2PWOA

Crystal structure of hiv-1 ca146 a92e psuedo cell
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
144
structure length
144
Chain Sequence
b'IVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIEPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein (Pr160Gag-Pol)
publication title Structure of the Antiviral Assembly Inhibitor CAP-1 Complex with the HIV-1 CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 46
structure length 144
sequence length 144
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2pwoA00
1E6JP 2X2DD 1G03A 2GONA 4PH3A 2WLVA 4U0EA 1AK4C 4HTWA 4XFYA 1M9CC 2M8LA 2XGVA 2PWMA 1D1DA 1EM9A 3P05A 4LQWC 4DGAC 4XFZA 2Y4ZA 2PXRC 2PWOA 3MGEA 4QNBA 1L6NA 2LF4A 4XFXA 4DGEC 2GOLB 4U0FA 4NX4C 4PH2A 5JPAA 2X83A 1U7KA 5HGMA 5HGLA 5HGKA 1P7NA 4INBA 4U0AA 1M9EC 2M8NA 2KGFA 4B4NA 2XDEA 4XROA 3NTEA 1AFVA 2EIAA 1GWPA 1M9YC 4J93A 2XGUA 1M9FC 4U0DA 4U0BA 2V4XA 3BP9A 1QRJA 2WLVB 2M8PA 4PH0A 2XGYA 3H47A 4XRQA 2JPRA 4E92A 5HGOA 4E91A 2X82A 5HGNA 1M9XC 4WYMA 4U0CA 1EIAA 3H4EA 1M9DC
chains in the Genus database with same CATH superfamily
1E6JP 2X2DD 1G03A 2GONA 4PH3A 2WLVA 4U0EA 1AK4C 4HTWA 4XFYA 1M9CC 2M8LA 2XGVA 2PWMA 1D1DA 1EM9A 3P05A 4LQWC 4DGAC 4XFZA 2Y4ZA 2PXRC 2PWOA 3MGEA 4QNBA 1L6NA 2LF4A 4XFXA 4DGEC 2GOLB 4U0FA 4NX4C 4PH2A 5JPAA 2X83A 1U7KA 5HGMA 5HGLA 5HGKA 1P7NA 4INBA 4U0AA 1M9EC 2M8NA 2KGFA 4B4NA 2XDEA 4XROA 3NTEA 1AFVA 2EIAA 1GWPA 1M9YC 4J93A 2XGUA 1M9FC 4U0DA 4U0BA 2V4XA 3BP9A 1QRJA 2WLVB 2M8PA 4PH0A 2XGYA 3H47A 4XRQA 2JPRA 4E92A 5HGOA 4E91A 2X82A 5HGNA 1M9XC 4WYMA 4U0CA 1EIAA 3H4EA 1M9DC
chains in the Genus database with same CATH topology
1E6JP 2X2DD 1G03A 2GONA 4PH3A 2WLVA 4U0EA 1AK4C 4HTWA 4XFYA 1M9CC 2M8LA 2XGVA 2PWMA 1D1DA 1EM9A 3P05A 4LQWC 4DGAC 4XFZA 2Y4ZA 2PXRC 2PWOA 3MGEA 4QNBA 1L6NA 2LF4A 4XFXA 4DGEC 2GOLB 4U0FA 4NX4C 4PH2A 5JPAA 2X83A 1U7KA 5HGMA 5HGLA 5HGKA 1P7NA 4INBA 4U0AA 1M9EC 2M8NA 2KGFA 4B4NA 2XDEA 4XROA 3NTEA 1AFVA 2EIAA 1GWPA 1M9YC 4J93A 2XGUA 1M9FC 4U0DA 4U0BA 2V4XA 3BP9A 1QRJA 2WLVB 2M8PA 4PH0A 2XGYA 3H47A 4XRQA 2JPRA 4E92A 5HGOA 4E91A 2X82A 5HGNA 1M9XC 4WYMA 4U0CA 1EIAA 3H4EA 1M9DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6J P;  2X2D D;  1G03 A;  2GON A;  4PH3 A;  2WLV A;  4U0E A;  1AK4 C;  4HTW A;  4XFY A;  1M9C C;  2M8L A;  2XGV A;  2PWM A;  1D1D A;  1EM9 A;  3P05 A;  4LQW C;  4DGA C;  4XFZ A;  2Y4Z A;  2PXR C;  2PWO A;  3MGE A;  4QNB A;  1L6N A;  2LF4 A;  4XFX A;  4DGE C;  2GOL B;  4U0F A;  4NX4 C;  4PH2 A;  5JPA A;  2X83 A;  1U7K A;  5HGM A;  5HGL A;  5HGK A;  1P7N A;  4INB A;  4U0A A;  1M9E C;  2M8N A;  2KGF A;  4B4N A;  2XDE A;  4XRO A;  3NTE A;  1AFV A;  2EIA A;  1GWP A;  1M9Y C;  4J93 A;  2XGU A;  1M9F C;  4U0D A;  4U0B A;  2V4X A;  3BP9 A;  1QRJ A;  2WLV B;  2M8P A;  4PH0 A;  2XGY A;  3H47 A;  4XRQ A;  2JPR A;  4E92 A;  5HGO A;  4E91 A;  2X82 A;  5HGN A;  1M9X C;  4WYM A;  4U0C A;  1EIA A;  3H4E A;  1M9D C; 
#chains in the Genus database with same CATH topology
 1E6J P;  2X2D D;  1G03 A;  2GON A;  4PH3 A;  2WLV A;  4U0E A;  1AK4 C;  4HTW A;  4XFY A;  1M9C C;  2M8L A;  2XGV A;  2PWM A;  1D1D A;  1EM9 A;  3P05 A;  4LQW C;  4DGA C;  4XFZ A;  2Y4Z A;  2PXR C;  2PWO A;  3MGE A;  4QNB A;  1L6N A;  2LF4 A;  4XFX A;  4DGE C;  2GOL B;  4U0F A;  4NX4 C;  4PH2 A;  5JPA A;  2X83 A;  1U7K A;  5HGM A;  5HGL A;  5HGK A;  1P7N A;  4INB A;  4U0A A;  1M9E C;  2M8N A;  2KGF A;  4B4N A;  2XDE A;  4XRO A;  3NTE A;  1AFV A;  2EIA A;  1GWP A;  1M9Y C;  4J93 A;  2XGU A;  1M9F C;  4U0D A;  4U0B A;  2V4X A;  3BP9 A;  1QRJ A;  2WLV B;  2M8P A;  4PH0 A;  2XGY A;  3H47 A;  4XRQ A;  2JPR A;  4E92 A;  5HGO A;  4E91 A;  2X82 A;  5HGN A;  1M9X C;  4WYM A;  4U0C A;  1EIA A;  3H4E A;  1M9D C; 
#chains in the Genus database with same CATH homology
 1E6J P;  2X2D D;  1G03 A;  2GON A;  4PH3 A;  2WLV A;  4U0E A;  1AK4 C;  4HTW A;  4XFY A;  1M9C C;  2M8L A;  2XGV A;  2PWM A;  1D1D A;  1EM9 A;  3P05 A;  4LQW C;  4DGA C;  4XFZ A;  2Y4Z A;  2PXR C;  2PWO A;  3MGE A;  4QNB A;  1L6N A;  2LF4 A;  4XFX A;  4DGE C;  2GOL B;  4U0F A;  4NX4 C;  4PH2 A;  5JPA A;  2X83 A;  1U7K A;  5HGM A;  5HGL A;  5HGK A;  1P7N A;  4INB A;  4U0A A;  1M9E C;  2M8N A;  2KGF A;  4B4N A;  2XDE A;  4XRO A;  3NTE A;  1AFV A;  2EIA A;  1GWP A;  1M9Y C;  4J93 A;  2XGU A;  1M9F C;  4U0D A;  4U0B A;  2V4X A;  3BP9 A;  1QRJ A;  2WLV B;  2M8P A;  4PH0 A;  2XGY A;  3H47 A;  4XRQ A;  2JPR A;  4E92 A;  5HGO A;  4E91 A;  2X82 A;  5HGN A;  1M9X C;  4WYM A;  4U0C A;  1EIA A;  3H4E A;  1M9D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...