4U0FA

Hexameric hiv-1 ca in complex with bi-2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
201
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 70
structure length 201
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0fA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0fA02
4COPA 1EM9A 3G29A 2V4XA 4PH0A 1M9XC 2PXRC 1M9FC 1QRJA 4IPYA 1EOQA 4U0CA 2XGYA 4COCA 4XRQA 2PWOA 1EIAA 2WLVB 5HGKA 5JPAA 4E92A 1P7NA 3MGEA 2XGUA 3G26A 2XXMA 4U0BA 2X82A 4NX4C 2EIAA 2M8LA 3NTEA 1BAJA 4M0IA 1G03A 2M8NA 1M9CC 2X2DD 3G28A 3DS0A 1AK4C 4XFZA 2WLVA 4PH3A 3DS1A 3G21A 4E91A 2L6EA 4HTWA 2GONA 1A8OA 4PH2A 2KODA 3G1GA 2GOLB 5HGOA 3BP9A 1AFVA 4DGAC 1GWPA 4U0DA 4XROA 3H4EA 4INBA 3DS3A 3DS5A 4PH1A 5I4TG 1M9YC 3DPHA 1AUMA 3G1IA 1D1DA 1U7KA 4U0FA 4J93A 2JPRA 1E6JP 5HGMA 5HGLA 2JYLA 3H47A 5HGNA 2X83A 4WYMA 1M9EC 2JO0A 2XDEA 1A43A 2KGFA 4XFYA 4B4NA 4XFXA 1L6NA 4U0AA 3DS2A 3P05A 2PWMA 4QNBA 2ONTA 2LF4A 2BUOA 4LQWC 4DGEC 2M8PA 2JYGA 1M9DC 2XT1A 3VRLC 3DTJA 5DCKA 2Y4ZA 3LRYA 3DS4A 2XGVA 2XV6A 3G0VA 4U0EA
chains in the Genus database with same CATH superfamily
3CCJP 2GDYA 1Z6MA 3E2DA 4PH0A 4GR2A 1L0HA 2VLQA 2PY8A 1K30A 4COCA 4NEOA 2PWOA 2OTLP 1UJZA 2E1MA 1M90Q 2X82A 3OW2O 4NX4C 1QVFO 3EJEA 4H2YC 3NTEA 4PWVB 1G03A 2K92A 4H2WC 2KR5A 1NJIQ 1VQ6P 2L6EA 2PEMA 4HTWA 2JU2A 1DNYA 1K8AQ 2FQ2A 2KGAA 1JJ2O 3G1GA 2GOLB 2JAZA 5HGOA 4DGAC 2EHTA 2Z45A 1IMQA 2GZIA 2L9FA 2PENA 4INBA 1EMVA 3DS3A 1GXGA 3CE7A 4DG9A 1Q82Q 2MD9A 3CCQP 2CNRA 3B5IA 2K93A 2LIUA 2CQ8A 1M9EC 2P9XA 1KQSO 4B4NA 2AFEA 2FVAA 2MR8A 1K9MQ 3HZQA 1IUQA 1VQ4P 2VSQA 2BUOA 4LQWC 2KGCA 2M8PA 2JYGA 3H0DA 4BPGA 1M9DC 2XT1A 1MZ8A 2KOSA 3DTJA 3NY7B 5DCKA 3DS4A 4QKOA 2PEOA 1VQPP 2LL8A 2LTEA 4COPA 1EM9A 3G29A 1Q7YQ 1ACPA 1M9XC 5CZDB 2N6ZA 1KLPA 5HGKA 2K0YA 2BHVA 2MF4A 2XXMA 2EIAA 4M0IA 2FACA 3HYBA 3DS0A 2MY5A 1AK4C 4XFZA 2FADA 4PXHB 1VQ5P 4E91A 1RO0A 1OR5A 2N6YA 3CCRP 1Q81Q 1VQ7P 3CC2P 3CPWO 4PH2A 2PEIA 1YJNP 1Q86Q 1VQLP 4MRTC 1M6NA 3BP9A 2AF8A 1AF8A 1QVGO 2GDXA 1M9YC 2MVVA 5F2NA 2QA4P 1GPJA 1AUMA 1M74A 1N8RQ 1W2BO 1D1DA 1K73Q 2JPRA 1E6JP 2N98A 3B4QA 3GZLA 2N5IA 4H2XC 2K0DX 2KWLA 2X83A 4WYMA 2PEQA 1UNKA 2KW2A 2KG6A 1VKUA 2JB0A 1X3OA 1NQ4A 1BXIA 1KC8Q 1VQ8P 2LMLA 3G4SP 1YJ9P 4U0AA 3P05A 1YI2P 2PWMA 2DGYA 2K94A 5BS2A 2LOLA 2KOQA 2LKIA 5HVCA 3U43A 2M5RA 1RNIA 2MVUA 2GZGA 2XGVA 2XV6A 3G0VA 2K2QA 2VLNA 2GZEA 2L4BA 5KP6B 3Q20A 1VQMP 2V4XA 2VLOA 1DV5A 2PXRC 1M9FC 1YIJP 3CCEP 4IPYA 4U0CA 2XGYA 4XRQA 1EIAA 2WLVB 4E92A 1P7NA 2Z46A 1YJWP 3I55P 2XGUA 3G26A 3RG6C 1BAJA 2LPKA 1T8KA 1M9CC 2CG5B 2KOPA 2AVAA 3GJNA 2WLVA 1M1KQ 4PH3A 2X2BA 5F2KA 2KG8A 3CCSP 1VHNA 2JBGA 2GONA 1A8OA 3I56P 2N50A 3CCUP 2ROQA 2XZ0D 2ERHA 4UHPB 2WPTA 1GWPA 1RO2A 3GKLC 3GZMA 2L22A 1VQ9P 2FVFA 4XROA 3DS5A 4PH1A 1VQNP 3DPHA 2QNWA 3G71P 2N5HA 4IZ6A 4U0FA 3EJDA 2Z44A 1HQBA 3EJBA 1GXHA 5HGLA 1M6EX 3H47A 5HGNA 3M1MA 2JGPA 1A43A 1FR2A 4F37A 5KP8B 2K5XA 4CA3A 1L0IA 2JQ4A 3CC7P 3LMOA 2MR7A 2CGQA 3CC4P 4QNBA 2ONTA 2KORA 4DGEC 2OTJP 3CXCO 5EW5E 5BS1A 3LRYA 2FVEA 5F2OA 2K0XA 2QEXP 4GR6A 4U0EA 2FQ0A 2GYKA 3CMAP 1YHQP 1QRJA 1EOQA 2XZ1C 1AYIA 5JPAA 2DNWA 3CCVP 3MGEA 4U0BA 2KGDA 2GDWA 2M8LA 2FHSC 2M8NA 2NO8A 3G28A 2X2DD 1HY8A 4BPFA 2PEKA 2FAEA 2PNGA 3DS1A 3G21A 1S72P 4BPHA 3CMEP 2EG5A 2GZFA 2KGEA 2CWOA 2KODA 2FQ1A 7CEIA 1AFVA 4U0DA 2JU1A 2PEJA 1F80D 2LIWA 3H4EA 2AFDA 5KP7B 5I4TG 2L0QA 3G1IA 1U7KA 3CD6P 4J93A 5HGMA 2JYLA 3CCMP 2GZJA 2JO0A 2XDEA 2KGFA 4XFYA 4XFXA 2KG9A 3RG2A 4HKGA 5HV8A 1ZMBA 2EFJA 1L6NA 1YITP 3DS2A 1KD1Q 1VQKP 2OARA 5EJDA 2EHSA 1E0HA 4R0MA 2LF4A 3WBHA 2KOOA 2VLPA 1VQOP 3VRLC 1IMPA 2Y4ZA 3CCLP 1CEIA 3G6EP 1ZNVA
chains in the Genus database with same CATH topology
3CCJP 4COPA 1EM9A 3G29A 3Q20A 3E2DA 1VQMP 1Q7YQ 2V4XA 4PH0A 1M9XC 2PXRC 4GR2A 1M9FC 3CMAP 1YHQP 2PY8A 1QRJA 1YIJP 3CCEP 4IPYA 1EOQA 1K30A 4U0CA 2XGYA 4COCA 4XRQA 2PWOA 1EIAA 2WLVB 5HGKA 5JPAA 4E92A 1P7NA 2BHVA 3CCVP 2Z46A 1YJWP 2OTLP 3I55P 3MGEA 2E1MA 2XGUA 3G26A 1M90Q 2XXMA 4U0BA 2X82A 3OW2O 4NX4C 1QVFO 2EIAA 3RG6C 2M8LA 3NTEA 1BAJA 4M0IA 3HYBA 1G03A 2M8NA 1M9CC 2X2DD 3G28A 2PEKA 3DS0A 1AK4C 4XFZA 2WLVA 1M1KQ 4PH3A 3DS1A 3G21A 1VQ5P 4E91A 1NJIQ 1S72P 1RO0A 2L6EA 5F2KA 1VQ6P 2PEMA 3CCSP 3CMEP 2EG5A 4HTWA 3CCRP 1Q81Q 2GONA 1A8OA 2CWOA 1VQ7P 3CC2P 3CPWO 1K8AQ 4PH2A 3I56P 2PEIA 2KODA 1YJNP 1JJ2O 1Q86Q 3CCUP 1VQLP 3G1GA 2GOLB 1M6NA 5HGOA 3BP9A 1AFVA 4DGAC 2Z45A 1GWPA 1RO2A 4U0DA 1VQ9P 2PEJA 4XROA 1QVGO 2PENA 3H4EA 4INBA 3DS3A 3DS5A 4PH1A 1VQNP 5I4TG 1M9YC 3DPHA 5F2NA 2QA4P 1AUMA 3G1IA 3G71P 1Q82Q 1M74A 1N8RQ 3CCQP 1D1DA 1W2BO 1K73Q 1U7KA 4U0FA 3CD6P 4J93A 2JPRA 1E6JP 2Z44A 5HGMA 3B5IA 5HGLA 2JYLA 1M6EX 3H47A 5HGNA 2X83A 4WYMA 3M1MA 3CCMP 2PEQA 1M9EC 2JO0A 2XDEA 1A43A 2KGFA 2P9XA 1KQSO 4XFYA 4B4NA 4XFXA 1KC8Q 1K9MQ 1ZMBA 2EFJA 3HZQA 1VQ8P 1L6NA 3CC7P 3G4SP 1YJ9P 4U0AA 1YITP 1IUQA 3DS2A 1KD1Q 3P05A 1VQKP 2OARA 1YI2P 3CC4P 2PWMA 2DGYA 5BS2A 4QNBA 2ONTA 1VQ4P 2LF4A 2BUOA 2OTJP 4LQWC 4DGEC 2M8PA 3WBHA 3CXCO 2JYGA 3H0DA 1RNIA 1VQOP 5BS1A 1M9DC 2XT1A 3VRLC 3DTJA 5DCKA 2Y4ZA 3LRYA 3DS4A 2XGVA 2XV6A 5F2OA 2PEOA 2QEXP 3CCLP 4GR6A 3G0VA 1VQPP 3G6EP 4U0EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4COP A;  1EM9 A;  3G29 A;  2V4X A;  4PH0 A;  1M9X C;  2PXR C;  1M9F C;  1QRJ A;  4IPY A;  1EOQ A;  4U0C A;  2XGY A;  4COC A;  4XRQ A;  2PWO A;  1EIA A;  2WLV B;  5HGK A;  5JPA A;  4E92 A;  1P7N A;  3MGE A;  2XGU A;  3G26 A;  2XXM A;  4U0B A;  2X82 A;  4NX4 C;  2EIA A;  2M8L A;  3NTE A;  1BAJ A;  4M0I A;  1G03 A;  2M8N A;  1M9C C;  2X2D D;  3G28 A;  3DS0 A;  1AK4 C;  4XFZ A;  2WLV A;  4PH3 A;  3DS1 A;  3G21 A;  4E91 A;  2L6E A;  4HTW A;  2GON A;  1A8O A;  4PH2 A;  2KOD A;  3G1G A;  2GOL B;  5HGO A;  3BP9 A;  1AFV A;  4DGA C;  1GWP A;  4U0D A;  4XRO A;  3H4E A;  4INB A;  3DS3 A;  3DS5 A;  4PH1 A;  5I4T G;  1M9Y C;  3DPH A;  1AUM A;  3G1I A;  1D1D A;  1U7K A;  4U0F A;  4J93 A;  2JPR A;  1E6J P;  5HGM A;  5HGL A;  2JYL A;  3H47 A;  5HGN A;  2X83 A;  4WYM A;  1M9E C;  2JO0 A;  2XDE A;  1A43 A;  2KGF A;  4XFY A;  4B4N A;  4XFX A;  1L6N A;  4U0A A;  3DS2 A;  3P05 A;  2PWM A;  4QNB A;  2ONT A;  2LF4 A;  2BUO A;  4LQW C;  4DGE C;  2M8P A;  2JYG A;  1M9D C;  2XT1 A;  3VRL C;  3DTJ A;  5DCK A;  2Y4Z A;  3LRY A;  3DS4 A;  2XGV A;  2XV6 A;  3G0V A;  4U0E A; 
#chains in the Genus database with same CATH topology
 3CCJ P;  2GDY A;  1Z6M A;  3E2D A;  4PH0 A;  4GR2 A;  1L0H A;  2VLQ A;  2PY8 A;  1K30 A;  4COC A;  4NEO A;  2PWO A;  2OTL P;  1UJZ A;  2E1M A;  1M90 Q;  2X82 A;  3OW2 O;  4NX4 C;  1QVF O;  3EJE A;  4H2Y C;  3NTE A;  4PWV B;  1G03 A;  2K92 A;  4H2W C;  2KR5 A;  1NJI Q;  1VQ6 P;  2L6E A;  2PEM A;  4HTW A;  2JU2 A;  1DNY A;  1K8A Q;  2FQ2 A;  2KGA A;  1JJ2 O;  3G1G A;  2GOL B;  2JAZ A;  5HGO A;  4DGA C;  2EHT A;  2Z45 A;  1IMQ A;  2GZI A;  2L9F A;  2PEN A;  4INB A;  1EMV A;  3DS3 A;  1GXG A;  3CE7 A;  4DG9 A;  1Q82 Q;  2MD9 A;  3CCQ P;  2CNR A;  3B5I A;  2K93 A;  2LIU A;  2CQ8 A;  1M9E C;  2P9X A;  1KQS O;  4B4N A;  2AFE A;  2FVA A;  2MR8 A;  1K9M Q;  3HZQ A;  1IUQ A;  1VQ4 P;  2VSQ A;  2BUO A;  4LQW C;  2KGC A;  2M8P A;  2JYG A;  3H0D A;  4BPG A;  1M9D C;  2XT1 A;  1MZ8 A;  2KOS A;  3DTJ A;  3NY7 B;  5DCK A;  3DS4 A;  4QKO A;  2PEO A;  1VQP P;  2LL8 A;  2LTE A;  4COP A;  1EM9 A;  3G29 A;  1Q7Y Q;  1ACP A;  1M9X C;  5CZD B;  2N6Z A;  1KLP A;  5HGK A;  2K0Y A;  2BHV A;  2MF4 A;  2XXM A;  2EIA A;  4M0I A;  2FAC A;  3HYB A;  3DS0 A;  2MY5 A;  1AK4 C;  4XFZ A;  2FAD A;  4PXH B;  1VQ5 P;  4E91 A;  1RO0 A;  1OR5 A;  2N6Y A;  3CCR P;  1Q81 Q;  1VQ7 P;  3CC2 P;  3CPW O;  4PH2 A;  2PEI A;  1YJN P;  1Q86 Q;  1VQL P;  4MRT C;  1M6N A;  3BP9 A;  2AF8 A;  1AF8 A;  1QVG O;  2GDX A;  1M9Y C;  2MVV A;  5F2N A;  2QA4 P;  1GPJ A;  1AUM A;  1M74 A;  1N8R Q;  1W2B O;  1D1D A;  1K73 Q;  2JPR A;  1E6J P;  2N98 A;  3B4Q A;  3GZL A;  2N5I A;  4H2X C;  2K0D X;  2KWL A;  2X83 A;  4WYM A;  2PEQ A;  1UNK A;  2KW2 A;  2KG6 A;  1VKU A;  2JB0 A;  1X3O A;  1NQ4 A;  1BXI A;  1KC8 Q;  1VQ8 P;  2LML A;  3G4S P;  1YJ9 P;  4U0A A;  3P05 A;  1YI2 P;  2PWM A;  2DGY A;  2K94 A;  5BS2 A;  2LOL A;  2KOQ A;  2LKI A;  5HVC A;  3U43 A;  2M5R A;  1RNI A;  2MVU A;  2GZG A;  2XGV A;  2XV6 A;  3G0V A;  2K2Q A;  2VLN A;  2GZE A;  2L4B A;  5KP6 B;  3Q20 A;  1VQM P;  2V4X A;  2VLO A;  1DV5 A;  2PXR C;  1M9F C;  1YIJ P;  3CCE P;  4IPY A;  4U0C A;  2XGY A;  4XRQ A;  1EIA A;  2WLV B;  4E92 A;  1P7N A;  2Z46 A;  1YJW P;  3I55 P;  2XGU A;  3G26 A;  3RG6 C;  1BAJ A;  2LPK A;  1T8K A;  1M9C C;  2CG5 B;  2KOP A;  2AVA A;  3GJN A;  2WLV A;  1M1K Q;  4PH3 A;  2X2B A;  5F2K A;  2KG8 A;  3CCS P;  1VHN A;  2JBG A;  2GON A;  1A8O A;  3I56 P;  2N50 A;  3CCU P;  2ROQ A;  2XZ0 D;  2ERH A;  4UHP B;  2WPT A;  1GWP A;  1RO2 A;  3GKL C;  3GZM A;  2L22 A;  1VQ9 P;  2FVF A;  4XRO A;  3DS5 A;  4PH1 A;  1VQN P;  3DPH A;  2QNW A;  3G71 P;  2N5H A;  4IZ6 A;  4U0F A;  3EJD A;  2Z44 A;  1HQB A;  3EJB A;  1GXH A;  5HGL A;  1M6E X;  3H47 A;  5HGN A;  3M1M A;  2JGP A;  1A43 A;  1FR2 A;  4F37 A;  5KP8 B;  2K5X A;  4CA3 A;  1L0I A;  2JQ4 A;  3CC7 P;  3LMO A;  2MR7 A;  2CGQ A;  3CC4 P;  4QNB A;  2ONT A;  2KOR A;  4DGE C;  2OTJ P;  3CXC O;  5EW5 E;  5BS1 A;  3LRY A;  2FVE A;  5F2O A;  2K0X A;  2QEX P;  4GR6 A;  4U0E A;  2FQ0 A;  2GYK A;  3CMA P;  1YHQ P;  1QRJ A;  1EOQ A;  2XZ1 C;  1AYI A;  5JPA A;  2DNW A;  3CCV P;  3MGE A;  4U0B A;  2KGD A;  2GDW A;  2M8L A;  2FHS C;  2M8N A;  2NO8 A;  3G28 A;  2X2D D;  1HY8 A;  4BPF A;  2PEK A;  2FAE A;  2PNG A;  3DS1 A;  3G21 A;  1S72 P;  4BPH A;  3CME P;  2EG5 A;  2GZF A;  2KGE A;  2CWO A;  2KOD A;  2FQ1 A;  7CEI A;  1AFV A;  4U0D A;  2JU1 A;  2PEJ A;  1F80 D;  2LIW A;  3H4E A;  2AFD A;  5KP7 B;  5I4T G;  2L0Q A;  3G1I A;  1U7K A;  3CD6 P;  4J93 A;  5HGM A;  2JYL A;  3CCM P;  2GZJ A;  2JO0 A;  2XDE A;  2KGF A;  4XFY A;  4XFX A;  2KG9 A;  3RG2 A;  4HKG A;  5HV8 A;  1ZMB A;  2EFJ A;  1L6N A;  1YIT P;  3DS2 A;  1KD1 Q;  1VQK P;  2OAR A;  5EJD A;  2EHS A;  1E0H A;  4R0M A;  2LF4 A;  3WBH A;  2KOO A;  2VLP A;  1VQO P;  3VRL C;  1IMP A;  2Y4Z A;  3CCL P;  1CEI A;  3G6E P;  1ZNV A; 
#chains in the Genus database with same CATH homology
 3CCJ P;  4COP A;  1EM9 A;  3G29 A;  3Q20 A;  3E2D A;  1VQM P;  1Q7Y Q;  2V4X A;  4PH0 A;  1M9X C;  2PXR C;  4GR2 A;  1M9F C;  3CMA P;  1YHQ P;  2PY8 A;  1QRJ A;  1YIJ P;  3CCE P;  4IPY A;  1EOQ A;  1K30 A;  4U0C A;  2XGY A;  4COC A;  4XRQ A;  2PWO A;  1EIA A;  2WLV B;  5HGK A;  5JPA A;  4E92 A;  1P7N A;  2BHV A;  3CCV P;  2Z46 A;  1YJW P;  2OTL P;  3I55 P;  3MGE A;  2E1M A;  2XGU A;  3G26 A;  1M90 Q;  2XXM A;  4U0B A;  2X82 A;  3OW2 O;  4NX4 C;  1QVF O;  2EIA A;  3RG6 C;  2M8L A;  3NTE A;  1BAJ A;  4M0I A;  3HYB A;  1G03 A;  2M8N A;  1M9C C;  2X2D D;  3G28 A;  2PEK A;  3DS0 A;  1AK4 C;  4XFZ A;  2WLV A;  1M1K Q;  4PH3 A;  3DS1 A;  3G21 A;  1VQ5 P;  4E91 A;  1NJI Q;  1S72 P;  1RO0 A;  2L6E A;  5F2K A;  1VQ6 P;  2PEM A;  3CCS P;  3CME P;  2EG5 A;  4HTW A;  3CCR P;  1Q81 Q;  2GON A;  1A8O A;  2CWO A;  1VQ7 P;  3CC2 P;  3CPW O;  1K8A Q;  4PH2 A;  3I56 P;  2PEI A;  2KOD A;  1YJN P;  1JJ2 O;  1Q86 Q;  3CCU P;  1VQL P;  3G1G A;  2GOL B;  1M6N A;  5HGO A;  3BP9 A;  1AFV A;  4DGA C;  2Z45 A;  1GWP A;  1RO2 A;  4U0D A;  1VQ9 P;  2PEJ A;  4XRO A;  1QVG O;  2PEN A;  3H4E A;  4INB A;  3DS3 A;  3DS5 A;  4PH1 A;  1VQN P;  5I4T G;  1M9Y C;  3DPH A;  5F2N A;  2QA4 P;  1AUM A;  3G1I A;  3G71 P;  1Q82 Q;  1M74 A;  1N8R Q;  3CCQ P;  1D1D A;  1W2B O;  1K73 Q;  1U7K A;  4U0F A;  3CD6 P;  4J93 A;  2JPR A;  1E6J P;  2Z44 A;  5HGM A;  3B5I A;  5HGL A;  2JYL A;  1M6E X;  3H47 A;  5HGN A;  2X83 A;  4WYM A;  3M1M A;  3CCM P;  2PEQ A;  1M9E C;  2JO0 A;  2XDE A;  1A43 A;  2KGF A;  2P9X A;  1KQS O;  4XFY A;  4B4N A;  4XFX A;  1KC8 Q;  1K9M Q;  1ZMB A;  2EFJ A;  3HZQ A;  1VQ8 P;  1L6N A;  3CC7 P;  3G4S P;  1YJ9 P;  4U0A A;  1YIT P;  1IUQ A;  3DS2 A;  1KD1 Q;  3P05 A;  1VQK P;  2OAR A;  1YI2 P;  3CC4 P;  2PWM A;  2DGY A;  5BS2 A;  4QNB A;  2ONT A;  1VQ4 P;  2LF4 A;  2BUO A;  2OTJ P;  4LQW C;  4DGE C;  2M8P A;  3WBH A;  3CXC O;  2JYG A;  3H0D A;  1RNI A;  1VQO P;  5BS1 A;  1M9D C;  2XT1 A;  3VRL C;  3DTJ A;  5DCK A;  2Y4Z A;  3LRY A;  3DS4 A;  2XGV A;  2XV6 A;  5F2O A;  2PEO A;  2QEX P;  3CCL P;  4GR6 A;  3G0V A;  1VQP P;  3G6E P;  4U0E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...