4U0FA

Hexameric hiv-1 ca in complex with bi-2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
201
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 70
structure length 201
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0fA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0fA02
3H47A 3G1IA 3LRYA 2XV6A 1M9DC 4XRQA 4E92A 3NTEA 1M9XC 1U7KA 2M8LA 2Y4ZA 3DTJA 1AUMA 2XXMA 4DGEC 4PH0A 2JYGA 1BAJA 2PWMA 4U0EA 5DCKA 2WLVB 4U0CA 2XGYA 3P05A 2X83A 5JPAA 3MGEA 2XGUA 4WYMA 2EIAA 2M8NA 1M9FC 2PXRC 4XFYA 1E6JP 3G0VA 2KODA 2JO0A 3DS0A 1EIAA 4U0DA 3DS1A 5HGKA 4B4NA 2X82A 3BP9A 1QRJA 1GWPA 1M9EC 2PWOA 2XDEA 4LQWC 4IPYA 1A8OA 3VRLC 2M8PA 1P7NA 4HTWA 2LF4A 4XFXA 3DS3A 1L6NA 2JYLA 2ONTA 4PH1A 2GOLB 2GONA 2V4XA 4INBA 3G28A 4PH2A 1AK4C 1AFVA 4XROA 2BUOA 3DPHA 5HGNA 3G26A 4COPA 3DS2A 2KGFA 1D1DA 3G29A 5HGOA 4E91A 2XT1A 2X2DD 1EOQA 4COCA 4U0FA 3DS4A 3G21A 4XFZA 4DGAC 3G1GA 1G03A 4M0IA 1M9YC 4PH3A 1M9CC 1EM9A 4U0AA 4NX4C 2XGVA 2L6EA 5HGMA 2WLVA 5I4TG 1A43A 2JPRA 4QNBA 4U0BA 4J93A 3H4EA 3DS5A 5HGLA
chains in the Genus database with same CATH superfamily
2FVAA 3CCQP 4XRQA 4DG9A 1RO2A 1DV5A 2VLOA 3NTEA 1M9XC 2GDYA 2M8LA 2JAZA 3EJDA 1M1KQ 2PEMA 4H2WC 2JB0A 5DCKA 1YJ9P 3CCUP 2X2BA 2PEQA 1YHQP 4IZ6A 1ZMBA 1YI2P 2DNWA 2EIAA 1M9FC 5EW5E 2PXRC 4XFYA 1QVGO 2FACA 2FAEA 2FVEA 2FHSC 1L0HA 4U0DA 3DS1A 5BS2A 4B4NA 1VQKP 4BPFA 1RO0A 2PNGA 2XDEA 2E1MA 1K30A 1JJ2O 3Q20A 1A8OA 2QNWA 1HQBA 2AVAA 1P7NA 3B5IA 3CXCO 2PEKA 1GXGA 1L6NA 2GONA 3G28A 3G4SP 1YITP 1K9MQ 3CCRP 1RNIA 2LIUA 2LOLA 3H0DA 1MZ8A 1E0HA 1GXHA 1VQPP 3DPHA 5HGNA 2N6ZA 5CZDB 4GR2A 1L0IA 2K93A 2JGPA 3CMAP 1M74A 1NJIQ 2MR7A 3G21A 1IUQA 4DGAC 2VLPA 1KQSO 2LKIA 1F80D 4H2XC 1YJWP 2JBGA 1VQ5P 3U43A 4MRTC 2CGQA 2KOQA 3RG6C 5HGMA 3H4EA 2N5HA 2N5IA 1Q82Q 4PXHB 2KORA 2P9XA 2AFDA 2GYKA 2Y4ZA 2N50A 3DTJA 1AUMA 1YIJP 2N98A 3M1MA 2LIWA 2X83A 1CEIA 2PEOA 2JU2A 2XGUA 1BXIA 2MVUA 3HYBA 2MF4A 7CEIA 3DS0A 2X82A 3BP9A 2PWOA 2KWLA 2WPTA 4IPYA 2M8PA 2JQ4A 4HTWA 3RG2A 3EJEA 4QKOA 1OR5A 2OARA 2GOLB 4INBA 1IMQA 1K8AQ 1KC8Q 3G6EP 3I55P 4F37A 2CG5B 1KD1Q 2KR5A 1VQNP 3B4QA 4COPA 5BS1A 1W2BO 2KGFA 5HGOA 2XT1A 5HV8A 5HVCA 4COCA 3OW2O 1M6EX 1Q81Q 2K92A 2FADA 3CPWO 3HZQA 1VQ4P 5F2KA 1UNKA 3CC2P 4NEOA 1G03A 4BPHA 2CNRA 3NY7B 2K5XA 4PH3A 2XZ1C 1VQ9P 1M9CC 1EM9A 4U0AA 3CCEP 2PY8A 1Q86Q 2WLVA 5I4TG 1K73Q 1A43A 2PENA 1EMVA 1FR2A 3I56P 3DS5A 2VLNA 2VSQA 2OTJP 3G1IA 2XV6A 1X3OA 2GZJA 2ERHA 1VQ6P 2CQ8A 2XXMA 3GKLC 2JYGA 1BAJA 2GZGA 4U0EA 2XZ0D 2KG8A 2WLVB 4U0CA 2EHTA 3CD6P 5JPAA 1UJZA 1DNYA 2M8NA 2LL8A 1E6JP 2EHSA 5KP6B 1HY8A 2JO0A 3CMEP 4BPGA 1EIAA 1IMPA 1VHNA 5HGKA 1T8KA 2L0QA 1QRJA 1GWPA 1VQLP 5F2OA 2KW2A 2K0YA 3VRLC 3G71P 3E2DA 2L22A 1VKUA 2JYLA 4PH1A 3CC4P 2FQ0A 1AK4C 2KGCA 4H2YC 2MY5A 2QEXP 1AYIA 4XROA 3G26A 3DS2A 3G29A 2LTEA 3LMOA 3CCSP 2MD9A 2K2QA 4U0FA 1KLPA 4XFZA 2LMLA 2PEIA 3G1GA 1AF8A 1VQ7P 4UHPB 2JU1A 1GPJA 4PWVB 2KGAA 3CE7A 2KG6A 2M5RA 3GZMA 2OTLP 4HKGA 2AF8A 2BHVA 1M9YC 3WBHA 3EJBA 4GR6A 4NX4C 2XGVA 3CCVP 2N6YA 2KG9A 2L6EA 2KOOA 2KGEA 2JPRA 4QNBA 4U0BA 5HGLA 1S72P 3H47A 2AFEA 2GZIA 2FVFA 3LRYA 1M9DC 4E92A 2EFJA 2VLQA 3CC7P 1M6NA 2MVVA 2GZFA 2FQ2A 1ZNVA 5F2NA 1U7KA 5EJDA 5KP8B 5KP7B 2GDWA 4DGEC 2K0DX 4PH0A 2PWMA 2XGYA 2PEJA 3P05A 3GZLA 2EG5A 3MGEA 4WYMA 3GJNA 2Z44A 2K94A 4CA3A 2ROQA 3G0VA 2KOSA 2LPKA 3CCMP 1ACPA 2KODA 2FQ1A 1VQ8P 2Z46A 2L9FA 2DGYA 1YJNP 1M9EC 2QA4P 4LQWC 1NQ4A 2LF4A 4XFXA 3DS3A 2ONTA 2KOPA 1Q7YQ 2V4XA 1QVFO 2L4BA 4PH2A 2Z45A 1AFVA 1M90Q 2BUOA 2KGDA 1D1DA 4E91A 1N8RQ 2X2DD 1EOQA 3DS4A 1VQOP 2CWOA 4R0MA 1VQMP 2MR8A 2NO8A 4M0IA 1Z6MA 2K0XA 3CCJP 3CCLP 2GZEA 4J93A 2GDXA
chains in the Genus database with same CATH topology
3H47A 2OTJP 1Q82Q 3G1IA 3LRYA 3CCQP 2XV6A 1M9DC 4XRQA 4E92A 2EFJA 3CC7P 1RO2A 1M6NA 2P9XA 3NTEA 1M9XC 1VQ6P 5F2NA 1U7KA 2M8LA 2Y4ZA 3DTJA 1M1KQ 2PEMA 1AUMA 2XXMA 4DGEC 1YIJP 4PH0A 2JYGA 1BAJA 2PWMA 4U0EA 5DCKA 1YJ9P 2WLVB 3M1MA 3CCUP 4U0CA 2XGYA 2PEJA 3P05A 2X83A 3CD6P 2PEOA 5JPAA 2EG5A 2PEQA 1YHQP 1ZMBA 1YI2P 3MGEA 2XGUA 4WYMA 2EIAA 2M8NA 1M9FC 2Z44A 2PXRC 4XFYA 1QVGO 1E6JP 3HYBA 3G0VA 3CCMP 2KODA 2JO0A 1VQ8P 2Z46A 3DS0A 3CMEP 1EIAA 4U0DA 3DS1A 5BS2A 5HGKA 4B4NA 2X82A 3BP9A 2DGYA 1VQKP 1QRJA 1GWPA 1YJNP 1M9EC 2QA4P 1RO0A 1VQLP 2PWOA 2XDEA 5F2OA 2E1MA 4LQWC 4IPYA 1K30A 1JJ2O 3Q20A 1A8OA 3VRLC 3G71P 2M8PA 3E2DA 1P7NA 4HTWA 3B5IA 2LF4A 4XFXA 3CXCO 2PEKA 3DS3A 1L6NA 2JYLA 2ONTA 2OARA 4PH1A 1Q7YQ 2GOLB 2GONA 2V4XA 4INBA 3G28A 3G4SP 1YITP 1K9MQ 1K8AQ 3CC4P 3CCRP 1QVFO 1RNIA 1KC8Q 4PH2A 1AK4C 3G6EP 3I55P 2Z45A 1AFVA 2QEXP 1M90Q 3H0DA 4XROA 1KD1Q 1VQPP 2BUOA 3DPHA 1VQNP 5HGNA 3G26A 4COPA 5BS1A 3DS2A 1W2BO 2KGFA 1D1DA 3G29A 5HGOA 4E91A 2XT1A 1N8RQ 4GR2A 2X2DD 1EOQA 3CMAP 3CCSP 1M74A 1NJIQ 4COCA 4U0FA 3DS4A 3G21A 3OW2O 1M6EX 1IUQA 1VQOP 4XFZA 4DGAC 1Q81Q 2PEIA 3G1GA 3CPWO 3HZQA 1KQSO 2CWOA 1VQ4P 5F2KA 1VQ7P 3CC2P 1VQMP 1G03A 4M0IA 2OTLP 1YJWP 1VQ5P 2BHVA 1M9YC 4PH3A 3WBHA 1VQ9P 1M9CC 3CCJP 1EM9A 4U0AA 4GR6A 3CCLP 4NX4C 3CCEP 2XGVA 3CCVP 3RG6C 2PY8A 2L6EA 1Q86Q 5HGMA 2WLVA 5I4TG 1K73Q 1A43A 2JPRA 4QNBA 2PENA 4U0BA 4J93A 3H4EA 3DS5A 3I56P 5HGLA 1S72P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H47 A;  3G1I A;  3LRY A;  2XV6 A;  1M9D C;  4XRQ A;  4E92 A;  3NTE A;  1M9X C;  1U7K A;  2M8L A;  2Y4Z A;  3DTJ A;  1AUM A;  2XXM A;  4DGE C;  4PH0 A;  2JYG A;  1BAJ A;  2PWM A;  4U0E A;  5DCK A;  2WLV B;  4U0C A;  2XGY A;  3P05 A;  2X83 A;  5JPA A;  3MGE A;  2XGU A;  4WYM A;  2EIA A;  2M8N A;  1M9F C;  2PXR C;  4XFY A;  1E6J P;  3G0V A;  2KOD A;  2JO0 A;  3DS0 A;  1EIA A;  4U0D A;  3DS1 A;  5HGK A;  4B4N A;  2X82 A;  3BP9 A;  1QRJ A;  1GWP A;  1M9E C;  2PWO A;  2XDE A;  4LQW C;  4IPY A;  1A8O A;  3VRL C;  2M8P A;  1P7N A;  4HTW A;  2LF4 A;  4XFX A;  3DS3 A;  1L6N A;  2JYL A;  2ONT A;  4PH1 A;  2GOL B;  2GON A;  2V4X A;  4INB A;  3G28 A;  4PH2 A;  1AK4 C;  1AFV A;  4XRO A;  2BUO A;  3DPH A;  5HGN A;  3G26 A;  4COP A;  3DS2 A;  2KGF A;  1D1D A;  3G29 A;  5HGO A;  4E91 A;  2XT1 A;  2X2D D;  1EOQ A;  4COC A;  4U0F A;  3DS4 A;  3G21 A;  4XFZ A;  4DGA C;  3G1G A;  1G03 A;  4M0I A;  1M9Y C;  4PH3 A;  1M9C C;  1EM9 A;  4U0A A;  4NX4 C;  2XGV A;  2L6E A;  5HGM A;  2WLV A;  5I4T G;  1A43 A;  2JPR A;  4QNB A;  4U0B A;  4J93 A;  3H4E A;  3DS5 A;  5HGL A; 
#chains in the Genus database with same CATH topology
 2FVA A;  3CCQ P;  4XRQ A;  4DG9 A;  1RO2 A;  1DV5 A;  2VLO A;  3NTE A;  1M9X C;  2GDY A;  2M8L A;  2JAZ A;  3EJD A;  1M1K Q;  2PEM A;  4H2W C;  2JB0 A;  5DCK A;  1YJ9 P;  3CCU P;  2X2B A;  2PEQ A;  1YHQ P;  4IZ6 A;  1ZMB A;  1YI2 P;  2DNW A;  2EIA A;  1M9F C;  5EW5 E;  2PXR C;  4XFY A;  1QVG O;  2FAC A;  2FAE A;  2FVE A;  2FHS C;  1L0H A;  4U0D A;  3DS1 A;  5BS2 A;  4B4N A;  1VQK P;  4BPF A;  1RO0 A;  2PNG A;  2XDE A;  2E1M A;  1K30 A;  1JJ2 O;  3Q20 A;  1A8O A;  2QNW A;  1HQB A;  2AVA A;  1P7N A;  3B5I A;  3CXC O;  2PEK A;  1GXG A;  1L6N A;  2GON A;  3G28 A;  3G4S P;  1YIT P;  1K9M Q;  3CCR P;  1RNI A;  2LIU A;  2LOL A;  3H0D A;  1MZ8 A;  1E0H A;  1GXH A;  1VQP P;  3DPH A;  5HGN A;  2N6Z A;  5CZD B;  4GR2 A;  1L0I A;  2K93 A;  2JGP A;  3CMA P;  1M74 A;  1NJI Q;  2MR7 A;  3G21 A;  1IUQ A;  4DGA C;  2VLP A;  1KQS O;  2LKI A;  1F80 D;  4H2X C;  1YJW P;  2JBG A;  1VQ5 P;  3U43 A;  4MRT C;  2CGQ A;  2KOQ A;  3RG6 C;  5HGM A;  3H4E A;  2N5H A;  2N5I A;  1Q82 Q;  4PXH B;  2KOR A;  2P9X A;  2AFD A;  2GYK A;  2Y4Z A;  2N50 A;  3DTJ A;  1AUM A;  1YIJ P;  2N98 A;  3M1M A;  2LIW A;  2X83 A;  1CEI A;  2PEO A;  2JU2 A;  2XGU A;  1BXI A;  2MVU A;  3HYB A;  2MF4 A;  7CEI A;  3DS0 A;  2X82 A;  3BP9 A;  2PWO A;  2KWL A;  2WPT A;  4IPY A;  2M8P A;  2JQ4 A;  4HTW A;  3RG2 A;  3EJE A;  4QKO A;  1OR5 A;  2OAR A;  2GOL B;  4INB A;  1IMQ A;  1K8A Q;  1KC8 Q;  3G6E P;  3I55 P;  4F37 A;  2CG5 B;  1KD1 Q;  2KR5 A;  1VQN P;  3B4Q A;  4COP A;  5BS1 A;  1W2B O;  2KGF A;  5HGO A;  2XT1 A;  5HV8 A;  5HVC A;  4COC A;  3OW2 O;  1M6E X;  1Q81 Q;  2K92 A;  2FAD A;  3CPW O;  3HZQ A;  1VQ4 P;  5F2K A;  1UNK A;  3CC2 P;  4NEO A;  1G03 A;  4BPH A;  2CNR A;  3NY7 B;  2K5X A;  4PH3 A;  2XZ1 C;  1VQ9 P;  1M9C C;  1EM9 A;  4U0A A;  3CCE P;  2PY8 A;  1Q86 Q;  2WLV A;  5I4T G;  1K73 Q;  1A43 A;  2PEN A;  1EMV A;  1FR2 A;  3I56 P;  3DS5 A;  2VLN A;  2VSQ A;  2OTJ P;  3G1I A;  2XV6 A;  1X3O A;  2GZJ A;  2ERH A;  1VQ6 P;  2CQ8 A;  2XXM A;  3GKL C;  2JYG A;  1BAJ A;  2GZG A;  4U0E A;  2XZ0 D;  2KG8 A;  2WLV B;  4U0C A;  2EHT A;  3CD6 P;  5JPA A;  1UJZ A;  1DNY A;  2M8N A;  2LL8 A;  1E6J P;  2EHS A;  5KP6 B;  1HY8 A;  2JO0 A;  3CME P;  4BPG A;  1EIA A;  1IMP A;  1VHN A;  5HGK A;  1T8K A;  2L0Q A;  1QRJ A;  1GWP A;  1VQL P;  5F2O A;  2KW2 A;  2K0Y A;  3VRL C;  3G71 P;  3E2D A;  2L22 A;  1VKU A;  2JYL A;  4PH1 A;  3CC4 P;  2FQ0 A;  1AK4 C;  2KGC A;  4H2Y C;  2MY5 A;  2QEX P;  1AYI A;  4XRO A;  3G26 A;  3DS2 A;  3G29 A;  2LTE A;  3LMO A;  3CCS P;  2MD9 A;  2K2Q A;  4U0F A;  1KLP A;  4XFZ A;  2LML A;  2PEI A;  3G1G A;  1AF8 A;  1VQ7 P;  4UHP B;  2JU1 A;  1GPJ A;  4PWV B;  2KGA A;  3CE7 A;  2KG6 A;  2M5R A;  3GZM A;  2OTL P;  4HKG A;  2AF8 A;  2BHV A;  1M9Y C;  3WBH A;  3EJB A;  4GR6 A;  4NX4 C;  2XGV A;  3CCV P;  2N6Y A;  2KG9 A;  2L6E A;  2KOO A;  2KGE A;  2JPR A;  4QNB A;  4U0B A;  5HGL A;  1S72 P;  3H47 A;  2AFE A;  2GZI A;  2FVF A;  3LRY A;  1M9D C;  4E92 A;  2EFJ A;  2VLQ A;  3CC7 P;  1M6N A;  2MVV A;  2GZF A;  2FQ2 A;  1ZNV A;  5F2N A;  1U7K A;  5EJD A;  5KP8 B;  5KP7 B;  2GDW A;  4DGE C;  2K0D X;  4PH0 A;  2PWM A;  2XGY A;  2PEJ A;  3P05 A;  3GZL A;  2EG5 A;  3MGE A;  4WYM A;  3GJN A;  2Z44 A;  2K94 A;  4CA3 A;  2ROQ A;  3G0V A;  2KOS A;  2LPK A;  3CCM P;  1ACP A;  2KOD A;  2FQ1 A;  1VQ8 P;  2Z46 A;  2L9F A;  2DGY A;  1YJN P;  1M9E C;  2QA4 P;  4LQW C;  1NQ4 A;  2LF4 A;  4XFX A;  3DS3 A;  2ONT A;  2KOP A;  1Q7Y Q;  2V4X A;  1QVF O;  2L4B A;  4PH2 A;  2Z45 A;  1AFV A;  1M90 Q;  2BUO A;  2KGD A;  1D1D A;  4E91 A;  1N8R Q;  2X2D D;  1EOQ A;  3DS4 A;  1VQO P;  2CWO A;  4R0M A;  1VQM P;  2MR8 A;  2NO8 A;  4M0I A;  1Z6M A;  2K0X A;  3CCJ P;  3CCL P;  2GZE A;  4J93 A;  2GDX A; 
#chains in the Genus database with same CATH homology
 3H47 A;  2OTJ P;  1Q82 Q;  3G1I A;  3LRY A;  3CCQ P;  2XV6 A;  1M9D C;  4XRQ A;  4E92 A;  2EFJ A;  3CC7 P;  1RO2 A;  1M6N A;  2P9X A;  3NTE A;  1M9X C;  1VQ6 P;  5F2N A;  1U7K A;  2M8L A;  2Y4Z A;  3DTJ A;  1M1K Q;  2PEM A;  1AUM A;  2XXM A;  4DGE C;  1YIJ P;  4PH0 A;  2JYG A;  1BAJ A;  2PWM A;  4U0E A;  5DCK A;  1YJ9 P;  2WLV B;  3M1M A;  3CCU P;  4U0C A;  2XGY A;  2PEJ A;  3P05 A;  2X83 A;  3CD6 P;  2PEO A;  5JPA A;  2EG5 A;  2PEQ A;  1YHQ P;  1ZMB A;  1YI2 P;  3MGE A;  2XGU A;  4WYM A;  2EIA A;  2M8N A;  1M9F C;  2Z44 A;  2PXR C;  4XFY A;  1QVG O;  1E6J P;  3HYB A;  3G0V A;  3CCM P;  2KOD A;  2JO0 A;  1VQ8 P;  2Z46 A;  3DS0 A;  3CME P;  1EIA A;  4U0D A;  3DS1 A;  5BS2 A;  5HGK A;  4B4N A;  2X82 A;  3BP9 A;  2DGY A;  1VQK P;  1QRJ A;  1GWP A;  1YJN P;  1M9E C;  2QA4 P;  1RO0 A;  1VQL P;  2PWO A;  2XDE A;  5F2O A;  2E1M A;  4LQW C;  4IPY A;  1K30 A;  1JJ2 O;  3Q20 A;  1A8O A;  3VRL C;  3G71 P;  2M8P A;  3E2D A;  1P7N A;  4HTW A;  3B5I A;  2LF4 A;  4XFX A;  3CXC O;  2PEK A;  3DS3 A;  1L6N A;  2JYL A;  2ONT A;  2OAR A;  4PH1 A;  1Q7Y Q;  2GOL B;  2GON A;  2V4X A;  4INB A;  3G28 A;  3G4S P;  1YIT P;  1K9M Q;  1K8A Q;  3CC4 P;  3CCR P;  1QVF O;  1RNI A;  1KC8 Q;  4PH2 A;  1AK4 C;  3G6E P;  3I55 P;  2Z45 A;  1AFV A;  2QEX P;  1M90 Q;  3H0D A;  4XRO A;  1KD1 Q;  1VQP P;  2BUO A;  3DPH A;  1VQN P;  5HGN A;  3G26 A;  4COP A;  5BS1 A;  3DS2 A;  1W2B O;  2KGF A;  1D1D A;  3G29 A;  5HGO A;  4E91 A;  2XT1 A;  1N8R Q;  4GR2 A;  2X2D D;  1EOQ A;  3CMA P;  3CCS P;  1M74 A;  1NJI Q;  4COC A;  4U0F A;  3DS4 A;  3G21 A;  3OW2 O;  1M6E X;  1IUQ A;  1VQO P;  4XFZ A;  4DGA C;  1Q81 Q;  2PEI A;  3G1G A;  3CPW O;  3HZQ A;  1KQS O;  2CWO A;  1VQ4 P;  5F2K A;  1VQ7 P;  3CC2 P;  1VQM P;  1G03 A;  4M0I A;  2OTL P;  1YJW P;  1VQ5 P;  2BHV A;  1M9Y C;  4PH3 A;  3WBH A;  1VQ9 P;  1M9C C;  3CCJ P;  1EM9 A;  4U0A A;  4GR6 A;  3CCL P;  4NX4 C;  3CCE P;  2XGV A;  3CCV P;  3RG6 C;  2PY8 A;  2L6E A;  1Q86 Q;  5HGM A;  2WLV A;  5I4T G;  1K73 Q;  1A43 A;  2JPR A;  4QNB A;  2PEN A;  4U0B A;  4J93 A;  3H4E A;  3DS5 A;  3I56 P;  5HGL A;  1S72 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...