2PWOA

Crystal structure of hiv-1 ca146 a92e psuedo cell
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
144
structure length
144
Chain Sequence
IVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIEPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Gag-Pol polyprotein (Pr160Gag-Pol)
publication title Structure of the Antiviral Assembly Inhibitor CAP-1 Complex with the HIV-1 CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 46
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2pwoA00
4PH3A 4DGAC 5HGOA 1U7KA 2GOLB 4XROA 2XGUA 1M9EC 2M8NA 2X2DD 1GWPA 4PH2A 1P7NA 2M8LA 4B4NA 1AK4C 3MGEA 1E6JP 3P05A 2Y4ZA 1M9XC 4E92A 4U0CA 5HGLA 2WLVA 1M9FC 2LF4A 1AFVA 3H47A 5HGKA 5HGNA 2PXRC 2XDEA 2GONA 1EM9A 4QNBA 2JPRA 4U0AA 1L6NA 2WLVB 2XGVA 1EIAA 2X82A 2EIAA 3H4EA 2V4XA 1QRJA 4XFXA 3BP9A 4HTWA 2M8PA 4INBA 5JPAA 2XGYA 4XRQA 4XFYA 4E91A 5HGMA 4LQWC 2X83A 4DGEC 2PWMA 4U0DA 4U0FA 1G03A 3NTEA 4XFZA 1M9DC 4PH0A 4NX4C 1D1DA 2PWOA 1M9CC 4U0EA 4J93A 2KGFA 1M9YC 4WYMA 4U0BA
chains in the Genus database with same CATH superfamily
4PH3A 4DGAC 5HGOA 1U7KA 2GOLB 4XROA 2XGUA 1M9EC 2M8NA 2X2DD 1GWPA 4PH2A 1P7NA 2M8LA 4B4NA 1AK4C 3MGEA 1E6JP 3P05A 2Y4ZA 1M9XC 4E92A 4U0CA 5HGLA 2WLVA 1M9FC 2LF4A 1AFVA 3H47A 5HGKA 5HGNA 2PXRC 2XDEA 2GONA 1EM9A 4QNBA 2JPRA 4U0AA 1L6NA 2WLVB 2XGVA 1EIAA 2X82A 2EIAA 3H4EA 2V4XA 1QRJA 4XFXA 3BP9A 4HTWA 2M8PA 4INBA 5JPAA 2XGYA 4XRQA 4XFYA 4E91A 5HGMA 4LQWC 2X83A 4DGEC 2PWMA 4U0DA 4U0FA 1G03A 3NTEA 4XFZA 1M9DC 4PH0A 4NX4C 1D1DA 2PWOA 1M9CC 4U0EA 4J93A 2KGFA 1M9YC 4WYMA 4U0BA
chains in the Genus database with same CATH topology
4PH3A 4DGAC 5HGOA 1U7KA 2GOLB 4XROA 2XGUA 1M9EC 2M8NA 2X2DD 1GWPA 4PH2A 1P7NA 2M8LA 4B4NA 1AK4C 3MGEA 1E6JP 3P05A 2Y4ZA 1M9XC 4E92A 4U0CA 5HGLA 2WLVA 1M9FC 2LF4A 1AFVA 3H47A 5HGKA 5HGNA 2PXRC 2XDEA 2GONA 1EM9A 4QNBA 2JPRA 4U0AA 1L6NA 2WLVB 2XGVA 1EIAA 2X82A 2EIAA 3H4EA 2V4XA 1QRJA 4XFXA 3BP9A 4HTWA 2M8PA 4INBA 5JPAA 2XGYA 4XRQA 4XFYA 4E91A 5HGMA 4LQWC 2X83A 4DGEC 2PWMA 4U0DA 4U0FA 1G03A 3NTEA 4XFZA 1M9DC 4PH0A 4NX4C 1D1DA 2PWOA 1M9CC 4U0EA 4J93A 2KGFA 1M9YC 4WYMA 4U0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PH3 A;  4DGA C;  5HGO A;  1U7K A;  2GOL B;  4XRO A;  2XGU A;  1M9E C;  2M8N A;  2X2D D;  1GWP A;  4PH2 A;  1P7N A;  2M8L A;  4B4N A;  1AK4 C;  3MGE A;  1E6J P;  3P05 A;  2Y4Z A;  1M9X C;  4E92 A;  4U0C A;  5HGL A;  2WLV A;  1M9F C;  2LF4 A;  1AFV A;  3H47 A;  5HGK A;  5HGN A;  2PXR C;  2XDE A;  2GON A;  1EM9 A;  4QNB A;  2JPR A;  4U0A A;  1L6N A;  2WLV B;  2XGV A;  1EIA A;  2X82 A;  2EIA A;  3H4E A;  2V4X A;  1QRJ A;  4XFX A;  3BP9 A;  4HTW A;  2M8P A;  4INB A;  5JPA A;  2XGY A;  4XRQ A;  4XFY A;  4E91 A;  5HGM A;  4LQW C;  2X83 A;  4DGE C;  2PWM A;  4U0D A;  4U0F A;  1G03 A;  3NTE A;  4XFZ A;  1M9D C;  4PH0 A;  4NX4 C;  1D1D A;  2PWO A;  1M9C C;  4U0E A;  4J93 A;  2KGF A;  1M9Y C;  4WYM A;  4U0B A; 
#chains in the Genus database with same CATH topology
 4PH3 A;  4DGA C;  5HGO A;  1U7K A;  2GOL B;  4XRO A;  2XGU A;  1M9E C;  2M8N A;  2X2D D;  1GWP A;  4PH2 A;  1P7N A;  2M8L A;  4B4N A;  1AK4 C;  3MGE A;  1E6J P;  3P05 A;  2Y4Z A;  1M9X C;  4E92 A;  4U0C A;  5HGL A;  2WLV A;  1M9F C;  2LF4 A;  1AFV A;  3H47 A;  5HGK A;  5HGN A;  2PXR C;  2XDE A;  2GON A;  1EM9 A;  4QNB A;  2JPR A;  4U0A A;  1L6N A;  2WLV B;  2XGV A;  1EIA A;  2X82 A;  2EIA A;  3H4E A;  2V4X A;  1QRJ A;  4XFX A;  3BP9 A;  4HTW A;  2M8P A;  4INB A;  5JPA A;  2XGY A;  4XRQ A;  4XFY A;  4E91 A;  5HGM A;  4LQW C;  2X83 A;  4DGE C;  2PWM A;  4U0D A;  4U0F A;  1G03 A;  3NTE A;  4XFZ A;  1M9D C;  4PH0 A;  4NX4 C;  1D1D A;  2PWO A;  1M9C C;  4U0E A;  4J93 A;  2KGF A;  1M9Y C;  4WYM A;  4U0B A; 
#chains in the Genus database with same CATH homology
 4PH3 A;  4DGA C;  5HGO A;  1U7K A;  2GOL B;  4XRO A;  2XGU A;  1M9E C;  2M8N A;  2X2D D;  1GWP A;  4PH2 A;  1P7N A;  2M8L A;  4B4N A;  1AK4 C;  3MGE A;  1E6J P;  3P05 A;  2Y4Z A;  1M9X C;  4E92 A;  4U0C A;  5HGL A;  2WLV A;  1M9F C;  2LF4 A;  1AFV A;  3H47 A;  5HGK A;  5HGN A;  2PXR C;  2XDE A;  2GON A;  1EM9 A;  4QNB A;  2JPR A;  4U0A A;  1L6N A;  2WLV B;  2XGV A;  1EIA A;  2X82 A;  2EIA A;  3H4E A;  2V4X A;  1QRJ A;  4XFX A;  3BP9 A;  4HTW A;  2M8P A;  4INB A;  5JPA A;  2XGY A;  4XRQ A;  4XFY A;  4E91 A;  5HGM A;  4LQW C;  2X83 A;  4DGE C;  2PWM A;  4U0D A;  4U0F A;  1G03 A;  3NTE A;  4XFZ A;  1M9D C;  4PH0 A;  4NX4 C;  1D1D A;  2PWO A;  1M9C C;  4U0E A;  4J93 A;  2KGF A;  1M9Y C;  4WYM A;  4U0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...