2X82A

Evolutionary basis of hiv restriction by the antiretroviral trimcyp
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
145
structure length
145
Chain Sequence
PVQHVGGTYTHIPLSPRTLNAWVKLVEEKKFGAEVVPGFQALSEGCTPYDINQMLNCVGDHQAAMQIIREIINEEAAEWDVQHPIPAGPLPAGQLREPRGSDIAGTTSTVEEQIQWMFRPQNPVPVGNIYRRWIQIGLQKCVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords CAPSID PROTEIN P24
publication title Conformational Adaptation of Asian Macaque Trimcyp Directs Lineage Specific Antiviral Activity.
pubmed doi rcsb
source organism Human immunodeficiency virus type 2 (isolate d194)
total genus 51
structure length 145
sequence length 145
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-03-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2x82A00
1D1DA 5HGLA 4E92A 5JPAA 1GWPA 3H4EA 2EIAA 4B4NA 4DGEC 3BP9A 4PH0A 2WLVB 5HGMA 2XGUA 2PWMA 4QNBA 3MGEA 4NX4C 2M8NA 2XGYA 2XDEA 2V4XA 4XROA 1EIAA 2KGFA 2PXRC 1QRJA 2PWOA 1L6NA 4WYMA 4PH3A 1M9FC 1P7NA 2LF4A 1M9DC 1M9YC 1E6JP 1EM9A 1AK4C 4XFYA 3H47A 4HTWA 4PH2A 2GONA 4E91A 5HGNA 2Y4ZA 2M8PA 4LQWC 5HGOA 4U0FA 4U0DA 2JPRA 1M9CC 1M9EC 2X83A 1G03A 1AFVA 3NTEA 4XFZA 4INBA 4U0BA 2X2DD 3P05A 4U0CA 4J93A 4U0AA 5HGKA 2X82A 4DGAC 2WLVA 2XGVA 1U7KA 2GOLB 4U0EA 2M8LA 1M9XC 4XRQA 4XFXA
chains in the Genus database with same CATH superfamily
1D1DA 5HGLA 4E92A 5JPAA 1GWPA 3H4EA 2EIAA 4B4NA 4DGEC 3BP9A 4PH0A 2WLVB 5HGMA 2XGUA 2PWMA 4QNBA 3MGEA 4NX4C 2M8NA 2XGYA 2XDEA 2V4XA 4XROA 1EIAA 2KGFA 2PXRC 1QRJA 2PWOA 1L6NA 4WYMA 4PH3A 1M9FC 1P7NA 2LF4A 1M9DC 1M9YC 1E6JP 1EM9A 1AK4C 4XFYA 3H47A 4HTWA 4PH2A 2GONA 4E91A 5HGNA 2Y4ZA 2M8PA 4LQWC 5HGOA 4U0FA 4U0DA 2JPRA 1M9CC 1M9EC 2X83A 1G03A 1AFVA 3NTEA 4XFZA 4INBA 4U0BA 2X2DD 3P05A 4U0CA 4J93A 4U0AA 5HGKA 2X82A 4DGAC 2WLVA 2XGVA 1U7KA 2GOLB 4U0EA 2M8LA 1M9XC 4XRQA 4XFXA
chains in the Genus database with same CATH topology
1D1DA 5HGLA 4E92A 5JPAA 1GWPA 3H4EA 2EIAA 4B4NA 4DGEC 3BP9A 4PH0A 2WLVB 5HGMA 2XGUA 2PWMA 4QNBA 3MGEA 4NX4C 2M8NA 2XGYA 2XDEA 2V4XA 4XROA 1EIAA 2KGFA 2PXRC 1QRJA 2PWOA 1L6NA 4WYMA 4PH3A 1M9FC 1P7NA 2LF4A 1M9DC 1M9YC 1E6JP 1EM9A 1AK4C 4XFYA 3H47A 4HTWA 4PH2A 2GONA 4E91A 5HGNA 2Y4ZA 2M8PA 4LQWC 5HGOA 4U0FA 4U0DA 2JPRA 1M9CC 1M9EC 2X83A 1G03A 1AFVA 3NTEA 4XFZA 4INBA 4U0BA 2X2DD 3P05A 4U0CA 4J93A 4U0AA 5HGKA 2X82A 4DGAC 2WLVA 2XGVA 1U7KA 2GOLB 4U0EA 2M8LA 1M9XC 4XRQA 4XFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1D A;  5HGL A;  4E92 A;  5JPA A;  1GWP A;  3H4E A;  2EIA A;  4B4N A;  4DGE C;  3BP9 A;  4PH0 A;  2WLV B;  5HGM A;  2XGU A;  2PWM A;  4QNB A;  3MGE A;  4NX4 C;  2M8N A;  2XGY A;  2XDE A;  2V4X A;  4XRO A;  1EIA A;  2KGF A;  2PXR C;  1QRJ A;  2PWO A;  1L6N A;  4WYM A;  4PH3 A;  1M9F C;  1P7N A;  2LF4 A;  1M9D C;  1M9Y C;  1E6J P;  1EM9 A;  1AK4 C;  4XFY A;  3H47 A;  4HTW A;  4PH2 A;  2GON A;  4E91 A;  5HGN A;  2Y4Z A;  2M8P A;  4LQW C;  5HGO A;  4U0F A;  4U0D A;  2JPR A;  1M9C C;  1M9E C;  2X83 A;  1G03 A;  1AFV A;  3NTE A;  4XFZ A;  4INB A;  4U0B A;  2X2D D;  3P05 A;  4U0C A;  4J93 A;  4U0A A;  5HGK A;  2X82 A;  4DGA C;  2WLV A;  2XGV A;  1U7K A;  2GOL B;  4U0E A;  2M8L A;  1M9X C;  4XRQ A;  4XFX A; 
#chains in the Genus database with same CATH topology
 1D1D A;  5HGL A;  4E92 A;  5JPA A;  1GWP A;  3H4E A;  2EIA A;  4B4N A;  4DGE C;  3BP9 A;  4PH0 A;  2WLV B;  5HGM A;  2XGU A;  2PWM A;  4QNB A;  3MGE A;  4NX4 C;  2M8N A;  2XGY A;  2XDE A;  2V4X A;  4XRO A;  1EIA A;  2KGF A;  2PXR C;  1QRJ A;  2PWO A;  1L6N A;  4WYM A;  4PH3 A;  1M9F C;  1P7N A;  2LF4 A;  1M9D C;  1M9Y C;  1E6J P;  1EM9 A;  1AK4 C;  4XFY A;  3H47 A;  4HTW A;  4PH2 A;  2GON A;  4E91 A;  5HGN A;  2Y4Z A;  2M8P A;  4LQW C;  5HGO A;  4U0F A;  4U0D A;  2JPR A;  1M9C C;  1M9E C;  2X83 A;  1G03 A;  1AFV A;  3NTE A;  4XFZ A;  4INB A;  4U0B A;  2X2D D;  3P05 A;  4U0C A;  4J93 A;  4U0A A;  5HGK A;  2X82 A;  4DGA C;  2WLV A;  2XGV A;  1U7K A;  2GOL B;  4U0E A;  2M8L A;  1M9X C;  4XRQ A;  4XFX A; 
#chains in the Genus database with same CATH homology
 1D1D A;  5HGL A;  4E92 A;  5JPA A;  1GWP A;  3H4E A;  2EIA A;  4B4N A;  4DGE C;  3BP9 A;  4PH0 A;  2WLV B;  5HGM A;  2XGU A;  2PWM A;  4QNB A;  3MGE A;  4NX4 C;  2M8N A;  2XGY A;  2XDE A;  2V4X A;  4XRO A;  1EIA A;  2KGF A;  2PXR C;  1QRJ A;  2PWO A;  1L6N A;  4WYM A;  4PH3 A;  1M9F C;  1P7N A;  2LF4 A;  1M9D C;  1M9Y C;  1E6J P;  1EM9 A;  1AK4 C;  4XFY A;  3H47 A;  4HTW A;  4PH2 A;  2GON A;  4E91 A;  5HGN A;  2Y4Z A;  2M8P A;  4LQW C;  5HGO A;  4U0F A;  4U0D A;  2JPR A;  1M9C C;  1M9E C;  2X83 A;  1G03 A;  1AFV A;  3NTE A;  4XFZ A;  4INB A;  4U0B A;  2X2D D;  3P05 A;  4U0C A;  4J93 A;  4U0A A;  5HGK A;  2X82 A;  4DGA C;  2WLV A;  2XGV A;  1U7K A;  2GOL B;  4U0E A;  2M8L A;  1M9X C;  4XRQ A;  4XFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...