LIU A;  1VQO P;  1DV5 A;  1S72 P;  4IZ6 A;  2PWO A;  3CCU P;  1IMP A;  3G29 A;  4PH2 A;  3CCE P;  2N98 A;  1YIJ P;  2GYK A;  1HY8 A;  1QVF O;  3CC7 P;  1BXI A;  4U0E A;  2MR7 A;  2OTL P;  3CCS P;  1N8R Q;  2N5H A;  3CCJ P;  2FAD A;  3BP9 A;  2CQ8 A;  2L22 A;  4DG9 A;  2X2B A;  1M9E C;  4U0B A;  5HGM A;  2KR5 A;  2LOL A;  1VQ9 P;  1A8O A;  3DS3 A;  3NTE A;  1M6E X;  2GDW A;  1KD1 Q;  1Q81 Q;  5HGL A;  2AFE A;  4PH3 A;  3G1G A;  1AFV A;  2QNW A;  2JU2 A;  1VHN A;  2OTJ P;  2VLO A;  3CMA P;  2GZJ A;  2X2D D;  2E1M A;  2FQ2 A;  2LIW A;  3CD6 P;  3DTJ A;  1VQ6 P;  3G21 A;  3VRL C;  1VQK P;  2XZ0 D;  4COP A;  1GWP A;  1M9X C;  3CCQ P;  1YJW P;  4B4N A;  5HGN A;  4PH1 A;  3B5I A;  2FQ1 A;  1OR5 A;  1M74 A;  3CCL P;  2GON A;  2KOR A;  4WYM A;  2EHT A;  2K5X A;  1M9Y C;  4NEO A;  3RG2 A;  5HVC A;  4GR6 A;  2EFJ A;  2JAZ A;  1T8K A;  1YJN P;  2MVU A;  1FR2 A;  2LTE A;  2OAR A;  2KGF A;  2XGU A;  2PEJ A;  1G03 A;  4E91 A;  2KOD A;  3E2D A;  4H2W C;  2KGA A;  4XRQ A;  1JJ2 O;  4U0F A;  4HKG A;  4DGA C;  2QEX P;  1VQM P;  2JPR A;  4XRO A;  2XGV A;  3CME P;  1RNI A;  1AF8 A;  1EOQ A;  1NQ4 A;  2N5I A;  2K0D X;  2KG8 A;  1Z6M A;  1K8A Q;  1A43 A;  4GR2 A;  1U7K A;  2VLP A;  2JQ4 A;  2BHV A;  4QKO A;  1Q82 Q;  5CZD B;  3GZL A;  2N6Z A;  3EJE A;  1UJZ A; 
#chains in the Genus database with same CATH homology
 1M9D C;  1E6J P;  3CMA P;  1VQ7 P;  1M9C C;  2X2D D;  4U0C A;  1AUM A;  2E1M A;  5DCK A;  4J93 A;  4XFZ A;  5I4T G;  3CPW O;  2PWM A;  2X82 A;  3CD6 P;  1K30 A;  4U0A A;  2P9X A;  3DTJ A;  1M1K Q;  1YI2 P;  3HYB A;  1VQ6 P;  3G21 A;  5F2K A;  3VRL C;  2LF4 A;  4LQW C;  3DS4 A;  1Q86 Q;  3DS2 A;  1D1D A;  2XT1 A;  2XGY A;  2CWO A;  3M1M A;  1VQK P;  2EG5 A;  2ONT A;  4COC A;  4COP A;  5BS1 A;  1GWP A;  1M9X C;  2BUO A;  3CCQ P;  1YJW P;  4B4N A;  4QNB A;  5HGN A;  4PH1 A;  3B5I A;  1P7N A;  4M0I A;  3DS0 A;  4DGE C;  1AK4 C;  3G6E P;  1KQS O;  3HZQ A;  1VQP P;  3CC4 P;  3DS5 A;  1VQ8 P;  1VQN P;  1M74 A;  4XFX A;  3CCL P;  2GON A;  3H47 A;  1ZMB A;  2JYG A;  4NX4 C;  4WYM A;  3I56 P;  1M6N A;  4XFY A;  3P05 A;  2EIA A;  5HGO A;  3CCR P;  3I55 P;  2V4X A;  3G4S P;  2M8L A;  2Y4Z A;  3DS1 A;  2DGY A;  2XV6 A;  2XXM A;  4PH0 A;  1M9Y C;  3G71 P;  1VQ5 P;  1K9M Q;  1VQO P;  3G26 A;  2WLV A;  4GR6 A;  3Q20 A;  1S72 P;  3CCU P;  2PWO A;  3G0V A;  5HGK A;  4E92 A;  2EFJ A;  2QA4 P;  4U0D A;  3G29 A;  4PH2 A;  2PY8 A;  3CCE P;  1YJN P;  2L6E A;  1NJI Q;  2GOL B;  3LRY A;  1VQ4 P;  1YIJ P;  3H4E A;  2OAR A;  2Z44 A;  1EM9 A;  2KGF A;  2XGU A;  1QVG O;  1Q7Y Q;  3CC7 P;  2PEJ A;  1G03 A;  1QVF O;  4U0E A;  4E91 A;  2KOD A;  3E2D A;  4XRQ A;  2XDE A;  2OTL P;  3CCS P;  2PEI A;  3MGE A;  1JJ2 O;  3OW2 O;  4U0F A;  1KC8 Q;  1QRJ A;  1N8R Q;  4DGA C;  3CCJ P;  3CCM P;  3H0D A;  2JO0 A;  3WBH A;  2QEX P;  1VQM P;  1YHQ P;  3BP9 A;  1M9F C;  2JPR A;  2PEK A;  2PEQ A;  4XRO A;  3G1I A;  2XGV A;  2X83 A;  2PEM A;  5F2O A;  1RNI A;  3CME P;  2Z46 A;  1M9E C;  4U0B A;  5HGM A;  1EOQ A;  1VQ9 P;  1M90 Q;  5F2N A;  3RG6 C;  1A8O A;  3DS3 A;  1RO2 A;  3NTE A;  1M6E X;  1K8A Q;  4INB A;  1EIA A;  1BAJ A;  2PEN A;  1YIT P;  1KD1 Q;  1A43 A;  1Q81 Q;  1VQL P;  1L6N A;  2M8N A;  5BS2 A;  3DPH A;  3CC2 P;  5JPA A;  5HGL A;  3G28 A;  1W2B O;  2WLV B;  3CCV P;  2JYL A;  4PH3 A;  4GR2 A;  1U7K A;  2PEO A;  1RO0 A;  3G1G A;  1AFV A;  4IPY A;  4HTW A;  1K73 Q;  1YJ9 P;  2BHV A;  2Z45 A;  1Q82 Q;  1IUQ A;  2OTJ P;  2M8P A;  3CXC O;  2PXR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...