4U0FA

Hexameric hiv-1 ca in complex with bi-2
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
219
structure length
201
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
total genus 70
structure length 201
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0fA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0fA02
2BUOA 3DS2A 4XROA 4COCA 3DS4A 1M9XC 4J93A 1U7KA 2X82A 2XDEA 5I4TG 1QRJA 4QNBA 2PWMA 3DPHA 1BAJA 3DS1A 3G1GA 1M9CC 2M8PA 2X2DD 3BP9A 3DS5A 4LQWC 2WLVB 4E92A 4HTWA 4U0AA 2JO0A 2LF4A 2GOLB 4NX4C 1P7NA 1M9EC 4PH0A 2M8LA 1EOQA 1EM9A 1A8OA 2PWOA 1E6JP 4DGAC 4XFYA 4XRQA 3NTEA 1D1DA 4U0BA 5HGNA 4INBA 3H4EA 3DTJA 2XGUA 2XGYA 4M0IA 4U0CA 1GWPA 3LRYA 2WLVA 4U0DA 1AUMA 4DGEC 2JYLA 1M9DC 4PH2A 1L6NA 2XV6A 2XT1A 4IPYA 2JYGA 4XFZA 3DS0A 1EIAA 2ONTA 5HGMA 5HGOA 4PH3A 4COPA 2EIAA 4E91A 4U0EA 5JPAA 5DCKA 4XFXA 3DS3A 3MGEA 1M9FC 5HGKA 1G03A 3H47A 2Y4ZA 3G26A 2KGFA 2KODA 3VRLC 1AFVA 1A43A 4B4NA 3G28A 2M8NA 3G29A 2X83A 1M9YC 2XXMA 3G21A 5HGLA 2V4XA 4WYMA 2GONA 2PXRC 2L6EA 4PH1A 4U0FA 3G0VA 3G1IA 1AK4C 2JPRA 2XGVA 3P05A
chains in the Genus database with same CATH superfamily
2BUOA 3DS4A 4J93A 5EJDA 1T8KA 2N5IA 1KD1Q 1MZ8A 2KOSA 1NQ4A 2K0XA 2DNWA 2Z46A 3DS1A 3I56P 3G1GA 2PY8A 2M8PA 1VKUA 3CC2P 4PXHB 3DS5A 2LOLA 2XZ0D 2KOQA 1X3OA 1VQ8P 1BXIA 1FR2A 2LF4A 2K5XA 1GXHA 1YHQP 1RO0A 4U0BA 2LKIA 2PEQA 4INBA 2FVEA 2XGUA 3HYBA 2ERHA 3CCVP 2EHSA 1GWPA 2GZGA 2WLVA 2JYLA 3H0DA 2XV6A 4XFZA 4COPA 4PH3A 2EIAA 4E91A 3DS3A 3MGEA 3CCSP 1RNIA 1M9FC 2FHSC 5KP8B 3H47A 1YIJP 2L9FA 1L0IA 4B4NA 2Z45A 5KP7B 2X83A 1M9YC 2K0YA 2V4XA 2GDWA 1UNKA 2VLQA 2L0QA 2PEOA 3G0VA 2LL8A 3G1IA 3OW2O 3CPWO 2XGVA 3P05A 2FADA 1HY8A 1YJ9P 2KWLA 4XROA 5HV8A 3CXCO 1U7KA 2X82A 4UHPB 1L0HA 4QNBA 4H2XC 3LMOA 3CC7P 1BAJA 2CG5B 2FVFA 2WPTA 7CEIA 3BP9A 2NO8A 4MRTC 1E0HA 2ROQA 1K73Q 1VQPP 5F2OA 2VLPA 2GOLB 2PEIA 1M9EC 3CCUP 4PWVB 1EOQA 1IUQA 1W2BO 1EM9A 2KGAA 1VQ5P 1JJ2O 2N98A 2PWOA 4DGAC 4XFYA 3NTEA 1K9MQ 1D1DA 5HGNA 4BPGA 1M1KQ 3DTJA 4U0CA 3GZMA 3LRYA 1M74A 2QA4P 4DGEC 1VQMP 2M5RA 1IMPA 2KG6A 2AVAA 1YJWP 2K93A 1HQBA 3DS0A 5HGOA 2JU1A 2OTJP 4DG9A 3EJDA 1NJIQ 3NY7B 2AF8A 2FAEA 2KR5A 3M1MA 2CNRA 2EHTA 2MD9A 5HGKA 2LTEA 2GZEA 2Y4ZA 3VRLC 3G28A 3B5IA 5HGLA 1GPJA 2FACA 2L6EA 4PH1A 2FQ1A 2PEJA 1UJZA 1VHNA 1AK4C 2JPRA 2JGPA 1K30A 2PEMA 2KOOA 5F2KA 3DS2A 2OTLP 2P9XA 2VLOA 2JAZA 1QRJA 1QVGO 2PWMA 2CQ8A 2LMLA 3U43A 4NEOA 1YI2P 3CC4P 2MVVA 1YITP 2BHVA 2KG8A 1VQ7P 1VQKP 2X2DD 3RG2A 2PNGA 3CMAP 2AFDA 1ZNVA 2OARA 4HTWA 1Q81Q 2PENA 1RO2A 2DGYA 3GZLA 2N6ZA 2VSQA 1P7NA 3G71P 2M8LA 1A8OA 2GDXA 2GZJA 1E6JP 4XRQA 2JB0A 2KGCA 3G6EP 1K8AQ 1EMVA 2EFJA 1VQ9P 4H2YC 2FQ0A 2FVAA 2GZIA 1S72P 3CMEP 1Q82Q 3G4SP 4IPYA 2JYGA 5HGMA 1VQ6P 4BPFA 5DCKA 1ZMBA 2MR8A 1M6NA 2KG9A 1G03A 2L4BA 2X2BA 3G26A 2E1MA 2KODA 1A43A 1CEIA 2XXMA 3G21A 3RG6C 2GDYA 2JU2A 4WYMA 2L22A 2GONA 2K94A 3EJBA 1AYIA 1YJNP 4HKGA 4U0FA 3GJNA 5BS1A 1GXGA 3E2DA 3I55P 3B4QA 2PEKA 3CE7A 2LIWA 5EW5E 2CWOA 4COCA 1M9XC 1Q7YQ 2KGEA 1QVFO 5BS2A 2XDEA 2MF4A 2N6YA 5I4TG 3CCRP 2KGDA 4F37A 1VQLP 3DPHA 1OR5A 1DV5A 1M9CC 3Q20A 2Z44A 3CD6P 4LQWC 2WLVB 3GKLC 1M6EX 4E92A 3CCLP 1VQNP 4U0AA 2JO0A 4QKOA 3CCQP 1VQOP 2JQ4A 2LPKA 2MY5A 2K0DX 1M90Q 3CCMP 1KQSO 4NX4C 1KLPA 4PH0A 2KORA 3WBHA 2MVUA 2FQ2A 1N8RQ 1KC8Q 3EJEA 2KOPA 2AFEA 1Z6MA 5CZDB 2GZFA 3H4EA 1AF8A 4R0MA 2XGYA 2K2QA 4M0IA 3HZQA 2GYKA 4IZ6A 4U0DA 1AUMA 4GR6A 1M9DC 4PH2A 1L6NA 2LIUA 1VQ4P 4H2WC 1F80D 2XT1A 1ACPA 1EIAA 2ONTA 4U0EA 5JPAA 4XFXA 2JBGA 3CCJP 2VLNA 4BPHA 1DNYA 2EG5A 2K92A 2KGFA 4GR2A 1AFVA 2M8NA 2N50A 3G29A 3CCEP 5HVCA 2N5HA 2PXRC 2MR7A 2CGQA 2QNWA 2XZ1C 2KW2A 1Q86Q 2QEXP 5F2NA 1IMQA 5KP6B 4CA3A
chains in the Genus database with same CATH topology
2BUOA 5F2KA 3DS2A 2CWOA 1YJ9P 4XROA 2OTLP 2P9XA 4COCA 3DS4A 1M9XC 4J93A 3CXCO 1Q7YQ 1QVFO 5BS2A 1U7KA 2X82A 2XDEA 5I4TG 1KD1Q 3CCRP 1QRJA 4QNBA 1QVGO 1VQLP 2PWMA 3DPHA 3CC7P 1BAJA 1YI2P 2Z46A 3DS1A 3I56P 3G1GA 3CC4P 2PY8A 1M9CC 1YITP 2M8PA 2BHVA 1VQ7P 1VQKP 2X2DD 3BP9A 3Q20A 3CC2P 2Z44A 3CD6P 3DS5A 3CMAP 4LQWC 2WLVB 1K73Q 1M6EX 4E92A 2OARA 3CCLP 1VQNP 1VQ8P 4HTWA 4U0AA 2JO0A 1VQPP 5F2OA 3CCQP 1VQOP 2LF4A 1Q81Q 2PENA 1RO2A 2DGYA 2GOLB 1M90Q 3CCMP 1KQSO 2PEIA 4NX4C 1P7NA 1M9EC 3CCUP 4PH0A 3G71P 2M8LA 3WBHA 1EOQA 1IUQA 1W2BO 1EM9A 1RO0A 1VQ5P 1YHQP 1A8OA 1N8RQ 1KC8Q 1JJ2O 2PWOA 1E6JP 4DGAC 4XFYA 4XRQA 3NTEA 1K9MQ 1D1DA 4U0BA 5HGNA 2PEQA 3G6EP 4INBA 1K8AQ 1M1KQ 3H4EA 3DTJA 2XGUA 3HYBA 2XGYA 2EFJA 1VQ9P 4M0IA 3CCVP 3HZQA 4U0CA 1GWPA 3LRYA 1S72P 2WLVA 1M74A 3CMEP 4U0DA 1AUMA 4GR6A 2QA4P 4DGEC 2JYLA 3H0DA 1VQMP 1Q82Q 1M9DC 4PH2A 1L6NA 1VQ4P 2XV6A 2XT1A 1YJWP 3G4SP 4IPYA 2JYGA 4XFZA 3DS0A 1EIAA 2ONTA 5HGMA 1VQ6P 5HGOA 4PH3A 4COPA 2EIAA 4E91A 4U0EA 5JPAA 2OTJP 5DCKA 4XFXA 3CCJP 1ZMBA 1NJIQ 3DS3A 3MGEA 3CCSP 1RNIA 1M6NA 3M1MA 1M9FC 5HGKA 1G03A 3H47A 2EG5A 1YIJP 2Y4ZA 3G26A 2KGFA 2E1MA 2KODA 1AFVA 4GR2A 3VRLC 1A43A 4B4NA 3G28A 2Z45A 2M8NA 3G29A 2X83A 3B5IA 1M9YC 2XXMA 3G21A 3CCEP 5HGLA 3RG6C 2V4XA 4WYMA 2GONA 2PXRC 2L6EA 1YJNP 4PH1A 4U0FA 2PEOA 3G0VA 2PEJA 3G1IA 1Q86Q 2QEXP 3OW2O 5BS1A 3E2DA 5F2NA 1AK4C 2JPRA 2XGVA 3CPWO 3I55P 3P05A 1K30A 2PEKA 2PEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BUO A;  3DS2 A;  4XRO A;  4COC A;  3DS4 A;  1M9X C;  4J93 A;  1U7K A;  2X82 A;  2XDE A;  5I4T G;  1QRJ A;  4QNB A;  2PWM A;  3DPH A;  1BAJ A;  3DS1 A;  3G1G A;  1M9C C;  2M8P A;  2X2D D;  3BP9 A;  3DS5 A;  4LQW C;  2WLV B;  4E92 A;  4HTW A;  4U0A A;  2JO0 A;  2LF4 A;  2GOL B;  4NX4 C;  1P7N A;  1M9E C;  4PH0 A;  2M8L A;  1EOQ A;  1EM9 A;  1A8O A;  2PWO A;  1E6J P;  4DGA C;  4XFY A;  4XRQ A;  3NTE A;  1D1D A;  4U0B A;  5HGN A;  4INB A;  3H4E A;  3DTJ A;  2XGU A;  2XGY A;  4M0I A;  4U0C A;  1GWP A;  3LRY A;  2WLV A;  4U0D A;  1AUM A;  4DGE C;  2JYL A;  1M9D C;  4PH2 A;  1L6N A;  2XV6 A;  2XT1 A;  4IPY A;  2JYG A;  4XFZ A;  3DS0 A;  1EIA A;  2ONT A;  5HGM A;  5HGO A;  4PH3 A;  4COP A;  2EIA A;  4E91 A;  4U0E A;  5JPA A;  5DCK A;  4XFX A;  3DS3 A;  3MGE A;  1M9F C;  5HGK A;  1G03 A;  3H47 A;  2Y4Z A;  3G26 A;  2KGF A;  2KOD A;  3VRL C;  1AFV A;  1A43 A;  4B4N A;  3G28 A;  2M8N A;  3G29 A;  2X83 A;  1M9Y C;  2XXM A;  3G21 A;  5HGL A;  2V4X A;  4WYM A;  2GON A;  2PXR C;  2L6E A;  4PH1 A;  4U0F A;  3G0V A;  3G1I A;  1AK4 C;  2JPR A;  2XGV A;  3P05 A; 
#chains in the Genus database with same CATH topology
 2BUO A;  3DS4 A;  4J93 A;  5EJD A;  1T8K A;  2N5I A;  1KD1 Q;  1MZ8 A;  2KOS A;  1NQ4 A;  2K0X A;  2DNW A;  2Z46 A;  3DS1 A;  3I56 P;  3G1G A;  2PY8 A;  2M8P A;  1VKU A;  3CC2 P;  4PXH B;  3DS5 A;  2LOL A;  2XZ0 D;  2KOQ A;  1X3O A;  1VQ8 P;  1BXI A;  1FR2 A;  2LF4 A;  2K5X A;  1GXH A;  1YHQ P;  1RO0 A;  4U0B A;  2LKI A;  2PEQ A;  4INB A;  2FVE A;  2XGU A;  3HYB A;  2ERH A;  3CCV P;  2EHS A;  1GWP A;  2GZG A;  2WLV A;  2JYL A;  3H0D A;  2XV6 A;  4XFZ A;  4COP A;  4PH3 A;  2EIA A;  4E91 A;  3DS3 A;  3MGE A;  3CCS P;  1RNI A;  1M9F C;  2FHS C;  5KP8 B;  3H47 A;  1YIJ P;  2L9F A;  1L0I A;  4B4N A;  2Z45 A;  5KP7 B;  2X83 A;  1M9Y C;  2K0Y A;  2V4X A;  2GDW A;  1UNK A;  2VLQ A;  2L0Q A;  2PEO A;  3G0V A;  2LL8 A;  3G1I A;  3OW2 O;  3CPW O;  2XGV A;  3P05 A;  2FAD A;  1HY8 A;  1YJ9 P;  2KWL A;  4XRO A;  5HV8 A;  3CXC O;  1U7K A;  2X82 A;  4UHP B;  1L0H A;  4QNB A;  4H2X C;  3LMO A;  3CC7 P;  1BAJ A;  2CG5 B;  2FVF A;  2WPT A;  7CEI A;  3BP9 A;  2NO8 A;  4MRT C;  1E0H A;  2ROQ A;  1K73 Q;  1VQP P;  5F2O A;  2VLP A;  2GOL B;  2PEI A;  1M9E C;  3CCU P;  4PWV B;  1EOQ A;  1IUQ A;  1W2B O;  1EM9 A;  2KGA A;  1VQ5 P;  1JJ2 O;  2N98 A;  2PWO A;  4DGA C;  4XFY A;  3NTE A;  1K9M Q;  1D1D A;  5HGN A;  4BPG A;  1M1K Q;  3DTJ A;  4U0C A;  3GZM A;  3LRY A;  1M74 A;  2QA4 P;  4DGE C;  1VQM P;  2M5R A;  1IMP A;  2KG6 A;  2AVA A;  1YJW P;  2K93 A;  1HQB A;  3DS0 A;  5HGO A;  2JU1 A;  2OTJ P;  4DG9 A;  3EJD A;  1NJI Q;  3NY7 B;  2AF8 A;  2FAE A;  2KR5 A;  3M1M A;  2CNR A;  2EHT A;  2MD9 A;  5HGK A;  2LTE A;  2GZE A;  2Y4Z A;  3VRL C;  3G28 A;  3B5I A;  5HGL A;  1GPJ A;  2FAC A;  2L6E A;  4PH1 A;  2FQ1 A;  2PEJ A;  1UJZ A;  1VHN A;  1AK4 C;  2JPR A;  2JGP A;  1K30 A;  2PEM A;  2KOO A;  5F2K A;  3DS2 A;  2OTL P;  2P9X A;  2VLO A;  2JAZ A;  1QRJ A;  1QVG O;  2PWM A;  2CQ8 A;  2LML A;  3U43 A;  4NEO A;  1YI2 P;  3CC4 P;  2MVV A;  1YIT P;  2BHV A;  2KG8 A;  1VQ7 P;  1VQK P;  2X2D D;  3RG2 A;  2PNG A;  3CMA P;  2AFD A;  1ZNV A;  2OAR A;  4HTW A;  1Q81 Q;  2PEN A;  1RO2 A;  2DGY A;  3GZL A;  2N6Z A;  2VSQ A;  1P7N A;  3G71 P;  2M8L A;  1A8O A;  2GDX A;  2GZJ A;  1E6J P;  4XRQ A;  2JB0 A;  2KGC A;  3G6E P;  1K8A Q;  1EMV A;  2EFJ A;  1VQ9 P;  4H2Y C;  2FQ0 A;  2FVA A;  2GZI A;  1S72 P;  3CME P;  1Q82 Q;  3G4S P;  4IPY A;  2JYG A;  5HGM A;  1VQ6 P;  4BPF A;  5DCK A;  1ZMB A;  2MR8 A;  1M6N A;  2KG9 A;  1G03 A;  2L4B A;  2X2B A;  3G26 A;  2E1M A;  2KOD A;  1A43 A;  1CEI A;  2XXM A;  3G21 A;  3RG6 C;  2GDY A;  2JU2 A;  4WYM A;  2L22 A;  2GON A;  2K94 A;  3EJB A;  1AYI A;  1YJN P;  4HKG A;  4U0F A;  3GJN A;  5BS1 A;  1GXG A;  3E2D A;  3I55 P;  3B4Q A;  2PEK A;  3CE7 A;  2LIW A;  5EW5 E;  2CWO A;  4COC A;  1M9X C;  1Q7Y Q;  2KGE A;  1QVF O;  5BS2 A;  2XDE A;  2MF4 A;  2N6Y A;  5I4T G;  3CCR P;  2KGD A;  4F37 A;  1VQL P;  3DPH A;  1OR5 A;  1DV5 A;  1M9C C;  3Q20 A;  2Z44 A;  3CD6 P;  4LQW C;  2WLV B;  3GKL C;  1M6E X;  4E92 A;  3CCL P;  1VQN P;  4U0A A;  2JO0 A;  4QKO A;  3CCQ P;  1VQO P;  2JQ4 A;  2LPK A;  2MY5 A;  2K0D X;  1M90 Q;  3CCM P;  1KQS O;  4NX4 C;  1KLP A;  4PH0 A;  2KOR A;  3WBH A;  2MVU A;  2FQ2 A;  1N8R Q;  1KC8 Q;  3EJE A;  2KOP A;  2AFE A;  1Z6M A;  5CZD B;  2GZF A;  3H4E A;  1AF8 A;  4R0M A;  2XGY A;  2K2Q A;  4M0I A;  3HZQ A;  2GYK A;  4IZ6 A;  4U0D A;  1AUM A;  4GR6 A;  1M9D C;  4PH2 A;  1L6N A;  2LIU A;  1VQ4 P;  4H2W C;  1F80 D;  2XT1 A;  1ACP A;  1EIA A;  2ONT A;  4U0E A;  5JPA A;  4XFX A;  2JBG A;  3CCJ P;  2VLN A;  4BPH A;  1DNY A;  2EG5 A;  2K92 A;  2KGF A;  4GR2 A;  1AFV A;  2M8N A;  2N50 A;  3G29 A;  3CCE P;  5HVC A;  2N5H A;  2PXR C;  2MR7 A;  2CGQ A;  2QNW A;  2XZ1 C;  2KW2 A;  1Q86 Q;  2QEX P;  5F2N A;  1IMQ A;  5KP6 B;  4CA3 A; 
#chains in the Genus database with same CATH homology
 2BUO A;  5F2K A;  3DS2 A;  2CWO A;  1YJ9 P;  4XRO A;  2OTL P;  2P9X A;  4COC A;  3DS4 A;  1M9X C;  4J93 A;  3CXC O;  1Q7Y Q;  1QVF O;  5BS2 A;  1U7K A;  2X82 A;  2XDE A;  5I4T G;  1KD1 Q;  3CCR P;  1QRJ A;  4QNB A;  1QVG O;  1VQL P;  2PWM A;  3DPH A;  3CC7 P;  1BAJ A;  1YI2 P;  2Z46 A;  3DS1 A;  3I56 P;  3G1G A;  3CC4 P;  2PY8 A;  1M9C C;  1YIT P;  2M8P A;  2BHV A;  1VQ7 P;  1VQK P;  2X2D D;  3BP9 A;  3Q20 A;  3CC2 P;  2Z44 A;  3CD6 P;  3DS5 A;  3CMA P;  4LQW C;  2WLV B;  1K73 Q;  1M6E X;  4E92 A;  2OAR A;  3CCL P;  1VQN P;  1VQ8 P;  4HTW A;  4U0A A;  2JO0 A;  1VQP P;  5F2O A;  3CCQ P;  1VQO P;  2LF4 A;  1Q81 Q;  2PEN A;  1RO2 A;  2DGY A;  2GOL B;  1M90 Q;  3CCM P;  1KQS O;  2PEI A;  4NX4 C;  1P7N A;  1M9E C;  3CCU P;  4PH0 A;  3G71 P;  2M8L A;  3WBH A;  1EOQ A;  1IUQ A;  1W2B O;  1EM9 A;  1RO0 A;  1VQ5 P;  1YHQ P;  1A8O A;  1N8R Q;  1KC8 Q;  1JJ2 O;  2PWO A;  1E6J P;  4DGA C;  4XFY A;  4XRQ A;  3NTE A;  1K9M Q;  1D1D A;  4U0B A;  5HGN A;  2PEQ A;  3G6E P;  4INB A;  1K8A Q;  1M1K Q;  3H4E A;  3DTJ A;  2XGU A;  3HYB A;  2XGY A;  2EFJ A;  1VQ9 P;  4M0I A;  3CCV P;  3HZQ A;  4U0C A;  1GWP A;  3LRY A;  1S72 P;  2WLV A;  1M74 A;  3CME P;  4U0D A;  1AUM A;  4GR6 A;  2QA4 P;  4DGE C;  2JYL A;  3H0D A;  1VQM P;  1Q82 Q;  1M9D C;  4PH2 A;  1L6N A;  1VQ4 P;  2XV6 A;  2XT1 A;  1YJW P;  3G4S P;  4IPY A;  2JYG A;  4XFZ A;  3DS0 A;  1EIA A;  2ONT A;  5HGM A;  1VQ6 P;  5HGO A;  4PH3 A;  4COP A;  2EIA A;  4E91 A;  4U0E A;  5JPA A;  2OTJ P;  5DCK A;  4XFX A;  3CCJ P;  1ZMB A;  1NJI Q;  3DS3 A;  3MGE A;  3CCS P;  1RNI A;  1M6N A;  3M1M A;  1M9F C;  5HGK A;  1G03 A;  3H47 A;  2EG5 A;  1YIJ P;  2Y4Z A;  3G26 A;  2KGF A;  2E1M A;  2KOD A;  1AFV A;  4GR2 A;  3VRL C;  1A43 A;  4B4N A;  3G28 A;  2Z45 A;  2M8N A;  3G29 A;  2X83 A;  3B5I A;  1M9Y C;  2XXM A;  3G21 A;  3CCE P;  5HGL A;  3RG6 C;  2V4X A;  4WYM A;  2GON A;  2PXR C;  2L6E A;  1YJN P;  4PH1 A;  4U0F A;  2PEO A;  3G0V A;  2PEJ A;  3G1I A;  1Q86 Q;  2QEX P;  3OW2 O;  5BS1 A;  3E2D A;  5F2N A;  1AK4 C;  2JPR A;  2XGV A;  3CPW O;  3I55 P;  3P05 A;  1K30 A;  2PEK A;  2PEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...