4U0FA

Hexameric hiv-1 ca in complex with bi-2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
201
Chain Sequence
b'PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 70
structure length 201
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0fA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0fA02
2XV6A 1U7KA 2ONTA 5HGNA 2PWOA 3G0VA 3P05A 1AK4C 5HGMA 2JPRA 2JYLA 1M9DC 2M8NA 1E6JP 5I4TG 1M9CC 4E91A 4PH3A 3G1IA 3DPHA 2M8LA 5HGKA 5HGOA 4XFXA 3NTEA 1G03A 3G29A 2M8PA 3G28A 4J93A 4INBA 4COCA 2Y4ZA 2V4XA 4U0EA 2JYGA 4PH2A 1A43A 4U0BA 4IPYA 2KGFA 1QRJA 1L6NA 3DS1A 4XROA 4HTWA 1A8OA 4XFZA 2XGUA 5HGLA 2PXRC 4COPA 3MGEA 4M0IA 1EM9A 2EIAA 3DS0A 1D1DA 5JPAA 4NX4C 2XGYA 1EIAA 2X82A 1EOQA 4E92A 3G1GA 4U0CA 2XGVA 3BP9A 4DGAC 2L6EA 3H47A 3DS2A 2BUOA 2X83A 4QNBA 2XXMA 2XT1A 3DTJA 1M9YC 2LF4A 1P7NA 3DS5A 4PH1A 4WYMA 1AUMA 2KODA 3G21A 4B4NA 1BAJA 4PH0A 3VRLC 3DS3A 4LQWC 4XFYA 3LRYA 1M9EC 2GONA 2WLVA 5DCKA 3H4EA 2JO0A 3DS4A 1M9FC 2XDEA 4U0DA 4U0FA 1AFVA 3G26A 2WLVB 1M9XC 4U0AA 4DGEC 1GWPA 4XRQA 2X2DD 2GOLB 2PWMA
chains in the Genus database with same CATH superfamily
1AYIA 2L0QA 2ONTA 1UNKA 3G0VA 2KGAA 4NEOA 3GJNA 5HGMA 1M1KQ 3GZMA 2JYLA 2Z44A 2GYKA 2LIWA 2MF4A 5BS1A 3U43A 2PENA 2GZJA 4DG9A 4E91A 1VQOP 1HY8A 3DPHA 3CMEP 2CG5B 3CMAP 2KGDA 2GZGA 2M8PA 1KQSO 2JBGA 2KGEA 1W2BO 1VQKP 1YJNP 2MVUA 4U0EA 2LKIA 4U0BA 2K0DX 1QRJA 1L6NA 3DS1A 2QNWA 4XROA 2E1MA 3CE7A 2N6YA 1VQ7P 5JPAA 2FVAA 2KW2A 2XGYA 1EIAA 2X82A 1EOQA 1Q86Q 3CCJP 3G1GA 2VLNA 4U0CA 3B4QA 4DGAC 2L6EA 2XXMA 2VLPA 3DTJA 2KOOA 1VQNP 4BPHA 2LF4A 3CCSP 2KG6A 4PH1A 3RG2A 1VQ4P 1YJ9P 3CCEP 5KP7B 1BAJA 1RO0A 3CPWO 1NJIQ 5CZDB 2L4BA 3CC2P 2GONA 2PEIA 5DCKA 2AFDA 2N50A 3CCLP 3DS4A 2MR7A 3CC7P 4U0FA 2KOQA 5F2KA 2Z46A 1AFVA 1M9XC 5BS2A 4QKOA 2KR5A 4DGEC 2LTEA 4XRQA 2GOLB 2KOPA 2XV6A 1ACPA 1GPJA 3P05A 1JJ2O 1YJWP 2N5IA 2FQ2A 3CCVP 2FVFA 1RO2A 2M8NA 2OTJP 1M90Q 2KWLA 5I4TG 4PH3A 2FVEA 4XFXA 1M74A 1VHNA 1S72P 2K2QA 4CA3A 1YITP 1X3OA 4J93A 2AFEA 4COCA 1CEIA 1F80D 2Y4ZA 2JYGA 4IPYA 1VQ9P 1ZNVA 4BPFA 4XFZA 4HKGA 2XGUA 5HGLA 2PXRC 3MGEA 3CCMP 3M1MA 3CCRP 1T8KA 2NO8A 1D1DA 3OW2O 1KC8Q 4NX4C 2KORA 2K92A 4GR6A 2EHTA 4H2XC 5KP6B 3G4SP 2XGVA 2JAZA 1L0IA 2L9FA 3LMOA 3CCUP 4QNBA 3NY7B 5F2NA 2GZIA 2XT1A 1GXGA 1K8AQ 3DS5A 2LIUA 1Q82Q 2KG9A 3G21A 3CC4P 2FAEA 1IUQA 4BPGA 5F2OA 3E2DA 3VRLC 2VSQA 3LRYA 3H4EA 3H0DA 2XDEA 1ZMBA 4U0DA 1BXIA 2CGQA 2X2DD 1U7KA 5HGNA 2PWOA 2FADA 1AK4C 2MY5A 1N8RQ 1M6NA 2ROQA 2PY8A 1E6JP 1K9MQ 4H2YC 2BHVA 1Q81Q 1QVGO 2M8LA 2GDYA 5HGKA 3B5IA 2QEXP 3CXCO 1G03A 1Z6MA 2M5RA 3G29A 4R0MA 2CWOA 1K73Q 2FQ1A 3CD6P 4INBA 2V4XA 4PH2A 1A43A 3HZQA 2KGFA 2JU1A 5EW5E 1A8OA 3Q20A 4F37A 4COPA 4M0IA 1IMPA 1EM9A 2EIAA 1UJZA 1Q7YQ 1E0HA 3G6EP 4E92A 3RG6C 1KD1Q 2P9XA 2MVVA 1NQ4A 3BP9A 2PEQA 3H47A 2GDXA 2Z45A 3GKLC 2BUOA 2OARA 1VQ5P 2GZFA 3EJBA 1KLPA 1DV5A 2PEMA 1P7NA 4PWVB 1AUMA 2CNRA 2KG8A 2X2BA 5HVCA 4B4NA 2FACA 1L0HA 1RNIA 2KOSA 2EFJA 4PH0A 2VLQA 4XFYA 2PEKA 2JGPA 2K0XA 1GXHA 2JO0A 1M9FC 1MZ8A 2FQ0A 2N98A 2K5XA 2WLVB 5HV8A 2LMLA 1EMVA 1K30A 3I56P 1YHQP 2PWMA 2N6ZA 2AF8A 2LPKA 3G71P 2DGYA 2JPRA 1M9DC 1VQPP 2OTLP 2DNWA 3GZLA 2K94A 1M9CC 3G1IA 1VQ8P 4IZ6A 1QVFO 5HGOA 1VKUA 3NTEA 2KGCA 2GZEA 3EJEA 2JB0A 5EJDA 1YIJP 2XZ1C 2JU2A 5KP8B 2L22A 1M6EX 3G28A 1HQBA 2JQ4A 2FHSC 1VQLP 4UHPB 2XZ0D 1YI2P 3CCQP 2LL8A 4H2WC 1IMQA 2CQ8A 2VLOA 2K0YA 4HTWA 2PEOA 2AVAA 4PXHB 1AF8A 1VQMP 2K93A 3DS0A 2PNGA 2PEJA 2EG5A 2N5HA 2MR8A 1DNYA 2ERHA 1VQ6P 3DS2A 2X83A 2WPTA 1M9YC 4WYMA 2KODA 2LOLA 3I55P 2MD9A 2EHSA 4GR2A 4MRTC 3DS3A 4LQWC 3WBHA 1M9EC 2WLVA 1OR5A 7CEIA 3HYBA 2GDWA 3EJDA 1FR2A 3G26A 4U0AA 1GWPA 2QA4P
chains in the Genus database with same CATH topology
2XV6A 1U7KA 2ONTA 5HGNA 2PWOA 3G0VA 3P05A 1AK4C 1JJ2O 5HGMA 1YJWP 1M1KQ 1N8RQ 1M6NA 3CCVP 3G71P 2DGYA 2JPRA 2JYLA 2Z44A 1M9DC 1RO2A 2PY8A 2M8NA 1VQPP 2OTJP 5BS1A 2OTLP 1M90Q 1E6JP 1K9MQ 2PENA 5I4TG 1M9CC 2BHVA 4E91A 4PH3A 1VQOP 3G1IA 1VQ8P 3DPHA 1Q81Q 3CMEP 1QVFO 1QVGO 2M8LA 3CMAP 5HGKA 3B5IA 5HGOA 2QEXP 4XFXA 1M74A 3CXCO 3NTEA 1G03A 3G29A 1S72P 1YIJP 2M8PA 1KQSO 2CWOA 1K73Q 1YITP 3CD6P 1M6EX 3G28A 1W2BO 1VQKP 4J93A 4INBA 4COCA 1YJNP 2Y4ZA 1VQLP 2V4XA 4U0EA 2JYGA 4PH2A 1A43A 4U0BA 3HZQA 1YI2P 4IPYA 3CCQP 2KGFA 1VQ9P 1QRJA 1L6NA 3DS1A 4XROA 4HTWA 1A8OA 4XFZA 2PEOA 2XGUA 5HGLA 2PXRC 2E1MA 3Q20A 4COPA 3MGEA 3CCMP 1VQMP 1VQ7P 2QA4P 3M1MA 3CCRP 4M0IA 1EM9A 2EIAA 3DS0A 1D1DA 5JPAA 2PEJA 3OW2O 2EG5A 1KC8Q 1Q7YQ 4NX4C 2XGYA 3G6EP 1EIAA 2X82A 1EOQA 4E92A 1Q86Q 3RG6C 4GR6A 1KD1Q 3CCJP 2P9XA 3G4SP 3G1GA 4U0CA 1VQ6P 2XGVA 3BP9A 4DGAC 2L6EA 2PEQA 3H47A 3DS2A 2Z45A 2BUOA 2X83A 2OARA 3CCUP 4QNBA 1VQ5P 5F2NA 2XXMA 2XT1A 3DTJA 1M9YC 1VQNP 1K8AQ 2LF4A 2PEMA 1P7NA 3DS5A 4PH1A 3CCSP 1Q82Q 4WYMA 1AUMA 1VQ4P 2KODA 3G21A 1YJ9P 3CC4P 3CCEP 4B4NA 1BAJA 1RO0A 1RNIA 3CPWO 3I55P 2EFJA 1IUQA 4PH0A 5F2OA 1NJIQ 3E2DA 3VRLC 4GR2A 3DS3A 4LQWC 3WBHA 3CC2P 4XFYA 3LRYA 1M9EC 2GONA 2WLVA 2PEIA 2PEKA 5DCKA 3CCLP 3H4EA 2JO0A 3DS4A 1M9FC 3HYBA 3H0DA 3CC7P 2XDEA 1ZMBA 4U0DA 4U0FA 5F2KA 2Z46A 1AFVA 3G26A 2WLVB 1M9XC 5BS2A 4U0AA 4DGEC 1GWPA 1K30A 4XRQA 3I56P 2X2DD 1YHQP 2GOLB 2PWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XV6 A;  1U7K A;  2ONT A;  5HGN A;  2PWO A;  3G0V A;  3P05 A;  1AK4 C;  5HGM A;  2JPR A;  2JYL A;  1M9D C;  2M8N A;  1E6J P;  5I4T G;  1M9C C;  4E91 A;  4PH3 A;  3G1I A;  3DPH A;  2M8L A;  5HGK A;  5HGO A;  4XFX A;  3NTE A;  1G03 A;  3G29 A;  2M8P A;  3G28 A;  4J93 A;  4INB A;  4COC A;  2Y4Z A;  2V4X A;  4U0E A;  2JYG A;  4PH2 A;  1A43 A;  4U0B A;  4IPY A;  2KGF A;  1QRJ A;  1L6N A;  3DS1 A;  4XRO A;  4HTW A;  1A8O A;  4XFZ A;  2XGU A;  5HGL A;  2PXR C;  4COP A;  3MGE A;  4M0I A;  1EM9 A;  2EIA A;  3DS0 A;  1D1D A;  5JPA A;  4NX4 C;  2XGY A;  1EIA A;  2X82 A;  1EOQ A;  4E92 A;  3G1G A;  4U0C A;  2XGV A;  3BP9 A;  4DGA C;  2L6E A;  3H47 A;  3DS2 A;  2BUO A;  2X83 A;  4QNB A;  2XXM A;  2XT1 A;  3DTJ A;  1M9Y C;  2LF4 A;  1P7N A;  3DS5 A;  4PH1 A;  4WYM A;  1AUM A;  2KOD A;  3G21 A;  4B4N A;  1BAJ A;  4PH0 A;  3VRL C;  3DS3 A;  4LQW C;  4XFY A;  3LRY A;  1M9E C;  2GON A;  2WLV A;  5DCK A;  3H4E A;  2JO0 A;  3DS4 A;  1M9F C;  2XDE A;  4U0D A;  4U0F A;  1AFV A;  3G26 A;  2WLV B;  1M9X C;  4U0A A;  4DGE C;  1GWP A;  4XRQ A;  2X2D D;  2GOL B;  2PWM A; 
#chains in the Genus database with same CATH topology
 1AYI A;  2L0Q A;  2ONT A;  1UNK A;  3G0V A;  2KGA A;  4NEO A;  3GJN A;  5HGM A;  1M1K Q;  3GZM A;  2JYL A;  2Z44 A;  2GYK A;  2LIW A;  2MF4 A;  5BS1 A;  3U43 A;  2PEN A;  2GZJ A;  4DG9 A;  4E91 A;  1VQO P;  1HY8 A;  3DPH A;  3CME P;  2CG5 B;  3CMA P;  2KGD A;  2GZG A;  2M8P A;  1KQS O;  2JBG A;  2KGE A;  1W2B O;  1VQK P;  1YJN P;  2MVU A;  4U0E A;  2LKI A;  4U0B A;  2K0D X;  1QRJ A;  1L6N A;  3DS1 A;  2QNW A;  4XRO A;  2E1M A;  3CE7 A;  2N6Y A;  1VQ7 P;  5JPA A;  2FVA A;  2KW2 A;  2XGY A;  1EIA A;  2X82 A;  1EOQ A;  1Q86 Q;  3CCJ P;  3G1G A;  2VLN A;  4U0C A;  3B4Q A;  4DGA C;  2L6E A;  2XXM A;  2VLP A;  3DTJ A;  2KOO A;  1VQN P;  4BPH A;  2LF4 A;  3CCS P;  2KG6 A;  4PH1 A;  3RG2 A;  1VQ4 P;  1YJ9 P;  3CCE P;  5KP7 B;  1BAJ A;  1RO0 A;  3CPW O;  1NJI Q;  5CZD B;  2L4B A;  3CC2 P;  2GON A;  2PEI A;  5DCK A;  2AFD A;  2N50 A;  3CCL P;  3DS4 A;  2MR7 A;  3CC7 P;  4U0F A;  2KOQ A;  5F2K A;  2Z46 A;  1AFV A;  1M9X C;  5BS2 A;  4QKO A;  2KR5 A;  4DGE C;  2LTE A;  4XRQ A;  2GOL B;  2KOP A;  2XV6 A;  1ACP A;  1GPJ A;  3P05 A;  1JJ2 O;  1YJW P;  2N5I A;  2FQ2 A;  3CCV P;  2FVF A;  1RO2 A;  2M8N A;  2OTJ P;  1M90 Q;  2KWL A;  5I4T G;  4PH3 A;  2FVE A;  4XFX A;  1M74 A;  1VHN A;  1S72 P;  2K2Q A;  4CA3 A;  1YIT P;  1X3O A;  4J93 A;  2AFE A;  4COC A;  1CEI A;  1F80 D;  2Y4Z A;  2JYG A;  4IPY A;  1VQ9 P;  1ZNV A;  4BPF A;  4XFZ A;  4HKG A;  2XGU A;  5HGL A;  2PXR C;  3MGE A;  3CCM P;  3M1M A;  3CCR P;  1T8K A;  2NO8 A;  1D1D A;  3OW2 O;  1KC8 Q;  4NX4 C;  2KOR A;  2K92 A;  4GR6 A;  2EHT A;  4H2X C;  5KP6 B;  3G4S P;  2XGV A;  2JAZ A;  1L0I A;  2L9F A;  3LMO A;  3CCU P;  4QNB A;  3NY7 B;  5F2N A;  2GZI A;  2XT1 A;  1GXG A;  1K8A Q;  3DS5 A;  2LIU A;  1Q82 Q;  2KG9 A;  3G21 A;  3CC4 P;  2FAE A;  1IUQ A;  4BPG A;  5F2O A;  3E2D A;  3VRL C;  2VSQ A;  3LRY A;  3H4E A;  3H0D A;  2XDE A;  1ZMB A;  4U0D A;  1BXI A;  2CGQ A;  2X2D D;  1U7K A;  5HGN A;  2PWO A;  2FAD A;  1AK4 C;  2MY5 A;  1N8R Q;  1M6N A;  2ROQ A;  2PY8 A;  1E6J P;  1K9M Q;  4H2Y C;  2BHV A;  1Q81 Q;  1QVG O;  2M8L A;  2GDY A;  5HGK A;  3B5I A;  2QEX P;  3CXC O;  1G03 A;  1Z6M A;  2M5R A;  3G29 A;  4R0M A;  2CWO A;  1K73 Q;  2FQ1 A;  3CD6 P;  4INB A;  2V4X A;  4PH2 A;  1A43 A;  3HZQ A;  2KGF A;  2JU1 A;  5EW5 E;  1A8O A;  3Q20 A;  4F37 A;  4COP A;  4M0I A;  1IMP A;  1EM9 A;  2EIA A;  1UJZ A;  1Q7Y Q;  1E0H A;  3G6E P;  4E92 A;  3RG6 C;  1KD1 Q;  2P9X A;  2MVV A;  1NQ4 A;  3BP9 A;  2PEQ A;  3H47 A;  2GDX A;  2Z45 A;  3GKL C;  2BUO A;  2OAR A;  1VQ5 P;  2GZF A;  3EJB A;  1KLP A;  1DV5 A;  2PEM A;  1P7N A;  4PWV B;  1AUM A;  2CNR A;  2KG8 A;  2X2B A;  5HVC A;  4B4N A;  2FAC A;  1L0H A;  1RNI A;  2KOS A;  2EFJ A;  4PH0 A;  2VLQ A;  4XFY A;  2PEK A;  2JGP A;  2K0X A;  1GXH A;  2JO0 A;  1M9F C;  1MZ8 A;  2FQ0 A;  2N98 A;  2K5X A;  2WLV B;  5HV8 A;  2LML A;  1EMV A;  1K30 A;  3I56 P;  1YHQ P;  2PWM A;  2N6Z A;  2AF8 A;  2LPK A;  3G71 P;  2DGY A;  2JPR A;  1M9D C;  1VQP P;  2OTL P;  2DNW A;  3GZL A;  2K94 A;  1M9C C;  3G1I A;  1VQ8 P;  4IZ6 A;  1QVF O;  5HGO A;  1VKU A;  3NTE A;  2KGC A;  2GZE A;  3EJE A;  2JB0 A;  5EJD A;  1YIJ P;  2XZ1 C;  2JU2 A;  5KP8 B;  2L22 A;  1M6E X;  3G28 A;  1HQB A;  2JQ4 A;  2FHS C;  1VQL P;  4UHP B;  2XZ0 D;  1YI2 P;  3CCQ P;  2LL8 A;  4H2W C;  1IMQ A;  2CQ8 A;  2VLO A;  2K0Y A;  4HTW A;  2PEO A;  2AVA A;  4PXH B;  1AF8 A;  1VQM P;  2K93 A;  3DS0 A;  2PNG A;  2PEJ A;  2EG5 A;  2N5H A;  2MR8 A;  1DNY A;  2ERH A;  1VQ6 P;  3DS2 A;  2X83 A;  2WPT A;  1M9Y C;  4WYM A;  2KOD A;  2LOL A;  3I55 P;  2MD9 A;  2EHS A;  4GR2 A;  4MRT C;  3DS3 A;  4LQW C;  3WBH A;  1M9E C;  2WLV A;  1OR5 A;  7CEI A;  3HYB A;  2GDW A;  3EJD A;  1FR2 A;  3G26 A;  4U0A A;  1GWP A;  2QA4 P; 
#chains in the Genus database with same CATH homology
 2XV6 A;  1U7K A;  2ONT A;  5HGN A;  2PWO A;  3G0V A;  3P05 A;  1AK4 C;  1JJ2 O;  5HGM A;  1YJW P;  1M1K Q;  1N8R Q;  1M6N A;  3CCV P;  3G71 P;  2DGY A;  2JPR A;  2JYL A;  2Z44 A;  1M9D C;  1RO2 A;  2PY8 A;  2M8N A;  1VQP P;  2OTJ P;  5BS1 A;  2OTL P;  1M90 Q;  1E6J P;  1K9M Q;  2PEN A;  5I4T G;  1M9C C;  2BHV A;  4E91 A;  4PH3 A;  1VQO P;  3G1I A;  1VQ8 P;  3DPH A;  1Q81 Q;  3CME P;  1QVF O;  1QVG O;  2M8L A;  3CMA P;  5HGK A;  3B5I A;  5HGO A;  2QEX P;  4XFX A;  1M74 A;  3CXC O;  3NTE A;  1G03 A;  3G29 A;  1S72 P;  1YIJ P;  2M8P A;  1KQS O;  2CWO A;  1K73 Q;  1YIT P;  3CD6 P;  1M6E X;  3G28 A;  1W2B O;  1VQK P;  4J93 A;  4INB A;  4COC A;  1YJN P;  2Y4Z A;  1VQL P;  2V4X A;  4U0E A;  2JYG A;  4PH2 A;  1A43 A;  4U0B A;  3HZQ A;  1YI2 P;  4IPY A;  3CCQ P;  2KGF A;  1VQ9 P;  1QRJ A;  1L6N A;  3DS1 A;  4XRO A;  4HTW A;  1A8O A;  4XFZ A;  2PEO A;  2XGU A;  5HGL A;  2PXR C;  2E1M A;  3Q20 A;  4COP A;  3MGE A;  3CCM P;  1VQM P;  1VQ7 P;  2QA4 P;  3M1M A;  3CCR P;  4M0I A;  1EM9 A;  2EIA A;  3DS0 A;  1D1D A;  5JPA A;  2PEJ A;  3OW2 O;  2EG5 A;  1KC8 Q;  1Q7Y Q;  4NX4 C;  2XGY A;  3G6E P;  1EIA A;  2X82 A;  1EOQ A;  4E92 A;  1Q86 Q;  3RG6 C;  4GR6 A;  1KD1 Q;  3CCJ P;  2P9X A;  3G4S P;  3G1G A;  4U0C A;  1VQ6 P;  2XGV A;  3BP9 A;  4DGA C;  2L6E A;  2PEQ A;  3H47 A;  3DS2 A;  2Z45 A;  2BUO A;  2X83 A;  2OAR A;  3CCU P;  4QNB A;  1VQ5 P;  5F2N A;  2XXM A;  2XT1 A;  3DTJ A;  1M9Y C;  1VQN P;  1K8A Q;  2LF4 A;  2PEM A;  1P7N A;  3DS5 A;  4PH1 A;  3CCS P;  1Q82 Q;  4WYM A;  1AUM A;  1VQ4 P;  2KOD A;  3G21 A;  1YJ9 P;  3CC4 P;  3CCE P;  4B4N A;  1BAJ A;  1RO0 A;  1RNI A;  3CPW O;  3I55 P;  2EFJ A;  1IUQ A;  4PH0 A;  5F2O A;  1NJI Q;  3E2D A;  3VRL C;  4GR2 A;  3DS3 A;  4LQW C;  3WBH A;  3CC2 P;  4XFY A;  3LRY A;  1M9E C;  2GON A;  2WLV A;  2PEI A;  2PEK A;  5DCK A;  3CCL P;  3H4E A;  2JO0 A;  3DS4 A;  1M9F C;  3HYB A;  3H0D A;  3CC7 P;  2XDE A;  1ZMB A;  4U0D A;  4U0F A;  5F2K A;  2Z46 A;  1AFV A;  3G26 A;  2WLV B;  1M9X C;  5BS2 A;  4U0A A;  4DGE C;  1GWP A;  1K30 A;  4XRQ A;  3I56 P;  2X2D D;  1YHQ P;  2GOL B;  2PWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...