2PWOA

Crystal structure of hiv-1 ca146 a92e psuedo cell
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
144
structure length
144
Chain Sequence
IVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIEPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein (Pr160Gag-Pol)
publication title Structure of the Antiviral Assembly Inhibitor CAP-1 Complex with the HIV-1 CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 46
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2pwoA00
4QNBA 4U0BA 2KGFA 4J93A 2V4XA 4U0EA 4XFYA 2PXRC 1D1DA 1AK4C 4XRQA 5HGNA 1M9FC 3NTEA 4DGEC 2M8NA 4WYMA 4U0CA 1M9EC 1QRJA 4U0FA 4PH2A 4PH3A 4DGAC 4LQWC 1L6NA 4E92A 2XGYA 2XGUA 5HGKA 4XFZA 4PH0A 5JPAA 2M8LA 3H47A 3MGEA 2GOLB 1EM9A 1E6JP 1AFVA 4HTWA 2X83A 4XROA 4XFXA 2JPRA 2PWMA 2LF4A 1U7KA 3H4EA 5HGLA 4INBA 2WLVA 2WLVB 1P7NA 4U0AA 1M9YC 1M9CC 2PWOA 2GONA 2XGVA 4NX4C 1M9XC 2EIAA 2XDEA 1EIAA 3BP9A 2Y4ZA 1M9DC 1GWPA 5HGOA 5HGMA 3P05A 4U0DA 2M8PA 2X82A 4B4NA 4E91A 2X2DD 1G03A
chains in the Genus database with same CATH superfamily
4QNBA 4U0BA 2KGFA 4J93A 2V4XA 4U0EA 4XFYA 2PXRC 1D1DA 1AK4C 4XRQA 5HGNA 1M9FC 3NTEA 4DGEC 2M8NA 4WYMA 4U0CA 1M9EC 1QRJA 4U0FA 4PH2A 4PH3A 4DGAC 4LQWC 1L6NA 4E92A 2XGYA 2XGUA 5HGKA 4XFZA 4PH0A 5JPAA 2M8LA 3H47A 3MGEA 2GOLB 1EM9A 1E6JP 1AFVA 4HTWA 2X83A 4XROA 4XFXA 2JPRA 2PWMA 2LF4A 1U7KA 3H4EA 5HGLA 4INBA 2WLVA 2WLVB 1P7NA 4U0AA 1M9YC 1M9CC 2PWOA 2GONA 2XGVA 4NX4C 1M9XC 2EIAA 2XDEA 1EIAA 3BP9A 2Y4ZA 1M9DC 1GWPA 5HGOA 5HGMA 3P05A 4U0DA 2M8PA 2X82A 4B4NA 4E91A 2X2DD 1G03A
chains in the Genus database with same CATH topology
4QNBA 4U0BA 2KGFA 4J93A 2V4XA 4U0EA 4XFYA 2PXRC 1D1DA 1AK4C 4XRQA 5HGNA 1M9FC 3NTEA 4DGEC 2M8NA 4WYMA 4U0CA 1M9EC 1QRJA 4U0FA 4PH2A 4PH3A 4DGAC 4LQWC 1L6NA 4E92A 2XGYA 2XGUA 5HGKA 4XFZA 4PH0A 5JPAA 2M8LA 3H47A 3MGEA 2GOLB 1EM9A 1E6JP 1AFVA 4HTWA 2X83A 4XROA 4XFXA 2JPRA 2PWMA 2LF4A 1U7KA 3H4EA 5HGLA 4INBA 2WLVA 2WLVB 1P7NA 4U0AA 1M9YC 1M9CC 2PWOA 2GONA 2XGVA 4NX4C 1M9XC 2EIAA 2XDEA 1EIAA 3BP9A 2Y4ZA 1M9DC 1GWPA 5HGOA 5HGMA 3P05A 4U0DA 2M8PA 2X82A 4B4NA 4E91A 2X2DD 1G03A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNB A;  4U0B A;  2KGF A;  4J93 A;  2V4X A;  4U0E A;  4XFY A;  2PXR C;  1D1D A;  1AK4 C;  4XRQ A;  5HGN A;  1M9F C;  3NTE A;  4DGE C;  2M8N A;  4WYM A;  4U0C A;  1M9E C;  1QRJ A;  4U0F A;  4PH2 A;  4PH3 A;  4DGA C;  4LQW C;  1L6N A;  4E92 A;  2XGY A;  2XGU A;  5HGK A;  4XFZ A;  4PH0 A;  5JPA A;  2M8L A;  3H47 A;  3MGE A;  2GOL B;  1EM9 A;  1E6J P;  1AFV A;  4HTW A;  2X83 A;  4XRO A;  4XFX A;  2JPR A;  2PWM A;  2LF4 A;  1U7K A;  3H4E A;  5HGL A;  4INB A;  2WLV A;  2WLV B;  1P7N A;  4U0A A;  1M9Y C;  1M9C C;  2PWO A;  2GON A;  2XGV A;  4NX4 C;  1M9X C;  2EIA A;  2XDE A;  1EIA A;  3BP9 A;  2Y4Z A;  1M9D C;  1GWP A;  5HGO A;  5HGM A;  3P05 A;  4U0D A;  2M8P A;  2X82 A;  4B4N A;  4E91 A;  2X2D D;  1G03 A; 
#chains in the Genus database with same CATH topology
 4QNB A;  4U0B A;  2KGF A;  4J93 A;  2V4X A;  4U0E A;  4XFY A;  2PXR C;  1D1D A;  1AK4 C;  4XRQ A;  5HGN A;  1M9F C;  3NTE A;  4DGE C;  2M8N A;  4WYM A;  4U0C A;  1M9E C;  1QRJ A;  4U0F A;  4PH2 A;  4PH3 A;  4DGA C;  4LQW C;  1L6N A;  4E92 A;  2XGY A;  2XGU A;  5HGK A;  4XFZ A;  4PH0 A;  5JPA A;  2M8L A;  3H47 A;  3MGE A;  2GOL B;  1EM9 A;  1E6J P;  1AFV A;  4HTW A;  2X83 A;  4XRO A;  4XFX A;  2JPR A;  2PWM A;  2LF4 A;  1U7K A;  3H4E A;  5HGL A;  4INB A;  2WLV A;  2WLV B;  1P7N A;  4U0A A;  1M9Y C;  1M9C C;  2PWO A;  2GON A;  2XGV A;  4NX4 C;  1M9X C;  2EIA A;  2XDE A;  1EIA A;  3BP9 A;  2Y4Z A;  1M9D C;  1GWP A;  5HGO A;  5HGM A;  3P05 A;  4U0D A;  2M8P A;  2X82 A;  4B4N A;  4E91 A;  2X2D D;  1G03 A; 
#chains in the Genus database with same CATH homology
 4QNB A;  4U0B A;  2KGF A;  4J93 A;  2V4X A;  4U0E A;  4XFY A;  2PXR C;  1D1D A;  1AK4 C;  4XRQ A;  5HGN A;  1M9F C;  3NTE A;  4DGE C;  2M8N A;  4WYM A;  4U0C A;  1M9E C;  1QRJ A;  4U0F A;  4PH2 A;  4PH3 A;  4DGA C;  4LQW C;  1L6N A;  4E92 A;  2XGY A;  2XGU A;  5HGK A;  4XFZ A;  4PH0 A;  5JPA A;  2M8L A;  3H47 A;  3MGE A;  2GOL B;  1EM9 A;  1E6J P;  1AFV A;  4HTW A;  2X83 A;  4XRO A;  4XFX A;  2JPR A;  2PWM A;  2LF4 A;  1U7K A;  3H4E A;  5HGL A;  4INB A;  2WLV A;  2WLV B;  1P7N A;  4U0A A;  1M9Y C;  1M9C C;  2PWO A;  2GON A;  2XGV A;  4NX4 C;  1M9X C;  2EIA A;  2XDE A;  1EIA A;  3BP9 A;  2Y4Z A;  1M9D C;  1GWP A;  5HGO A;  5HGM A;  3P05 A;  4U0D A;  2M8P A;  2X82 A;  4B4N A;  4E91 A;  2X2D D;  1G03 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...