4U0FA

Hexameric hiv-1 ca in complex with bi-2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
201
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 70
structure length 201
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0fA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0fA02
4U0BA 4WYMA 1G03A 5JPAA 1D1DA 4XFZA 2LF4A 2X83A 5HGKA 2M8LA 3DS3A 3DTJA 1E6JP 1M9CC 3VRLC 4COPA 3DS0A 4NX4C 4U0AA 3G28A 1U7KA 2JYLA 4PH1A 4LQWC 2KODA 3G0VA 3LRYA 1M9XC 2WLVA 1EIAA 5HGMA 3DS2A 4PH2A 4PH0A 4U0DA 2M8PA 1EOQA 2EIAA 3G21A 4QNBA 2KGFA 3G1IA 3H47A 5HGLA 2ONTA 3NTEA 4IPYA 1M9EC 4PH3A 4DGEC 2GOLB 2XDEA 2PXRC 4XROA 3DS5A 1AFVA 2XT1A 1AK4C 3G26A 4U0CA 2BUOA 1A43A 1M9FC 4B4NA 4HTWA 4XFXA 5I4TG 2JPRA 4U0FA 3H4EA 2X2DD 2PWOA 2XV6A 2XGVA 4XFYA 1M9YC 3G29A 4M0IA 5DCKA 2GONA 3G1GA 1GWPA 4INBA 4XRQA 5HGNA 2L6EA 3DS1A 1A8OA 1M9DC 3DS4A 4DGAC 3DPHA 1AUMA 3BP9A 4U0EA 2XGYA 2XGUA 3P05A 4E92A 2M8NA 3MGEA 2V4XA 2XXMA 2JO0A 2X82A 1QRJA 2WLVB 1L6NA 4E91A 1EM9A 1P7NA 1BAJA 2PWMA 4COCA 5HGOA 4J93A 2Y4ZA 2JYGA
chains in the Genus database with same CATH superfamily
2KORA 2FACA 1VQ5P 4U0BA 3B5IA 1G03A 4H2YC 3CCRP 2GDWA 2KOPA 1D1DA 4XFZA 2LF4A 2L4BA 2DNWA 2K0DX 1T8KA 3VRLC 2KOOA 2QEXP 4U0AA 3G28A 1M1KQ 2GDXA 2JU1A 2KGEA 2KODA 3G0VA 5BS2A 2WLVA 1RNIA 1VHNA 1JJ2O 2N5IA 2KGAA 2QA4P 3WBHA 1YITP 3G1IA 2JB0A 3NTEA 2LTEA 4PH3A 1GPJA 1GXHA 2L22A 3CMAP 1AK4C 1GXGA 2BUOA 1M90Q 1YIJP 3OW2O 4XFXA 1F80D 2XV6A 1M9YC 3B4QA 2EHSA 3G29A 2GYKA 1EMVA 5DCKA 4BPHA 5KP8B 3G1GA 4XRQA 3DS1A 3I55P 3DS4A 3CC7P 4GR6A 7CEIA 4GR2A 3E2DA 5HVCA 3CPWO 2KG8A 1RO0A 3MGEA 2FVAA 1KC8Q 2XXMA 1KD1Q 3CCLP 2X82A 2WLVB 3G71P 2XZ0D 4E91A 2CQ8A 2AF8A 2LMLA 4R0MA 4IZ6A 2DGYA 2K0XA 4QKOA 4HKGA 1N8RQ 2JYGA 3CCEP 2X2BA 5BS1A 3H0DA 4WYMA 2GZFA 2KR5A 1AF8A 4UHPB 1W2BO 1VQKP 2N50A 2OTJP 2M8LA 3CCQP 2Z46A 1E6JP 1M9CC 3EJEA 2LIUA 1VQ6P 2OARA 2JBGA 5EW5E 2PY8A 1NJIQ 1K73Q 2K93A 1AYIA 1M6EX 2GDYA 4PH1A 2MF4A 1Q81Q 1M9XC 2PEIA 1EIAA 1BXIA 3RG2A 4PH2A 1S72P 2KGCA 2EIAA 3G21A 4QNBA 1UNKA 4IPYA 2PEOA 4DGEC 3G6EP 3CC2P 5F2KA 4XROA 2N98A 1YJ9P 1AFVA 2XT1A 3CCMP 3GKLC 2K0YA 3U43A 1A43A 1YJNP 2CWOA 2VLOA 5I4TG 2NO8A 2FVFA 1HQBA 1X3OA 1L0IA 4M0IA 2GONA 2MVVA 1GWPA 2ERHA 4INBA 5HGNA 1ZNVA 2WPTA 1DNYA 2FQ0A 1M9DC 3DPHA 1AUMA 1L0HA 2E1MA 4U0EA 1IUQA 3P05A 2Z44A 2KW2A 2M8NA 1Q82Q 1P7NA 2PEJA 5CZDB 5HGOA 2AFEA 5F2NA 3CD6P 3Q20A 2L9FA 2VLPA 3GZLA 2FADA 5JPAA 1VQ4P 2KOSA 2X83A 2FVEA 2GZIA 2BHVA 2FQ1A 3NY7B 3DTJA 2PNGA 3G4SP 2CGQA 3DS0A 2AVAA 4NX4C 1MZ8A 2LKIA 3EJDA 1VQLP 2Z45A 4LQWC 1M74A 1VQ8P 3LRYA 1K8AQ 1QVFO 1HY8A 4PH0A 3I56P 4U0DA 1KQSO 1EOQA 4F37A 2GZJA 1VQ7P 2KGFA 3H47A 1Q7YQ 2K5XA 1M9EC 2EHTA 1ACPA 2GOLB 2XDEA 1M6NA 3G26A 1M9FC 2KWLA 4HTWA 3H4EA 2X2DD 1Z6MA 2KOQA 2QNWA 2XGVA 4XFYA 2PEQA 5KP6B 3HZQA 5KP7B 4PWVB 3CCJP 3BP9A 2CNRA 2LPKA 3CCVP 2XGUA 2KG9A 4BPFA 3CE7A 5F2OA 3EJBA 1RO2A 2V4XA 2JO0A 3GJNA 2VLQA 1QRJA 2VLNA 1L6NA 4PXHB 1EM9A 1BAJA 1VQOP 1KLPA 2FAEA 1IMQA 2LL8A 1YJWP 2K94A 1VQPP 1ZMBA 3HYBA 2Y4ZA 1VQ9P 2N5HA 2MR7A 4MRTC 2EFJA 4H2WC 5HGKA 3DS3A 2KG6A 3RG6C 4COPA 2VSQA 2EG5A 2P9XA 2FHSC 2JQ4A 2PEMA 1U7KA 2GZEA 2N6YA 2JYLA 1VQMP 1E0HA 2KGDA 2JU2A 2GZGA 5HGMA 3DS2A 1OR5A 3M1MA 3CXCO 3CMEP 4DG9A 2M8PA 2L0QA 5HGLA 2ONTA 2LOLA 1CEIA 2JGPA 4H2XC 1QVGO 2PXRC 3DS5A 2FQ2A 1FR2A 2K92A 2OTLP 4U0CA 1Q86Q 1K9MQ 4B4NA 3CCUP 2LIWA 1YI2P 2JPRA 4U0FA 2PWOA 2AFDA 1VQNP 3CCSP 4CA3A 3LMOA 1UJZA 2M5RA 2MY5A 2L6EA 2N6ZA 3GZMA 1A8OA 4DGAC 1K30A 2ROQA 3CC4P 2XGYA 2MD9A 2PEKA 1DV5A 2XZ1C 1IMPA 4E92A 2PENA 2CG5B 1NQ4A 5HV8A 2K2QA 1VKUA 2PWMA 2MR8A 5EJDA 4NEOA 4COCA 2JAZA 2MVUA 4J93A 1YHQP 4BPGA
chains in the Genus database with same CATH topology
1VQ9P 3CCEP 1VQ5P 4U0BA 5BS1A 3H0DA 4WYMA 3B5IA 1G03A 3CCRP 5JPAA 1VQ4P 1D1DA 4XFZA 2LF4A 2EFJA 2X83A 1W2BO 1VQKP 2OTJP 2BHVA 5HGKA 2M8LA 3DS3A 3CCQP 2Z46A 3DTJA 1E6JP 1M9CC 3VRLC 3G4SP 3RG6C 4COPA 3DS0A 4NX4C 1VQ6P 2OARA 2QEXP 4U0AA 3G28A 2PY8A 1NJIQ 2EG5A 2P9XA 1M1KQ 2PEMA 1U7KA 1K73Q 2JYLA 1VQLP 1M6EX 2Z45A 4PH1A 4LQWC 1VQMP 1Q81Q 1M74A 2KODA 3G0VA 1VQ8P 3LRYA 1K8AQ 5BS2A 1M9XC 2WLVA 2PEIA 1EIAA 5HGMA 1RNIA 3DS2A 1JJ2O 1QVFO 4PH2A 3M1MA 4PH0A 3I56P 4U0DA 1KQSO 3CXCO 3CMEP 1S72P 2QA4P 2M8PA 1EOQA 2EIAA 3G21A 3WBHA 4QNBA 1VQ7P 2KGFA 3G1IA 1YITP 3H47A 5HGLA 2ONTA 3NTEA 1Q7YQ 4IPYA 1M9EC 2PEOA 4PH3A 4DGEC 1QVGO 2GOLB 2XDEA 2PXRC 5F2KA 1M6NA 4XROA 3G6EP 3CC2P 3DS5A 1YJ9P 1AFVA 2XT1A 3CMAP 3CCMP 1AK4C 2OTLP 3G26A 4U0CA 2BUOA 1A43A 1M90Q 1Q86Q 1M9FC 1K9MQ 4B4NA 1YJNP 2CWOA 3CCUP 1YIJP 4HTWA 3OW2O 4XFXA 5I4TG 1YI2P 2JPRA 4U0FA 3H4EA 2X2DD 2PWOA 2XV6A 1VQNP 2XGVA 4XFYA 2PEQA 1M9YC 3CCSP 3G29A 4M0IA 3HZQA 5DCKA 2GONA 3G1GA 1GWPA 4INBA 4XRQA 5HGNA 2L6EA 3DS1A 3CCJP 1A8OA 3I55P 1M9DC 3DS4A 4DGAC 3DPHA 1AUMA 1K30A 3BP9A 3CC4P 3CC7P 4GR6A 2E1MA 3CCVP 4GR2A 3E2DA 4U0EA 2XGYA 2XGUA 2PEKA 1IUQA 3P05A 2Z44A 5F2OA 3CPWO 1RO0A 4E92A 2M8NA 1RO2A 3MGEA 2PENA 2V4XA 1Q82Q 2XXMA 1KC8Q 1KD1Q 2JO0A 3CCLP 2X82A 1QRJA 2WLVB 3G71P 1L6NA 4E91A 1EM9A 1P7NA 1BAJA 2PWMA 1VQOP 2PEJA 4COCA 5HGOA 5F2NA 3CD6P 4J93A 2DGYA 3Q20A 1YHQP 1YJWP 1VQPP 1ZMBA 3HYBA 1N8RQ 2Y4ZA 2JYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0B A;  4WYM A;  1G03 A;  5JPA A;  1D1D A;  4XFZ A;  2LF4 A;  2X83 A;  5HGK A;  2M8L A;  3DS3 A;  3DTJ A;  1E6J P;  1M9C C;  3VRL C;  4COP A;  3DS0 A;  4NX4 C;  4U0A A;  3G28 A;  1U7K A;  2JYL A;  4PH1 A;  4LQW C;  2KOD A;  3G0V A;  3LRY A;  1M9X C;  2WLV A;  1EIA A;  5HGM A;  3DS2 A;  4PH2 A;  4PH0 A;  4U0D A;  2M8P A;  1EOQ A;  2EIA A;  3G21 A;  4QNB A;  2KGF A;  3G1I A;  3H47 A;  5HGL A;  2ONT A;  3NTE A;  4IPY A;  1M9E C;  4PH3 A;  4DGE C;  2GOL B;  2XDE A;  2PXR C;  4XRO A;  3DS5 A;  1AFV A;  2XT1 A;  1AK4 C;  3G26 A;  4U0C A;  2BUO A;  1A43 A;  1M9F C;  4B4N A;  4HTW A;  4XFX A;  5I4T G;  2JPR A;  4U0F A;  3H4E A;  2X2D D;  2PWO A;  2XV6 A;  2XGV A;  4XFY A;  1M9Y C;  3G29 A;  4M0I A;  5DCK A;  2GON A;  3G1G A;  1GWP A;  4INB A;  4XRQ A;  5HGN A;  2L6E A;  3DS1 A;  1A8O A;  1M9D C;  3DS4 A;  4DGA C;  3DPH A;  1AUM A;  3BP9 A;  4U0E A;  2XGY A;  2XGU A;  3P05 A;  4E92 A;  2M8N A;  3MGE A;  2V4X A;  2XXM A;  2JO0 A;  2X82 A;  1QRJ A;  2WLV B;  1L6N A;  4E91 A;  1EM9 A;  1P7N A;  1BAJ A;  2PWM A;  4COC A;  5HGO A;  4J93 A;  2Y4Z A;  2JYG A; 
#chains in the Genus database with same CATH topology
 2KOR A;  2FAC A;  1VQ5 P;  4U0B A;  3B5I A;  1G03 A;  4H2Y C;  3CCR P;  2GDW A;  2KOP A;  1D1D A;  4XFZ A;  2LF4 A;  2L4B A;  2DNW A;  2K0D X;  1T8K A;  3VRL C;  2KOO A;  2QEX P;  4U0A A;  3G28 A;  1M1K Q;  2GDX A;  2JU1 A;  2KGE A;  2KOD A;  3G0V A;  5BS2 A;  2WLV A;  1RNI A;  1VHN A;  1JJ2 O;  2N5I A;  2KGA A;  2QA4 P;  3WBH A;  1YIT P;  3G1I A;  2JB0 A;  3NTE A;  2LTE A;  4PH3 A;  1GPJ A;  1GXH A;  2L22 A;  3CMA P;  1AK4 C;  1GXG A;  2BUO A;  1M90 Q;  1YIJ P;  3OW2 O;  4XFX A;  1F80 D;  2XV6 A;  1M9Y C;  3B4Q A;  2EHS A;  3G29 A;  2GYK A;  1EMV A;  5DCK A;  4BPH A;  5KP8 B;  3G1G A;  4XRQ A;  3DS1 A;  3I55 P;  3DS4 A;  3CC7 P;  4GR6 A;  7CEI A;  4GR2 A;  3E2D A;  5HVC A;  3CPW O;  2KG8 A;  1RO0 A;  3MGE A;  2FVA A;  1KC8 Q;  2XXM A;  1KD1 Q;  3CCL P;  2X82 A;  2WLV B;  3G71 P;  2XZ0 D;  4E91 A;  2CQ8 A;  2AF8 A;  2LML A;  4R0M A;  4IZ6 A;  2DGY A;  2K0X A;  4QKO A;  4HKG A;  1N8R Q;  2JYG A;  3CCE P;  2X2B A;  5BS1 A;  3H0D A;  4WYM A;  2GZF A;  2KR5 A;  1AF8 A;  4UHP B;  1W2B O;  1VQK P;  2N50 A;  2OTJ P;  2M8L A;  3CCQ P;  2Z46 A;  1E6J P;  1M9C C;  3EJE A;  2LIU A;  1VQ6 P;  2OAR A;  2JBG A;  5EW5 E;  2PY8 A;  1NJI Q;  1K73 Q;  2K93 A;  1AYI A;  1M6E X;  2GDY A;  4PH1 A;  2MF4 A;  1Q81 Q;  1M9X C;  2PEI A;  1EIA A;  1BXI A;  3RG2 A;  4PH2 A;  1S72 P;  2KGC A;  2EIA A;  3G21 A;  4QNB A;  1UNK A;  4IPY A;  2PEO A;  4DGE C;  3G6E P;  3CC2 P;  5F2K A;  4XRO A;  2N98 A;  1YJ9 P;  1AFV A;  2XT1 A;  3CCM P;  3GKL C;  2K0Y A;  3U43 A;  1A43 A;  1YJN P;  2CWO A;  2VLO A;  5I4T G;  2NO8 A;  2FVF A;  1HQB A;  1X3O A;  1L0I A;  4M0I A;  2GON A;  2MVV A;  1GWP A;  2ERH A;  4INB A;  5HGN A;  1ZNV A;  2WPT A;  1DNY A;  2FQ0 A;  1M9D C;  3DPH A;  1AUM A;  1L0H A;  2E1M A;  4U0E A;  1IUQ A;  3P05 A;  2Z44 A;  2KW2 A;  2M8N A;  1Q82 Q;  1P7N A;  2PEJ A;  5CZD B;  5HGO A;  2AFE A;  5F2N A;  3CD6 P;  3Q20 A;  2L9F A;  2VLP A;  3GZL A;  2FAD A;  5JPA A;  1VQ4 P;  2KOS A;  2X83 A;  2FVE A;  2GZI A;  2BHV A;  2FQ1 A;  3NY7 B;  3DTJ A;  2PNG A;  3G4S P;  2CGQ A;  3DS0 A;  2AVA A;  4NX4 C;  1MZ8 A;  2LKI A;  3EJD A;  1VQL P;  2Z45 A;  4LQW C;  1M74 A;  1VQ8 P;  3LRY A;  1K8A Q;  1QVF O;  1HY8 A;  4PH0 A;  3I56 P;  4U0D A;  1KQS O;  1EOQ A;  4F37 A;  2GZJ A;  1VQ7 P;  2KGF A;  3H47 A;  1Q7Y Q;  2K5X A;  1M9E C;  2EHT A;  1ACP A;  2GOL B;  2XDE A;  1M6N A;  3G26 A;  1M9F C;  2KWL A;  4HTW A;  3H4E A;  2X2D D;  1Z6M A;  2KOQ A;  2QNW A;  2XGV A;  4XFY A;  2PEQ A;  5KP6 B;  3HZQ A;  5KP7 B;  4PWV B;  3CCJ P;  3BP9 A;  2CNR A;  2LPK A;  3CCV P;  2XGU A;  2KG9 A;  4BPF A;  3CE7 A;  5F2O A;  3EJB A;  1RO2 A;  2V4X A;  2JO0 A;  3GJN A;  2VLQ A;  1QRJ A;  2VLN A;  1L6N A;  4PXH B;  1EM9 A;  1BAJ A;  1VQO P;  1KLP A;  2FAE A;  1IMQ A;  2LL8 A;  1YJW P;  2K94 A;  1VQP P;  1ZMB A;  3HYB A;  2Y4Z A;  1VQ9 P;  2N5H A;  2MR7 A;  4MRT C;  2EFJ A;  4H2W C;  5HGK A;  3DS3 A;  2KG6 A;  3RG6 C;  4COP A;  2VSQ A;  2EG5 A;  2P9X A;  2FHS C;  2JQ4 A;  2PEM A;  1U7K A;  2GZE A;  2N6Y A;  2JYL A;  1VQM P;  1E0H A;  2KGD A;  2JU2 A;  2GZG A;  5HGM A;  3DS2 A;  1OR5 A;  3M1M A;  3CXC O;  3CME P;  4DG9 A;  2M8P A;  2L0Q A;  5HGL A;  2ONT A;  2LOL A;  1CEI A;  2JGP A;  4H2X C;  1QVG O;  2PXR C;  3DS5 A;  2FQ2 A;  1FR2 A;  2K92 A;  2OTL P;  4U0C A;  1Q86 Q;  1K9M Q;  4B4N A;  3CCU P;  2LIW A;  1YI2 P;  2JPR A;  4U0F A;  2PWO A;  2AFD A;  1VQN P;  3CCS P;  4CA3 A;  3LMO A;  1UJZ A;  2M5R A;  2MY5 A;  2L6E A;  2N6Z A;  3GZM A;  1A8O A;  4DGA C;  1K30 A;  2ROQ A;  3CC4 P;  2XGY A;  2MD9 A;  2PEK A;  1DV5 A;  2XZ1 C;  1IMP A;  4E92 A;  2PEN A;  2CG5 B;  1NQ4 A;  5HV8 A;  2K2Q A;  1VKU A;  2PWM A;  2MR8 A;  5EJD A;  4NEO A;  4COC A;  2JAZ A;  2MVU A;  4J93 A;  1YHQ P;  4BPG A; 
#chains in the Genus database with same CATH homology
 1VQ9 P;  3CCE P;  1VQ5 P;  4U0B A;  5BS1 A;  3H0D A;  4WYM A;  3B5I A;  1G03 A;  3CCR P;  5JPA A;  1VQ4 P;  1D1D A;  4XFZ A;  2LF4 A;  2EFJ A;  2X83 A;  1W2B O;  1VQK P;  2OTJ P;  2BHV A;  5HGK A;  2M8L A;  3DS3 A;  3CCQ P;  2Z46 A;  3DTJ A;  1E6J P;  1M9C C;  3VRL C;  3G4S P;  3RG6 C;  4COP A;  3DS0 A;  4NX4 C;  1VQ6 P;  2OAR A;  2QEX P;  4U0A A;  3G28 A;  2PY8 A;  1NJI Q;  2EG5 A;  2P9X A;  1M1K Q;  2PEM A;  1U7K A;  1K73 Q;  2JYL A;  1VQL P;  1M6E X;  2Z45 A;  4PH1 A;  4LQW C;  1VQM P;  1Q81 Q;  1M74 A;  2KOD A;  3G0V A;  1VQ8 P;  3LRY A;  1K8A Q;  5BS2 A;  1M9X C;  2WLV A;  2PEI A;  1EIA A;  5HGM A;  1RNI A;  3DS2 A;  1JJ2 O;  1QVF O;  4PH2 A;  3M1M A;  4PH0 A;  3I56 P;  4U0D A;  1KQS O;  3CXC O;  3CME P;  1S72 P;  2QA4 P;  2M8P A;  1EOQ A;  2EIA A;  3G21 A;  3WBH A;  4QNB A;  1VQ7 P;  2KGF A;  3G1I A;  1YIT P;  3H47 A;  5HGL A;  2ONT A;  3NTE A;  1Q7Y Q;  4IPY A;  1M9E C;  2PEO A;  4PH3 A;  4DGE C;  1QVG O;  2GOL B;  2XDE A;  2PXR C;  5F2K A;  1M6N A;  4XRO A;  3G6E P;  3CC2 P;  3DS5 A;  1YJ9 P;  1AFV A;  2XT1 A;  3CMA P;  3CCM P;  1AK4 C;  2OTL P;  3G26 A;  4U0C A;  2BUO A;  1A43 A;  1M90 Q;  1Q86 Q;  1M9F C;  1K9M Q;  4B4N A;  1YJN P;  2CWO A;  3CCU P;  1YIJ P;  4HTW A;  3OW2 O;  4XFX A;  5I4T G;  1YI2 P;  2JPR A;  4U0F A;  3H4E A;  2X2D D;  2PWO A;  2XV6 A;  1VQN P;  2XGV A;  4XFY A;  2PEQ A;  1M9Y C;  3CCS P;  3G29 A;  4M0I A;  3HZQ A;  5DCK A;  2GON A;  3G1G A;  1GWP A;  4INB A;  4XRQ A;  5HGN A;  2L6E A;  3DS1 A;  3CCJ P;  1A8O A;  3I55 P;  1M9D C;  3DS4 A;  4DGA C;  3DPH A;  1AUM A;  1K30 A;  3BP9 A;  3CC4 P;  3CC7 P;  4GR6 A;  2E1M A;  3CCV P;  4GR2 A;  3E2D A;  4U0E A;  2XGY A;  2XGU A;  2PEK A;  1IUQ A;  3P05 A;  2Z44 A;  5F2O A;  3CPW O;  1RO0 A;  4E92 A;  2M8N A;  1RO2 A;  3MGE A;  2PEN A;  2V4X A;  1Q82 Q;  2XXM A;  1KC8 Q;  1KD1 Q;  2JO0 A;  3CCL P;  2X82 A;  1QRJ A;  2WLV B;  3G71 P;  1L6N A;  4E91 A;  1EM9 A;  1P7N A;  1BAJ A;  2PWM A;  1VQO P;  2PEJ A;  4COC A;  5HGO A;  5F2N A;  3CD6 P;  4J93 A;  2DGY A;  3Q20 A;  1YHQ P;  1YJW P;  1VQP P;  1ZMB A;  3HYB A;  1N8R Q;  2Y4Z A;  2JYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...