4U0EA

Hexameric hiv-1 ca in complex with pf3450074
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
209
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQETETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 73
structure length 209
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0eA02
2XXMA 2X83A 4U0CA 5HGKA 2WLVB 3DS5A 3NTEA 5HGNA 2WLVA 3DS2A 3DS0A 2X2DD 3G26A 4J93A 4XFXA 2PXRC 4DGAC 1BAJA 2PWMA 3LRYA 2BUOA 2Y4ZA 2M8LA 1M9EC 5DCKA 4IPYA 4U0AA 3DPHA 2XGVA 3G28A 1L6NA 1GWPA 5JPAA 4PH0A 4XFZA 4COPA 3G0VA 2JYLA 2XGYA 2M8PA 3DS3A 2LF4A 2JO0A 3VRLC 3P05A 1AUMA 2JYGA 2XV6A 3DS4A 1M9DC 1EOQA 3G1IA 5HGLA 1M9CC 2EIAA 2GOLB 4DGEC 1EIAA 1EM9A 1A43A 4PH2A 4NX4C 1G03A 1A8OA 2GONA 4U0FA 1QRJA 4U0EA 4PH1A 4B4NA 2KGFA 5I4TG 2ONTA 4PH3A 4XFYA 3H47A 4XRQA 1U7KA 3G21A 4LQWC 3DTJA 2V4XA 2XGUA 2XT1A 1M9XC 3G1GA 2M8NA 4HTWA 4WYMA 4E92A 4QNBA 4INBA 4XROA 4COCA 3BP9A 1AFVA 1D1DA 1M9FC 2PWOA 2L6EA 1M9YC 3G29A 2X82A 2KODA 1AK4C 4M0IA 1E6JP 3MGEA 1P7NA 3H4EA 2JPRA 2XDEA 4U0BA 3DS1A 5HGOA 4U0DA 5HGMA 4E91A
chains in the Genus database with same CATH superfamily
2K92A 1DNYA 1YIJP 3DS0A 1AYIA 1KC8Q 2K2QA 2XZ1C 1ZMBA 2LIWA 1K30A 2BUOA 2L4BA 2M8LA 1M6NA 4U0AA 1K8AQ 3G71P 3DPHA 2LMLA 2K0YA 3CCVP 3U43A 2PEOA 3RG2A 3I55P 1IMQA 2FVFA 4COPA 3CD6P 2FQ0A 2XGYA 5EW5E 3VRLC 2GZIA 2CNRA 2JYGA 2PNGA 1MZ8A 1VKUA 1L0HA 2EIAA 2GOLB 2AFEA 3CCJP 1UJZA 1L0IA 1IUQA 2EHTA 2FQ2A 3B4QA 3CCRP 1A8OA 3OW2O 2LOLA 1YJNP 2OARA 1QRJA 1VQ7P 2K94A 2KOSA 2LL8A 5HVCA 1RNIA 3G21A 2EG5A 2GDYA 1N8RQ 1YJWP 2MVUA 2EFJA 2FAEA 5F2OA 2L9FA 2GYKA 1AFVA 1D1DA 2Z46A 2XZ0D 2KODA 4IZ6A 4BPHA 1ACPA 4M0IA 2E1MA 1E6JP 1YITP 3NY7B 3RG6C 1KLPA 2XDEA 3CCUP 3M1MA 3HYBA 4QKOA 3CXCO 2N5HA 3LMOA 2JAZA 2KGAA 2CGQA 4U0CA 5HGKA 1M1KQ 3CCEP 2CQ8A 2WLVB 3DS5A 5HGNA 2PENA 3CCLP 3G26A 3Q20A 5KP7B 3CCSP 1OR5A 2N6ZA 2QNWA 2WPTA 1M9EC 2OTJP 2Z44A 2FADA 1X3OA 2JU2A 3G28A 1GWPA 5JPAA 1VHNA 5HV8A 4XFZA 3G0VA 2NO8A 2JYLA 2LF4A 3GKLC 3P05A 2MD9A 3G4SP 1M9DC 1EOQA 2KORA 1Z6MA 4BPGA 2VSQA 5F2KA 4DG9A 1VQ6P 1RO2A 4NX4C 1VQ4P 1G03A 2JU1A 2N98A 2DGYA 4U0FA 1YI2P 1K9MQ 2BHVA 1FR2A 4B4NA 3CC4P 4PH3A 1M74A 4XFYA 3CE7A 2KG8A 3CMAP 3H47A 5EJDA 3CCMP 4LQWC 3DTJA 2GDXA 4GR2A 4WYMA 2GZGA 4XROA 5BS1A 1Q81Q 2KOOA 2KOQA 2MF4A 2CWOA 1JJ2O 2K93A 2L6EA 2N6YA 2X82A 3GZLA 1P7NA 2DNWA 2JPRA 3DS1A 3G6EP 2PEQA 5HGOA 2X2BA 2KGCA 1ZNVA 2X83A 3B5IA 2PEKA 1Q86Q 4PWVB 2GZJA 2N5IA 2MY5A 2FACA 3DS2A 1KQSO 2Z45A 2PEIA 2X2DD 7CEIA 2PXRC 2KR5A 4DGAC 4R0MA 2Y4ZA 3GZMA 2M5RA 5F2NA 5DCKA 1K73Q 1VQPP 3I56P 2XGVA 1L6NA 2AVAA 2K5XA 2M8PA 3DS3A 1YJ9P 2KOPA 5BS2A 1AUMA 2AFDA 3G1IA 5HGLA 1M9CC 1S72P 2GDWA 1VQ9P 3H0DA 4DGEC 1RO0A 1NJIQ 2OTLP 2FVAA 2GZFA 2FQ1A 2L22A 1A43A 1QVFO 1T8KA 1YHQP 2MVVA 2GONA 1Q82Q 2PY8A 2VLOA 2LIUA 2JQ4A 1E0HA 2ONTA 2K0XA 5HGMA 1W2BO 2MR7A 2ROQA 2ERHA 4XRQA 1GXGA 2V4XA 2XGUA 3G1GA 3GJNA 2M8NA 4HTWA 4F37A 4E92A 1VQLP 4COCA 1BXIA 1M9FC 2PWOA 1M9YC 1VQ8P 1VQKP 3G29A 3HZQA 1CEIA 4H2WC 2QEXP 2LKIA 4H2YC 2PEMA 2XXMA 4H2XC 3CCQP 2JGPA 4HKGA 4PXHB 3NTEA 2WLVA 4BPFA 1VQ5P 2JBGA 2PEJA 3CC7P 2P9XA 3CC2P 4J93A 4XFXA 1BAJA 2PWMA 3LRYA 1AF8A 2LPKA 3EJDA 4IPYA 2FHSC 5CZDB 2KG6A 3EJBA 2K0DX 2KWLA 2GZEA 2QA4P 4PH0A 1Q7YQ 2MR8A 2JO0A 4GR6A 3CMEP 2XV6A 3DS4A 3E2DA 1M90Q 1F80D 2KGDA 2KGEA 2L0QA 2VLPA 4MRTC 1EIAA 1UNKA 1EM9A 4PH2A 1DV5A 1HY8A 4NEOA 1VQOP 2KW2A 1IMPA 4U0EA 4PH1A 3WBHA 2KGFA 1NQ4A 2EHSA 2KG9A 5I4TG 2CG5B 1GXHA 4CA3A 1U7KA 4UHPB 2XT1A 1VQNP 1M9XC 3CPWO 2N50A 3EJEA 1HQBA 4QNBA 2LTEA 4INBA 3BP9A 5KP8B 1KD1Q 2JB0A 5KP6B 1VQMP 2VLQA 1AK4C 2AF8A 3MGEA 3H4EA 4U0BA 1GPJA 2FVEA 2VLNA 1QVGO 4U0DA 1EMVA 1M6EX 4E91A
chains in the Genus database with same CATH topology
2PEMA 2XXMA 2X83A 4U0CA 2PEKA 5HGKA 3B5IA 3CCQP 1M1KQ 3CCEP 1Q86Q 2WLVB 3DS5A 3NTEA 1YIJP 5HGNA 2WLVA 2PENA 3DS2A 1VQ5P 2PEJA 3DS0A 1KQSO 2Z45A 2P9XA 3CC7P 3CC2P 2PEIA 2X2DD 3CCLP 3G26A 4J93A 4XFXA 3Q20A 1KC8Q 1ZMBA 2PXRC 4DGAC 1BAJA 3CCSP 2PWMA 3LRYA 1K30A 2Y4ZA 2BUOA 2M8LA 1M6NA 5F2NA 1M9EC 5DCKA 1K73Q 4IPYA 4U0AA 2OTJP 2Z44A 1K8AQ 1VQPP 3I56P 3DPHA 3G71P 3CCVP 2XGVA 2PEOA 3G28A 1L6NA 1GWPA 3I55P 5JPAA 2QA4P 4PH0A 4XFZA 1Q7YQ 4COPA 3G0VA 3CD6P 2JYLA 2XGYA 2M8PA 3DS3A 2LF4A 2JO0A 4GR6A 1YJ9P 5BS2A 3CMEP 3VRLC 3P05A 1AUMA 2JYGA 2XV6A 3DS4A 3G4SP 1M9DC 3E2DA 1M90Q 1EOQA 3G1IA 5HGLA 1M9CC 1S72P 2EIAA 1VQ9P 2GOLB 3H0DA 4DGEC 1RO0A 5F2KA 1NJIQ 2OTLP 3CCJP 1EIAA 1EM9A 1A43A 1IUQA 1QVFO 4PH2A 1VQ6P 1RO2A 1YHQP 4NX4C 1VQ4P 1G03A 3CCRP 1A8OA 2GONA 2DGYA 3OW2O 4U0FA 1VQOP 1YJNP 2OARA 1Q82Q 1YI2P 1QRJA 1K9MQ 2PY8A 4U0EA 4PH1A 2BHVA 1VQ7P 4B4NA 3WBHA 2KGFA 3CC4P 5I4TG 2ONTA 4PH3A 1M74A 1M6EX 4XFYA 1W2BO 3CMAP 1RNIA 3H47A 4XRQA 1U7KA 2EG5A 3G21A 3CCMP 4LQWC 3DTJA 2V4XA 2XGUA 1N8RQ 2XT1A 1VQNP 1M9XC 3CPWO 3G1GA 4GR2A 2M8NA 4HTWA 1YJWP 4WYMA 4E92A 1VQLP 4QNBA 2EFJA 4INBA 4XROA 4COCA 3BP9A 5BS1A 1Q81Q 5F2OA 1AFVA 1D1DA 2CWOA 1JJ2O 1M9FC 2PWOA 2L6EA 1M9YC 2Z46A 1VQMP 1KD1Q 3G29A 2X82A 1VQ8P 1VQKP 2KODA 3HZQA 1AK4C 4M0IA 2E1MA 1E6JP 1YITP 3RG6C 3MGEA 1P7NA 3H4EA 2JPRA 2XDEA 4U0BA 3CCUP 3M1MA 3DS1A 3G6EP 3HYBA 3CXCO 2PEQA 5HGOA 4U0DA 2QEXP 1QVGO 5HGMA 4E91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXM A;  2X83 A;  4U0C A;  5HGK A;  2WLV B;  3DS5 A;  3NTE A;  5HGN A;  2WLV A;  3DS2 A;  3DS0 A;  2X2D D;  3G26 A;  4J93 A;  4XFX A;  2PXR C;  4DGA C;  1BAJ A;  2PWM A;  3LRY A;  2BUO A;  2Y4Z A;  2M8L A;  1M9E C;  5DCK A;  4IPY A;  4U0A A;  3DPH A;  2XGV A;  3G28 A;  1L6N A;  1GWP A;  5JPA A;  4PH0 A;  4XFZ A;  4COP A;  3G0V A;  2JYL A;  2XGY A;  2M8P A;  3DS3 A;  2LF4 A;  2JO0 A;  3VRL C;  3P05 A;  1AUM A;  2JYG A;  2XV6 A;  3DS4 A;  1M9D C;  1EOQ A;  3G1I A;  5HGL A;  1M9C C;  2EIA A;  2GOL B;  4DGE C;  1EIA A;  1EM9 A;  1A43 A;  4PH2 A;  4NX4 C;  1G03 A;  1A8O A;  2GON A;  4U0F A;  1QRJ A;  4U0E A;  4PH1 A;  4B4N A;  2KGF A;  5I4T G;  2ONT A;  4PH3 A;  4XFY A;  3H47 A;  4XRQ A;  1U7K A;  3G21 A;  4LQW C;  3DTJ A;  2V4X A;  2XGU A;  2XT1 A;  1M9X C;  3G1G A;  2M8N A;  4HTW A;  4WYM A;  4E92 A;  4QNB A;  4INB A;  4XRO A;  4COC A;  3BP9 A;  1AFV A;  1D1D A;  1M9F C;  2PWO A;  2L6E A;  1M9Y C;  3G29 A;  2X82 A;  2KOD A;  1AK4 C;  4M0I A;  1E6J P;  3MGE A;  1P7N A;  3H4E A;  2JPR A;  2XDE A;  4U0B A;  3DS1 A;  5HGO A;  4U0D A;  5HGM A;  4E91 A; 
#chains in the Genus database with same CATH topology
 2K92 A;  1DNY A;  1YIJ P;  3DS0 A;  1AYI A;  1KC8 Q;  2K2Q A;  2XZ1 C;  1ZMB A;  2LIW A;  1K30 A;  2BUO A;  2L4B A;  2M8L A;  1M6N A;  4U0A A;  1K8A Q;  3G71 P;  3DPH A;  2LML A;  2K0Y A;  3CCV P;  3U43 A;  2PEO A;  3RG2 A;  3I55 P;  1IMQ A;  2FVF A;  4COP A;  3CD6 P;  2FQ0 A;  2XGY A;  5EW5 E;  3VRL C;  2GZI A;  2CNR A;  2JYG A;  2PNG A;  1MZ8 A;  1VKU A;  1L0H A;  2EIA A;  2GOL B;  2AFE A;  3CCJ P;  1UJZ A;  1L0I A;  1IUQ A;  2EHT A;  2FQ2 A;  3B4Q A;  3CCR P;  1A8O A;  3OW2 O;  2LOL A;  1YJN P;  2OAR A;  1QRJ A;  1VQ7 P;  2K94 A;  2KOS A;  2LL8 A;  5HVC A;  1RNI A;  3G21 A;  2EG5 A;  2GDY A;  1N8R Q;  1YJW P;  2MVU A;  2EFJ A;  2FAE A;  5F2O A;  2L9F A;  2GYK A;  1AFV A;  1D1D A;  2Z46 A;  2XZ0 D;  2KOD A;  4IZ6 A;  4BPH A;  1ACP A;  4M0I A;  2E1M A;  1E6J P;  1YIT P;  3NY7 B;  3RG6 C;  1KLP A;  2XDE A;  3CCU P;  3M1M A;  3HYB A;  4QKO A;  3CXC O;  2N5H A;  3LMO A;  2JAZ A;  2KGA A;  2CGQ A;  4U0C A;  5HGK A;  1M1K Q;  3CCE P;  2CQ8 A;  2WLV B;  3DS5 A;  5HGN A;  2PEN A;  3CCL P;  3G26 A;  3Q20 A;  5KP7 B;  3CCS P;  1OR5 A;  2N6Z A;  2QNW A;  2WPT A;  1M9E C;  2OTJ P;  2Z44 A;  2FAD A;  1X3O A;  2JU2 A;  3G28 A;  1GWP A;  5JPA A;  1VHN A;  5HV8 A;  4XFZ A;  3G0V A;  2NO8 A;  2JYL A;  2LF4 A;  3GKL C;  3P05 A;  2MD9 A;  3G4S P;  1M9D C;  1EOQ A;  2KOR A;  1Z6M A;  4BPG A;  2VSQ A;  5F2K A;  4DG9 A;  1VQ6 P;  1RO2 A;  4NX4 C;  1VQ4 P;  1G03 A;  2JU1 A;  2N98 A;  2DGY A;  4U0F A;  1YI2 P;  1K9M Q;  2BHV A;  1FR2 A;  4B4N A;  3CC4 P;  4PH3 A;  1M74 A;  4XFY A;  3CE7 A;  2KG8 A;  3CMA P;  3H47 A;  5EJD A;  3CCM P;  4LQW C;  3DTJ A;  2GDX A;  4GR2 A;  4WYM A;  2GZG A;  4XRO A;  5BS1 A;  1Q81 Q;  2KOO A;  2KOQ A;  2MF4 A;  2CWO A;  1JJ2 O;  2K93 A;  2L6E A;  2N6Y A;  2X82 A;  3GZL A;  1P7N A;  2DNW A;  2JPR A;  3DS1 A;  3G6E P;  2PEQ A;  5HGO A;  2X2B A;  2KGC A;  1ZNV A;  2X83 A;  3B5I A;  2PEK A;  1Q86 Q;  4PWV B;  2GZJ A;  2N5I A;  2MY5 A;  2FAC A;  3DS2 A;  1KQS O;  2Z45 A;  2PEI A;  2X2D D;  7CEI A;  2PXR C;  2KR5 A;  4DGA C;  4R0M A;  2Y4Z A;  3GZM A;  2M5R A;  5F2N A;  5DCK A;  1K73 Q;  1VQP P;  3I56 P;  2XGV A;  1L6N A;  2AVA A;  2K5X A;  2M8P A;  3DS3 A;  1YJ9 P;  2KOP A;  5BS2 A;  1AUM A;  2AFD A;  3G1I A;  5HGL A;  1M9C C;  1S72 P;  2GDW A;  1VQ9 P;  3H0D A;  4DGE C;  1RO0 A;  1NJI Q;  2OTL P;  2FVA A;  2GZF A;  2FQ1 A;  2L22 A;  1A43 A;  1QVF O;  1T8K A;  1YHQ P;  2MVV A;  2GON A;  1Q82 Q;  2PY8 A;  2VLO A;  2LIU A;  2JQ4 A;  1E0H A;  2ONT A;  2K0X A;  5HGM A;  1W2B O;  2MR7 A;  2ROQ A;  2ERH A;  4XRQ A;  1GXG A;  2V4X A;  2XGU A;  3G1G A;  3GJN A;  2M8N A;  4HTW A;  4F37 A;  4E92 A;  1VQL P;  4COC A;  1BXI A;  1M9F C;  2PWO A;  1M9Y C;  1VQ8 P;  1VQK P;  3G29 A;  3HZQ A;  1CEI A;  4H2W C;  2QEX P;  2LKI A;  4H2Y C;  2PEM A;  2XXM A;  4H2X C;  3CCQ P;  2JGP A;  4HKG A;  4PXH B;  3NTE A;  2WLV A;  4BPF A;  1VQ5 P;  2JBG A;  2PEJ A;  3CC7 P;  2P9X A;  3CC2 P;  4J93 A;  4XFX A;  1BAJ A;  2PWM A;  3LRY A;  1AF8 A;  2LPK A;  3EJD A;  4IPY A;  2FHS C;  5CZD B;  2KG6 A;  3EJB A;  2K0D X;  2KWL A;  2GZE A;  2QA4 P;  4PH0 A;  1Q7Y Q;  2MR8 A;  2JO0 A;  4GR6 A;  3CME P;  2XV6 A;  3DS4 A;  3E2D A;  1M90 Q;  1F80 D;  2KGD A;  2KGE A;  2L0Q A;  2VLP A;  4MRT C;  1EIA A;  1UNK A;  1EM9 A;  4PH2 A;  1DV5 A;  1HY8 A;  4NEO A;  1VQO P;  2KW2 A;  1IMP A;  4U0E A;  4PH1 A;  3WBH A;  2KGF A;  1NQ4 A;  2EHS A;  2KG9 A;  5I4T G;  2CG5 B;  1GXH A;  4CA3 A;  1U7K A;  4UHP B;  2XT1 A;  1VQN P;  1M9X C;  3CPW O;  2N50 A;  3EJE A;  1HQB A;  4QNB A;  2LTE A;  4INB A;  3BP9 A;  5KP8 B;  1KD1 Q;  2JB0 A;  5KP6 B;  1VQM P;  2VLQ A;  1AK4 C;  2AF8 A;  3MGE A;  3H4E A;  4U0B A;  1GPJ A;  2FVE A;  2VLN A;  1QVG O;  4U0D A;  1EMV A;  1M6E X;  4E91 A; 
#chains in the Genus database with same CATH homology
 2PEM A;  2XXM A;  2X83 A;  4U0C A;  2PEK A;  5HGK A;  3B5I A;  3CCQ P;  1M1K Q;  3CCE P;  1Q86 Q;  2WLV B;  3DS5 A;  3NTE A;  1YIJ P;  5HGN A;  2WLV A;  2PEN A;  3DS2 A;  1VQ5 P;  2PEJ A;  3DS0 A;  1KQS O;  2Z45 A;  2P9X A;  3CC7 P;  3CC2 P;  2PEI A;  2X2D D;  3CCL P;  3G26 A;  4J93 A;  4XFX A;  3Q20 A;  1KC8 Q;  1ZMB A;  2PXR C;  4DGA C;  1BAJ A;  3CCS P;  2PWM A;  3LRY A;  1K30 A;  2Y4Z A;  2BUO A;  2M8L A;  1M6N A;  5F2N A;  1M9E C;  5DCK A;  1K73 Q;  4IPY A;  4U0A A;  2OTJ P;  2Z44 A;  1K8A Q;  1VQP P;  3I56 P;  3DPH A;  3G71 P;  3CCV P;  2XGV A;  2PEO A;  3G28 A;  1L6N A;  1GWP A;  3I55 P;  5JPA A;  2QA4 P;  4PH0 A;  4XFZ A;  1Q7Y Q;  4COP A;  3G0V A;  3CD6 P;  2JYL A;  2XGY A;  2M8P A;  3DS3 A;  2LF4 A;  2JO0 A;  4GR6 A;  1YJ9 P;  5BS2 A;  3CME P;  3VRL C;  3P05 A;  1AUM A;  2JYG A;  2XV6 A;  3DS4 A;  3G4S P;  1M9D C;  3E2D A;  1M90 Q;  1EOQ A;  3G1I A;  5HGL A;  1M9C C;  1S72 P;  2EIA A;  1VQ9 P;  2GOL B;  3H0D A;  4DGE C;  1RO0 A;  5F2K A;  1NJI Q;  2OTL P;  3CCJ P;  1EIA A;  1EM9 A;  1A43 A;  1IUQ A;  1QVF O;  4PH2 A;  1VQ6 P;  1RO2 A;  1YHQ P;  4NX4 C;  1VQ4 P;  1G03 A;  3CCR P;  1A8O A;  2GON A;  2DGY A;  3OW2 O;  4U0F A;  1VQO P;  1YJN P;  2OAR A;  1Q82 Q;  1YI2 P;  1QRJ A;  1K9M Q;  2PY8 A;  4U0E A;  4PH1 A;  2BHV A;  1VQ7 P;  4B4N A;  3WBH A;  2KGF A;  3CC4 P;  5I4T G;  2ONT A;  4PH3 A;  1M74 A;  1M6E X;  4XFY A;  1W2B O;  3CMA P;  1RNI A;  3H47 A;  4XRQ A;  1U7K A;  2EG5 A;  3G21 A;  3CCM P;  4LQW C;  3DTJ A;  2V4X A;  2XGU A;  1N8R Q;  2XT1 A;  1VQN P;  1M9X C;  3CPW O;  3G1G A;  4GR2 A;  2M8N A;  4HTW A;  1YJW P;  4WYM A;  4E92 A;  1VQL P;  4QNB A;  2EFJ A;  4INB A;  4XRO A;  4COC A;  3BP9 A;  5BS1 A;  1Q81 Q;  5F2O A;  1AFV A;  1D1D A;  2CWO A;  1JJ2 O;  1M9F C;  2PWO A;  2L6E A;  1M9Y C;  2Z46 A;  1VQM P;  1KD1 Q;  3G29 A;  2X82 A;  1VQ8 P;  1VQK P;  2KOD A;  3HZQ A;  1AK4 C;  4M0I A;  2E1M A;  1E6J P;  1YIT P;  3RG6 C;  3MGE A;  1P7N A;  3H4E A;  2JPR A;  2XDE A;  4U0B A;  3CCU P;  3M1M A;  3DS1 A;  3G6E P;  3HYB A;  3CXC O;  2PEQ A;  5HGO A;  4U0D A;  2QEX P;  1QVG O;  5HGM A;  4E91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...