4U0EA

Hexameric hiv-1 ca in complex with pf3450074
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
209
Chain Sequence
b'PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQETETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 73
structure length 209
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0eA02
1EM9A 4PH2A 4PH0A 1M9XC 4B4NA 3LRYA 1M9FC 1D1DA 3DS5A 1M9CC 3BP9A 1P7NA 2ONTA 4XFYA 3DS0A 5HGNA 2PXRC 5I4TG 4PH3A 5DCKA 1EIAA 3G26A 1GWPA 2JYGA 2JO0A 5HGMA 3G1IA 2JPRA 2KGFA 2BUOA 2X83A 2XDEA 2LF4A 1QRJA 3NTEA 4U0CA 4U0EA 5HGOA 2Y4ZA 2XGYA 2V4XA 2GOLB 4NX4C 4U0FA 2KODA 5JPAA 3VRLC 4HTWA 4XFZA 4DGEC 4COPA 4INBA 1AFVA 2XV6A 1A43A 1EOQA 3DS1A 1L6NA 1AUMA 2X2DD 4DGAC 2WLVA 4XROA 2XGVA 1AK4C 3P05A 4XFXA 3G28A 1M9DC 3H4EA 3DPHA 2PWMA 2WLVB 4LQWC 1BAJA 4E91A 2XT1A 1M9YC 3G0VA 3MGEA 4PH1A 4M0IA 3G21A 4J93A 4U0AA 2L6EA 1G03A 1U7KA 1A8OA 4IPYA 2XXMA 4U0BA 2JYLA 2M8LA 3G29A 3DTJA 2M8PA 4U0DA 5HGLA 4QNBA 4COCA 4WYMA 4E92A 3DS2A 2XGUA 3DS3A 2M8NA 2EIAA 4XRQA 5HGKA 3G1GA 3DS4A 2X82A 3H47A 2PWOA 1M9EC 1E6JP 2GONA
chains in the Genus database with same CATH superfamily
1EM9A 4PH2A 1L0IA 4B4NA 2QEXP 1M9FC 2K92A 3DS5A 2OTJP 1ACPA 2FVEA 5I4TG 4PH3A 4IZ6A 4PXHB 2DGYA 1GWPA 2JO0A 3CMAP 3G1IA 2JU1A 3NY7B 2JPRA 1GXGA 2OARA 1K30A 3B4QA 2LF4A 3GZLA 2GDYA 2K5XA 3GZMA 5HGOA 2N50A 1IUQA 2XGYA 2V4XA 4NX4C 2GDWA 2AFEA 1Q7YQ 5JPAA 1K73Q 1K9MQ 2N5HA 2EHSA 3CCRP 1VHNA 4HTWA 2MR7A 2PEMA 2GZGA 4COPA 2KGAA 5EW5E 3CCQP 1EOQA 3DS1A 4MRTC 2LIUA 1VQNP 4XROA 3G28A 3H4EA 4BPFA 7CEIA 3G6EP 2WLVB 2PEQA 1KQSO 2MD9A 2AVAA 2LMLA 5KP6B 3HZQA 3G0VA 3MGEA 2KG8A 2KOPA 2MR8A 4U0AA 1F80D 2L6EA 1M6NA 1G03A 2MVVA 4U0BA 3EJDA 1YITP 2M8PA 4U0DA 3CCEP 5HGLA 2MY5A 2K94A 3OW2O 3DS3A 2PEOA 5HGKA 1YJWP 2X82A 3CC7P 2JAZA 3WBHA 2P9XA 2GONA 3CCVP 5F2OA 3RG2A 1S72P 1NJIQ 4PWVB 1M9CC 1YIJP 4XFYA 2ROQA 4QKOA 5EJDA 4H2YC 1W2BO 5HGNA 2KWLA 3GJNA 4R0MA 2NO8A 3G26A 2JYGA 3RG6C 2PENA 1KC8Q 2BUOA 2VLPA 2E1MA 2BHVA 2Y4ZA 2Z46A 2FVAA 2EHTA 2K2QA 2CQ8A 3CCLP 2JGPA 3CCSP 3VRLC 1VQ4P 3CCMP 2KGDA 1AFVA 2XV6A 1K8AQ 1A43A 2K93A 3H0DA 1AUMA 1RNIA 2QNWA 4DGAC 2LIWA 1NQ4A 1AK4C 2FAEA 1M9DC 2KOOA 2VLQA 2GZIA 2FQ1A 1VQLP 4BPGA 1BAJA 4H2XC 1M6EX 2XT1A 1M9YC 2N98A 4PH1A 3G21A 1VQ6P 2N6YA 3CCJP 3I55P 1U7KA 4IPYA 2JYLA 3G29A 1YHQP 2K0DX 4H2WC 2PEIA 5F2KA 3U43A 4COCA 2M5RA 3G71P 2VSQA 3DS2A 2XGUA 3GKLC 1E0HA 2M8NA 5KP7B 2ERHA 3CMEP 1M90Q 1OR5A 2GYKA 1M9EC 2JBGA 3B5IA 2WPTA 1E6JP 1VQ7P 1D1DA 1KD1Q 2GZJA 1ZMBA 3CE7A 3BP9A 3DS0A 4NEOA 2DNWA 2FACA 3I56P 2KR5A 5F2NA 2L22A 1GPJA 2LOLA 2LTEA 2QA4P 1HY8A 1UNKA 1QRJA 2LL8A 1YJNP 3NTEA 4U0CA 4U0EA 2KW2A 2EFJA 2GOLB 2FVFA 2X2BA 4U0FA 2KODA 2KG9A 2KOSA 2FHSC 4DGEC 1VKUA 3M1MA 3CD6P 1VQ5P 2LKIA 1Z6MA 2X2DD 1VQ8P 2XGVA 4XFXA 1VQPP 5HV8A 5BS1A 3DPHA 2PWMA 2MF4A 1IMPA 5BS2A 4LQWC 1DNYA 4E91A 3CPWO 4F37A 2FADA 2KGCA 1FR2A 5HVCA 2CNRA 3G4SP 4BPHA 2VLNA 4M0IA 2OTLP 4J93A 2K0XA 1YI2P 2PY8A 1X3OA 2Z44A 2MVUA 3DTJA 2GZEA 2L9FA 2JU2A 4WYMA 4E92A 2AF8A 3CXCO 2FQ0A 2PNGA 4XRQA 1HQBA 3G1GA 2N5IA 1RO2A 3EJBA 4CA3A 1BXIA 4PH0A 1M9XC 3LRYA 1VQOP 2CWOA 2EG5A 2ONTA 1P7NA 1N8RQ 3Q20A 2LPKA 2KG6A 2PEKA 2PXRC 5DCKA 2XZ1C 1EIAA 5HGMA 2L4BA 1DV5A 1Q81Q 1ZNVA 2KGFA 1IMQA 1Q82Q 1Q86Q 2X83A 2XDEA 2CGQA 1YJ9P 1QVFO 2FQ2A 1QVGO 2JQ4A 3LMOA 3CCUP 1AF8A 2KOQA 1CEIA 4DG9A 2PEJA 4XFZA 1M74A 2GZFA 1EMVA 4INBA 4UHPB 1L6NA 3CC4P 2WLVA 4GR6A 3P05A 4GR2A 5CZDB 2JB0A 1T8KA 2KORA 1GXHA 1M1KQ 2K0YA 1JJ2O 3HYBA 1MZ8A 2AFDA 2XZ0D 2GDXA 2VLOA 1A8OA 2XXMA 2N6ZA 1VQ9P 2M8LA 1AYIA 4QNBA 1RO0A 2KGEA 1L0HA 1VQKP 4HKGA 2EIAA 3CC2P 3EJEA 3DS4A 2CG5B 3H47A 2Z45A 1VQMP 3E2DA 2PWOA 1KLPA 1UJZA 5KP8B 2L0QA
chains in the Genus database with same CATH topology
1EM9A 4PH2A 4PH0A 1VQ7P 3CCVP 1M9XC 5F2OA 4B4NA 3LRYA 1S72P 1NJIQ 1VQOP 2QEXP 1M9FC 1D1DA 2CWOA 1KD1Q 1ZMBA 3DS5A 2EG5A 1M9CC 3BP9A 1P7NA 2ONTA 1YIJP 4XFYA 1N8RQ 2OTJP 3DS0A 3Q20A 3I56P 2PEKA 1W2BO 5HGNA 2PXRC 5I4TG 4PH3A 5DCKA 5F2NA 1EIAA 3G26A 2DGYA 1GWPA 2JYGA 2JO0A 5HGMA 3CMAP 3G1IA 1Q81Q 2JPRA 2KGFA 3RG6C 2QA4P 2PENA 1Q82Q 1Q86Q 1KC8Q 2BUOA 2X83A 2XDEA 2OARA 1YJ9P 1QVFO 2E1MA 1K30A 2LF4A 1QRJA 1QVGO 1YJNP 3NTEA 4U0CA 4U0EA 5HGOA 2BHVA 2Y4ZA 2Z46A 2EFJA 1IUQA 2XGYA 2V4XA 2GOLB 4NX4C 3CCUP 4U0FA 1Q7YQ 2KODA 5JPAA 1K73Q 3CCLP 1K9MQ 3CCSP 3CCRP 3VRLC 4HTWA 2PEMA 2PEJA 4XFZA 1VQ4P 1M74A 4DGEC 3CCMP 4COPA 4INBA 3M1MA 1AFVA 2XV6A 3CCQP 1A43A 1EOQA 3DS1A 1VQ5P 1K8AQ 3H0DA 3CD6P 1L6NA 1AUMA 1RNIA 2X2DD 4DGAC 1VQ8P 3CC4P 1VQNP 2WLVA 4XROA 4GR6A 2XGVA 1AK4C 3P05A 4XFXA 1VQPP 3G28A 1M9DC 3H4EA 4GR2A 5BS1A 3DPHA 2PWMA 3G6EP 2WLVB 2PEQA 5BS2A 4LQWC 1KQSO 1M1KQ 1VQLP 1BAJA 1JJ2O 4E91A 1M6EX 3HZQA 3CPWO 2XT1A 1M9YC 3HYBA 3G0VA 3MGEA 3G4SP 4PH1A 4M0IA 3G21A 2OTLP 4J93A 1VQ6P 1YI2P 3CCJP 4U0AA 3I55P 2L6EA 2PY8A 1M6NA 1G03A 1U7KA 1A8OA 2Z44A 2XXMA 4U0BA 4IPYA 2JYLA 1VQ9P 2M8LA 1YITP 3G29A 3DTJA 2M8PA 4U0DA 1YHQP 3CCEP 2PEIA 5HGLA 4QNBA 1RO0A 5F2KA 4WYMA 4COCA 3G71P 4E92A 3DS2A 2XGUA 3OW2O 3DS3A 3CXCO 2PEOA 1VQKP 2M8NA 2EIAA 4XRQA 3CC2P 1M90Q 3CMEP 5HGKA 3G1GA 3DS4A 2X82A 1YJWP 1RO2A 3H47A 2Z45A 1VQMP 3E2DA 2PWOA 3CC7P 1M9EC 3B5IA 3WBHA 1E6JP 2P9XA 2GONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EM9 A;  4PH2 A;  4PH0 A;  1M9X C;  4B4N A;  3LRY A;  1M9F C;  1D1D A;  3DS5 A;  1M9C C;  3BP9 A;  1P7N A;  2ONT A;  4XFY A;  3DS0 A;  5HGN A;  2PXR C;  5I4T G;  4PH3 A;  5DCK A;  1EIA A;  3G26 A;  1GWP A;  2JYG A;  2JO0 A;  5HGM A;  3G1I A;  2JPR A;  2KGF A;  2BUO A;  2X83 A;  2XDE A;  2LF4 A;  1QRJ A;  3NTE A;  4U0C A;  4U0E A;  5HGO A;  2Y4Z A;  2XGY A;  2V4X A;  2GOL B;  4NX4 C;  4U0F A;  2KOD A;  5JPA A;  3VRL C;  4HTW A;  4XFZ A;  4DGE C;  4COP A;  4INB A;  1AFV A;  2XV6 A;  1A43 A;  1EOQ A;  3DS1 A;  1L6N A;  1AUM A;  2X2D D;  4DGA C;  2WLV A;  4XRO A;  2XGV A;  1AK4 C;  3P05 A;  4XFX A;  3G28 A;  1M9D C;  3H4E A;  3DPH A;  2PWM A;  2WLV B;  4LQW C;  1BAJ A;  4E91 A;  2XT1 A;  1M9Y C;  3G0V A;  3MGE A;  4PH1 A;  4M0I A;  3G21 A;  4J93 A;  4U0A A;  2L6E A;  1G03 A;  1U7K A;  1A8O A;  4IPY A;  2XXM A;  4U0B A;  2JYL A;  2M8L A;  3G29 A;  3DTJ A;  2M8P A;  4U0D A;  5HGL A;  4QNB A;  4COC A;  4WYM A;  4E92 A;  3DS2 A;  2XGU A;  3DS3 A;  2M8N A;  2EIA A;  4XRQ A;  5HGK A;  3G1G A;  3DS4 A;  2X82 A;  3H47 A;  2PWO A;  1M9E C;  1E6J P;  2GON A; 
#chains in the Genus database with same CATH topology
 1EM9 A;  4PH2 A;  1L0I A;  4B4N A;  2QEX P;  1M9F C;  2K92 A;  3DS5 A;  2OTJ P;  1ACP A;  2FVE A;  5I4T G;  4PH3 A;  4IZ6 A;  4PXH B;  2DGY A;  1GWP A;  2JO0 A;  3CMA P;  3G1I A;  2JU1 A;  3NY7 B;  2JPR A;  1GXG A;  2OAR A;  1K30 A;  3B4Q A;  2LF4 A;  3GZL A;  2GDY A;  2K5X A;  3GZM A;  5HGO A;  2N50 A;  1IUQ A;  2XGY A;  2V4X A;  4NX4 C;  2GDW A;  2AFE A;  1Q7Y Q;  5JPA A;  1K73 Q;  1K9M Q;  2N5H A;  2EHS A;  3CCR P;  1VHN A;  4HTW A;  2MR7 A;  2PEM A;  2GZG A;  4COP A;  2KGA A;  5EW5 E;  3CCQ P;  1EOQ A;  3DS1 A;  4MRT C;  2LIU A;  1VQN P;  4XRO A;  3G28 A;  3H4E A;  4BPF A;  7CEI A;  3G6E P;  2WLV B;  2PEQ A;  1KQS O;  2MD9 A;  2AVA A;  2LML A;  5KP6 B;  3HZQ A;  3G0V A;  3MGE A;  2KG8 A;  2KOP A;  2MR8 A;  4U0A A;  1F80 D;  2L6E A;  1M6N A;  1G03 A;  2MVV A;  4U0B A;  3EJD A;  1YIT P;  2M8P A;  4U0D A;  3CCE P;  5HGL A;  2MY5 A;  2K94 A;  3OW2 O;  3DS3 A;  2PEO A;  5HGK A;  1YJW P;  2X82 A;  3CC7 P;  2JAZ A;  3WBH A;  2P9X A;  2GON A;  3CCV P;  5F2O A;  3RG2 A;  1S72 P;  1NJI Q;  4PWV B;  1M9C C;  1YIJ P;  4XFY A;  2ROQ A;  4QKO A;  5EJD A;  4H2Y C;  1W2B O;  5HGN A;  2KWL A;  3GJN A;  4R0M A;  2NO8 A;  3G26 A;  2JYG A;  3RG6 C;  2PEN A;  1KC8 Q;  2BUO A;  2VLP A;  2E1M A;  2BHV A;  2Y4Z A;  2Z46 A;  2FVA A;  2EHT A;  2K2Q A;  2CQ8 A;  3CCL P;  2JGP A;  3CCS P;  3VRL C;  1VQ4 P;  3CCM P;  2KGD A;  1AFV A;  2XV6 A;  1K8A Q;  1A43 A;  2K93 A;  3H0D A;  1AUM A;  1RNI A;  2QNW A;  4DGA C;  2LIW A;  1NQ4 A;  1AK4 C;  2FAE A;  1M9D C;  2KOO A;  2VLQ A;  2GZI A;  2FQ1 A;  1VQL P;  4BPG A;  1BAJ A;  4H2X C;  1M6E X;  2XT1 A;  1M9Y C;  2N98 A;  4PH1 A;  3G21 A;  1VQ6 P;  2N6Y A;  3CCJ P;  3I55 P;  1U7K A;  4IPY A;  2JYL A;  3G29 A;  1YHQ P;  2K0D X;  4H2W C;  2PEI A;  5F2K A;  3U43 A;  4COC A;  2M5R A;  3G71 P;  2VSQ A;  3DS2 A;  2XGU A;  3GKL C;  1E0H A;  2M8N A;  5KP7 B;  2ERH A;  3CME P;  1M90 Q;  1OR5 A;  2GYK A;  1M9E C;  2JBG A;  3B5I A;  2WPT A;  1E6J P;  1VQ7 P;  1D1D A;  1KD1 Q;  2GZJ A;  1ZMB A;  3CE7 A;  3BP9 A;  3DS0 A;  4NEO A;  2DNW A;  2FAC A;  3I56 P;  2KR5 A;  5F2N A;  2L22 A;  1GPJ A;  2LOL A;  2LTE A;  2QA4 P;  1HY8 A;  1UNK A;  1QRJ A;  2LL8 A;  1YJN P;  3NTE A;  4U0C A;  4U0E A;  2KW2 A;  2EFJ A;  2GOL B;  2FVF A;  2X2B A;  4U0F A;  2KOD A;  2KG9 A;  2KOS A;  2FHS C;  4DGE C;  1VKU A;  3M1M A;  3CD6 P;  1VQ5 P;  2LKI A;  1Z6M A;  2X2D D;  1VQ8 P;  2XGV A;  4XFX A;  1VQP P;  5HV8 A;  5BS1 A;  3DPH A;  2PWM A;  2MF4 A;  1IMP A;  5BS2 A;  4LQW C;  1DNY A;  4E91 A;  3CPW O;  4F37 A;  2FAD A;  2KGC A;  1FR2 A;  5HVC A;  2CNR A;  3G4S P;  4BPH A;  2VLN A;  4M0I A;  2OTL P;  4J93 A;  2K0X A;  1YI2 P;  2PY8 A;  1X3O A;  2Z44 A;  2MVU A;  3DTJ A;  2GZE A;  2L9F A;  2JU2 A;  4WYM A;  4E92 A;  2AF8 A;  3CXC O;  2FQ0 A;  2PNG A;  4XRQ A;  1HQB A;  3G1G A;  2N5I A;  1RO2 A;  3EJB A;  4CA3 A;  1BXI A;  4PH0 A;  1M9X C;  3LRY A;  1VQO P;  2CWO A;  2EG5 A;  2ONT A;  1P7N A;  1N8R Q;  3Q20 A;  2LPK A;  2KG6 A;  2PEK A;  2PXR C;  5DCK A;  2XZ1 C;  1EIA A;  5HGM A;  2L4B A;  1DV5 A;  1Q81 Q;  1ZNV A;  2KGF A;  1IMQ A;  1Q82 Q;  1Q86 Q;  2X83 A;  2XDE A;  2CGQ A;  1YJ9 P;  1QVF O;  2FQ2 A;  1QVG O;  2JQ4 A;  3LMO A;  3CCU P;  1AF8 A;  2KOQ A;  1CEI A;  4DG9 A;  2PEJ A;  4XFZ A;  1M74 A;  2GZF A;  1EMV A;  4INB A;  4UHP B;  1L6N A;  3CC4 P;  2WLV A;  4GR6 A;  3P05 A;  4GR2 A;  5CZD B;  2JB0 A;  1T8K A;  2KOR A;  1GXH A;  1M1K Q;  2K0Y A;  1JJ2 O;  3HYB A;  1MZ8 A;  2AFD A;  2XZ0 D;  2GDX A;  2VLO A;  1A8O A;  2XXM A;  2N6Z A;  1VQ9 P;  2M8L A;  1AYI A;  4QNB A;  1RO0 A;  2KGE A;  1L0H A;  1VQK P;  4HKG A;  2EIA A;  3CC2 P;  3EJE A;  3DS4 A;  2CG5 B;  3H47 A;  2Z45 A;  1VQM P;  3E2D A;  2PWO A;  1KLP A;  1UJZ A;  5KP8 B;  2L0Q A; 
#chains in the Genus database with same CATH homology
 1EM9 A;  4PH2 A;  4PH0 A;  1VQ7 P;  3CCV P;  1M9X C;  5F2O A;  4B4N A;  3LRY A;  1S72 P;  1NJI Q;  1VQO P;  2QEX P;  1M9F C;  1D1D A;  2CWO A;  1KD1 Q;  1ZMB A;  3DS5 A;  2EG5 A;  1M9C C;  3BP9 A;  1P7N A;  2ONT A;  1YIJ P;  4XFY A;  1N8R Q;  2OTJ P;  3DS0 A;  3Q20 A;  3I56 P;  2PEK A;  1W2B O;  5HGN A;  2PXR C;  5I4T G;  4PH3 A;  5DCK A;  5F2N A;  1EIA A;  3G26 A;  2DGY A;  1GWP A;  2JYG A;  2JO0 A;  5HGM A;  3CMA P;  3G1I A;  1Q81 Q;  2JPR A;  2KGF A;  3RG6 C;  2QA4 P;  2PEN A;  1Q82 Q;  1Q86 Q;  1KC8 Q;  2BUO A;  2X83 A;  2XDE A;  2OAR A;  1YJ9 P;  1QVF O;  2E1M A;  1K30 A;  2LF4 A;  1QRJ A;  1QVG O;  1YJN P;  3NTE A;  4U0C A;  4U0E A;  5HGO A;  2BHV A;  2Y4Z A;  2Z46 A;  2EFJ A;  1IUQ A;  2XGY A;  2V4X A;  2GOL B;  4NX4 C;  3CCU P;  4U0F A;  1Q7Y Q;  2KOD A;  5JPA A;  1K73 Q;  3CCL P;  1K9M Q;  3CCS P;  3CCR P;  3VRL C;  4HTW A;  2PEM A;  2PEJ A;  4XFZ A;  1VQ4 P;  1M74 A;  4DGE C;  3CCM P;  4COP A;  4INB A;  3M1M A;  1AFV A;  2XV6 A;  3CCQ P;  1A43 A;  1EOQ A;  3DS1 A;  1VQ5 P;  1K8A Q;  3H0D A;  3CD6 P;  1L6N A;  1AUM A;  1RNI A;  2X2D D;  4DGA C;  1VQ8 P;  3CC4 P;  1VQN P;  2WLV A;  4XRO A;  4GR6 A;  2XGV A;  1AK4 C;  3P05 A;  4XFX A;  1VQP P;  3G28 A;  1M9D C;  3H4E A;  4GR2 A;  5BS1 A;  3DPH A;  2PWM A;  3G6E P;  2WLV B;  2PEQ A;  5BS2 A;  4LQW C;  1KQS O;  1M1K Q;  1VQL P;  1BAJ A;  1JJ2 O;  4E91 A;  1M6E X;  3HZQ A;  3CPW O;  2XT1 A;  1M9Y C;  3HYB A;  3G0V A;  3MGE A;  3G4S P;  4PH1 A;  4M0I A;  3G21 A;  2OTL P;  4J93 A;  1VQ6 P;  1YI2 P;  3CCJ P;  4U0A A;  3I55 P;  2L6E A;  2PY8 A;  1M6N A;  1G03 A;  1U7K A;  1A8O A;  2Z44 A;  2XXM A;  4U0B A;  4IPY A;  2JYL A;  1VQ9 P;  2M8L A;  1YIT P;  3G29 A;  3DTJ A;  2M8P A;  4U0D A;  1YHQ P;  3CCE P;  2PEI A;  5HGL A;  4QNB A;  1RO0 A;  5F2K A;  4WYM A;  4COC A;  3G71 P;  4E92 A;  3DS2 A;  2XGU A;  3OW2 O;  3DS3 A;  3CXC O;  2PEO A;  1VQK P;  2M8N A;  2EIA A;  4XRQ A;  3CC2 P;  1M90 Q;  3CME P;  5HGK A;  3G1G A;  3DS4 A;  2X82 A;  1YJW P;  1RO2 A;  3H47 A;  2Z45 A;  1VQM P;  3E2D A;  2PWO A;  3CC7 P;  1M9E C;  3B5I A;  3WBH A;  1E6J P;  2P9X A;  2GON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...