4U0EA

Hexameric hiv-1 ca in complex with pf3450074
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
209
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQETETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 73
structure length 209
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0eA02
2GONA 5HGMA 5JPAA 2KODA 4HTWA 3VRLC 4J93A 4XFZA 3DS5A 3DS1A 4XRQA 1M9FC 2WLVB 1L6NA 1EM9A 2M8LA 4COCA 2XGVA 3H4EA 3G1IA 3DS3A 1EIAA 2LF4A 2M8NA 4U0BA 3G1GA 3DPHA 3G21A 2X2DD 1E6JP 1AUMA 4WYMA 3LRYA 4U0EA 4LQWC 2PWOA 4COPA 2PXRC 1D1DA 1EOQA 1P7NA 1U7KA 4U0DA 3DS0A 2X82A 5HGLA 2ONTA 1G03A 1M9YC 3G26A 5HGOA 3G0VA 3NTEA 3P05A 4XFYA 5I4TG 4E92A 3H47A 2JO0A 3BP9A 1A8OA 4XFXA 4INBA 2M8PA 4QNBA 1M9XC 2WLVA 4PH0A 4B4NA 2V4XA 2JYGA 4PH1A 3DS2A 2XGYA 4DGEC 1M9EC 2JPRA 3G28A 2PWMA 4DGAC 1M9DC 4E91A 1GWPA 2KGFA 2BUOA 5HGKA 1QRJA 4M0IA 2EIAA 2Y4ZA 4U0AA 5HGNA 1BAJA 3DTJA 3DS4A 4PH2A 2XT1A 4XROA 2X83A 2XV6A 2GOLB 2XDEA 3MGEA 4U0FA 2L6EA 3G29A 2XGUA 2XXMA 1M9CC 4U0CA 1AFVA 5DCKA 1AK4C 4IPYA 4NX4C 1A43A 4PH3A 2JYLA
chains in the Genus database with same CATH superfamily
5F2KA 2AF8A 2ROQA 4UHPB 5JPAA 1Q7YQ 2JGPA 2N50A 1AYIA 2PENA 1ACPA 3DS5A 1UJZA 2JBGA 2P9XA 4H2YC 1L6NA 1S72P 2FVEA 3DS3A 1EIAA 3CCMP 2OTJP 2CG5B 2M8NA 2JAZA 3G21A 1F80D 2X2DD 1M90Q 1E6JP 1IMQA 4WYMA 3CC2P 4HKGA 3G4SP 5CZDB 4U0EA 5EW5E 2L22A 1K73Q 1VQ8P 4U0DA 2QNWA 1IMPA 1VQOP 4BPHA 5HGLA 2MVUA 3G26A 5BS2A 1FR2A 1K9MQ 5I4TG 1VQLP 5KP6B 2JO0A 5EJDA 3BP9A 1A8OA 1UNKA 2PY8A 2PEQA 1VQ9P 3OW2O 2K0XA 2V4XA 2JYGA 2N6ZA 3HYBA 3DS2A 2K93A 4BPFA 2EHSA 2OARA 4BPGA 1VQ4P 2PEJA 1MZ8A 3B5IA 2DGYA 3EJBA 4NEOA 1K8AQ 2EG5A 3G6EP 1QVFO 1YJNP 1VHNA 4M0IA 2Y4ZA 5HGNA 1VQ5P 3CMAP 2ERHA 2XV6A 5F2NA 2WPTA 3MGEA 2FVAA 3CCSP 1RO2A 2CWOA 2L6EA 3G29A 2Z45A 1VQKP 1DNYA 2AVAA 1RNIA 3E2DA 2N5IA 1AK4C 1L0IA 4PH3A 2XZ0D 2AFEA 2KOPA 1Z6MA 2GONA 5HGMA 2KG6A 2MY5A 4H2XC 4HTWA 1QVGO 3VRLC 2LPKA 2JQ4A 2LKIA 1IUQA 4XFZA 2L4BA 3DS1A 1RO0A 2LL8A 3CCJP 5HV8A 1VQ6P 1EM9A 5F2OA 2LF4A 2K92A 2FQ1A 1KD1Q 2VLPA 4PXHB 1BXIA 3G71P 1GPJA 2VSQA 1T8KA 2EHTA 2AFDA 2PEMA 1YITP 3CCLP 4COPA 2KOSA 3DS0A 2CQ8A 2ONTA 1M74A 1G03A 1M9YC 2OTLP 2MF4A 3NTEA 1KLPA 3I56P 2QEXP 2M8PA 4QNBA 2WLVA 1VQNP 4B4NA 1N8RQ 2GDWA 1AF8A 4PH1A 3CMEP 2KGAA 4DGEC 1OR5A 2NO8A 4DGAC 3CPWO 4E91A 2FVFA 1YIJP 2KGFA 1GXHA 1E0HA 3GZLA 2FACA 2FAEA 2PNGA 3CC7P 4U0AA 1HQBA 1YI2P 4PH2A 2GOLB 1KC8Q 2GDYA 4U0FA 2XGUA 1W2BO 2Z44A 1M9CC 4U0CA 2KOOA 1AFVA 5DCKA 2GYKA 2KGDA 2DNWA 1CEIA 4XRQA 2WLVB 2JB0A 2M8LA 4COCA 1YJ9P 4F37A 2XGVA 2PEIA 4QKOA 2EFJA 1Q81Q 4U0BA 3CCQP 3CC4P 2VLNA 2VLOA 1AUMA 1HY8A 2GZGA 3I55P 3Q20A 2E1MA 4LQWC 3CXCO 2PXRC 1D1DA 1EOQA 2BHVA 2JU1A 4MRTC 3CE7A 2L0QA 4XFYA 4E92A 3H47A 1Q82Q 1KQSO 2KR5A 1X3OA 1M9XC 2KGCA 3H0DA 1EMVA 2LOLA 3GZMA 2KWLA 3EJDA 1DV5A 4PWVB 2QA4P 4GR6A 2PWMA 3CCUP 1M6NA 2LIUA 4IZ6A 1YJWP 2GZFA 5HGKA 1QRJA 1L0HA 2CGQA 5KP8B 3CCEP 4XROA 3GKLC 1VQMP 1VQ7P 2N5HA 2KG9A 2LMLA 2VLQA 1ZMBA 1ZNVA 3RG2A 4NX4C 1A43A 2MD9A 1Q86Q 5BS1A 3RG6C 2KODA 3WBHA 2FQ0A 4J93A 2N6YA 1M9FC 2FADA 2MVVA 3H4EA 3G1IA 3LMOA 2KOQA 3G1GA 3DPHA 2MR8A 2X2BA 2GZEA 2JU2A 2GZJA 3NY7B 2XZ1C 3LRYA 1JJ2O 2PWOA 2K94A 3U43A 2Z46A 1P7NA 4H2WC 1U7KA 2PEOA 2X82A 3CCVP 2LIWA 2K0YA 5HGOA 1NQ4A 2K5XA 3G0VA 2KG8A 3P05A 4XFXA 3B4QA 4INBA 4PH0A 1VQPP 1M1KQ 2KGEA 1M6EX 4R0MA 2XGYA 3M1MA 3CD6P 4GR2A 1M9EC 3EJEA 2JPRA 3G28A 1M9DC 4CA3A 2MR7A 1GWPA 1VKUA 2K2QA 7CEIA 1YHQP 2PEKA 2BUOA 2CNRA 2LTEA 2K0DX 2EIAA 3HZQA 3DTJA 5HVCA 1BAJA 2FHSC 2L9FA 3DS4A 2FQ2A 2XT1A 2X83A 2XDEA 1NJIQ 2KW2A 1GXGA 3GJNA 4DG9A 2XXMA 1K30A 5KP7B 2N98A 2KORA 2GDXA 4IPYA 2GZIA 2M5RA 2JYLA 3CCRP
chains in the Genus database with same CATH topology
1Q86Q 5F2KA 5BS1A 2GONA 5HGMA 3RG6C 5JPAA 2KODA 1Q7YQ 4HTWA 1QVGO 3VRLC 3WBHA 1IUQA 2PENA 4J93A 4XFZA 3DS5A 3DS1A 4XRQA 1RO0A 2P9XA 1M9FC 3CCJP 2WLVB 1S72P 1L6NA 1EM9A 2M8LA 1VQ6P 4COCA 1YJ9P 5F2OA 2XGVA 3H4EA 3G1IA 3DS3A 1EIAA 2PEIA 3CCMP 2OTJP 2LF4A 2EFJA 2M8NA 4U0BA 1Q81Q 3CCQP 3CC4P 3G1GA 1KD1Q 3DPHA 3G21A 2X2DD 1M90Q 3G71P 1E6JP 1AUMA 4WYMA 3CC2P 3I55P 3LRYA 3G4SP 1JJ2O 4U0EA 2PEMA 3Q20A 1YITP 2E1MA 4LQWC 2PWOA 4COPA 3CCLP 3CXCO 2PXRC 1D1DA 1EOQA 2BHVA 2Z46A 1P7NA 1K73Q 1U7KA 1VQ8P 4U0DA 2PEOA 3DS0A 1VQOP 2X82A 3CCVP 5HGLA 1M74A 1G03A 2ONTA 1M9YC 3G26A 5BS2A 2OTLP 5HGOA 3G0VA 1K9MQ 3NTEA 3P05A 4XFYA 5I4TG 4E92A 3H47A 1VQLP 2JO0A 3BP9A 1A8OA 4XFXA 3I56P 1Q82Q 4INBA 1KQSO 2PY8A 2QEXP 2M8PA 4QNBA 1M9XC 2PEQA 2WLVA 1VQ9P 3OW2O 4PH0A 1VQPP 1VQNP 4B4NA 2V4XA 2JYGA 1M1KQ 3H0DA 1N8RQ 1M6EX 4PH1A 3HYBA 3DS2A 2XGYA 3M1MA 3CMEP 3CD6P 4GR2A 4DGEC 1M9EC 2OARA 2JPRA 2QA4P 4GR6A 3G28A 2PWMA 1VQ4P 4DGAC 3CCUP 2PEJA 1M6NA 1M9DC 3CPWO 1YJWP 4E91A 3B5IA 2DGYA 1GWPA 1YIJP 2KGFA 1YHQP 1K8AQ 2EG5A 2PEKA 2BUOA 3G6EP 5HGKA 1QRJA 1YJNP 1QVFO 4M0IA 3CC7P 2EIAA 2Y4ZA 4U0AA 5HGNA 1BAJA 3DTJA 3HZQA 1YI2P 3DS4A 3CCEP 4PH2A 2XT1A 1VQ5P 4XROA 3CMAP 2X83A 2XV6A 5F2NA 2GOLB 2XDEA 1VQMP 3MGEA 1NJIQ 3CCSP 1KC8Q 1RO2A 1VQ7P 2CWOA 4U0FA 2L6EA 3G29A 2XGUA 2XXMA 2Z45A 1VQKP 1RNIA 3E2DA 1W2BO 1K30A 2Z44A 1M9CC 4U0CA 1AFVA 1ZMBA 5DCKA 1AK4C 4IPYA 4NX4C 1A43A 4PH3A 2JYLA 3CCRP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GON A;  5HGM A;  5JPA A;  2KOD A;  4HTW A;  3VRL C;  4J93 A;  4XFZ A;  3DS5 A;  3DS1 A;  4XRQ A;  1M9F C;  2WLV B;  1L6N A;  1EM9 A;  2M8L A;  4COC A;  2XGV A;  3H4E A;  3G1I A;  3DS3 A;  1EIA A;  2LF4 A;  2M8N A;  4U0B A;  3G1G A;  3DPH A;  3G21 A;  2X2D D;  1E6J P;  1AUM A;  4WYM A;  3LRY A;  4U0E A;  4LQW C;  2PWO A;  4COP A;  2PXR C;  1D1D A;  1EOQ A;  1P7N A;  1U7K A;  4U0D A;  3DS0 A;  2X82 A;  5HGL A;  2ONT A;  1G03 A;  1M9Y C;  3G26 A;  5HGO A;  3G0V A;  3NTE A;  3P05 A;  4XFY A;  5I4T G;  4E92 A;  3H47 A;  2JO0 A;  3BP9 A;  1A8O A;  4XFX A;  4INB A;  2M8P A;  4QNB A;  1M9X C;  2WLV A;  4PH0 A;  4B4N A;  2V4X A;  2JYG A;  4PH1 A;  3DS2 A;  2XGY A;  4DGE C;  1M9E C;  2JPR A;  3G28 A;  2PWM A;  4DGA C;  1M9D C;  4E91 A;  1GWP A;  2KGF A;  2BUO A;  5HGK A;  1QRJ A;  4M0I A;  2EIA A;  2Y4Z A;  4U0A A;  5HGN A;  1BAJ A;  3DTJ A;  3DS4 A;  4PH2 A;  2XT1 A;  4XRO A;  2X83 A;  2XV6 A;  2GOL B;  2XDE A;  3MGE A;  4U0F A;  2L6E A;  3G29 A;  2XGU A;  2XXM A;  1M9C C;  4U0C A;  1AFV A;  5DCK A;  1AK4 C;  4IPY A;  4NX4 C;  1A43 A;  4PH3 A;  2JYL A; 
#chains in the Genus database with same CATH topology
 5F2K A;  2AF8 A;  2ROQ A;  4UHP B;  5JPA A;  1Q7Y Q;  2JGP A;  2N50 A;  1AYI A;  2PEN A;  1ACP A;  3DS5 A;  1UJZ A;  2JBG A;  2P9X A;  4H2Y C;  1L6N A;  1S72 P;  2FVE A;  3DS3 A;  1EIA A;  3CCM P;  2OTJ P;  2CG5 B;  2M8N A;  2JAZ A;  3G21 A;  1F80 D;  2X2D D;  1M90 Q;  1E6J P;  1IMQ A;  4WYM A;  3CC2 P;  4HKG A;  3G4S P;  5CZD B;  4U0E A;  5EW5 E;  2L22 A;  1K73 Q;  1VQ8 P;  4U0D A;  2QNW A;  1IMP A;  1VQO P;  4BPH A;  5HGL A;  2MVU A;  3G26 A;  5BS2 A;  1FR2 A;  1K9M Q;  5I4T G;  1VQL P;  5KP6 B;  2JO0 A;  5EJD A;  3BP9 A;  1A8O A;  1UNK A;  2PY8 A;  2PEQ A;  1VQ9 P;  3OW2 O;  2K0X A;  2V4X A;  2JYG A;  2N6Z A;  3HYB A;  3DS2 A;  2K93 A;  4BPF A;  2EHS A;  2OAR A;  4BPG A;  1VQ4 P;  2PEJ A;  1MZ8 A;  3B5I A;  2DGY A;  3EJB A;  4NEO A;  1K8A Q;  2EG5 A;  3G6E P;  1QVF O;  1YJN P;  1VHN A;  4M0I A;  2Y4Z A;  5HGN A;  1VQ5 P;  3CMA P;  2ERH A;  2XV6 A;  5F2N A;  2WPT A;  3MGE A;  2FVA A;  3CCS P;  1RO2 A;  2CWO A;  2L6E A;  3G29 A;  2Z45 A;  1VQK P;  1DNY A;  2AVA A;  1RNI A;  3E2D A;  2N5I A;  1AK4 C;  1L0I A;  4PH3 A;  2XZ0 D;  2AFE A;  2KOP A;  1Z6M A;  2GON A;  5HGM A;  2KG6 A;  2MY5 A;  4H2X C;  4HTW A;  1QVG O;  3VRL C;  2LPK A;  2JQ4 A;  2LKI A;  1IUQ A;  4XFZ A;  2L4B A;  3DS1 A;  1RO0 A;  2LL8 A;  3CCJ P;  5HV8 A;  1VQ6 P;  1EM9 A;  5F2O A;  2LF4 A;  2K92 A;  2FQ1 A;  1KD1 Q;  2VLP A;  4PXH B;  1BXI A;  3G71 P;  1GPJ A;  2VSQ A;  1T8K A;  2EHT A;  2AFD A;  2PEM A;  1YIT P;  3CCL P;  4COP A;  2KOS A;  3DS0 A;  2CQ8 A;  2ONT A;  1M74 A;  1G03 A;  1M9Y C;  2OTL P;  2MF4 A;  3NTE A;  1KLP A;  3I56 P;  2QEX P;  2M8P A;  4QNB A;  2WLV A;  1VQN P;  4B4N A;  1N8R Q;  2GDW A;  1AF8 A;  4PH1 A;  3CME P;  2KGA A;  4DGE C;  1OR5 A;  2NO8 A;  4DGA C;  3CPW O;  4E91 A;  2FVF A;  1YIJ P;  2KGF A;  1GXH A;  1E0H A;  3GZL A;  2FAC A;  2FAE A;  2PNG A;  3CC7 P;  4U0A A;  1HQB A;  1YI2 P;  4PH2 A;  2GOL B;  1KC8 Q;  2GDY A;  4U0F A;  2XGU A;  1W2B O;  2Z44 A;  1M9C C;  4U0C A;  2KOO A;  1AFV A;  5DCK A;  2GYK A;  2KGD A;  2DNW A;  1CEI A;  4XRQ A;  2WLV B;  2JB0 A;  2M8L A;  4COC A;  1YJ9 P;  4F37 A;  2XGV A;  2PEI A;  4QKO A;  2EFJ A;  1Q81 Q;  4U0B A;  3CCQ P;  3CC4 P;  2VLN A;  2VLO A;  1AUM A;  1HY8 A;  2GZG A;  3I55 P;  3Q20 A;  2E1M A;  4LQW C;  3CXC O;  2PXR C;  1D1D A;  1EOQ A;  2BHV A;  2JU1 A;  4MRT C;  3CE7 A;  2L0Q A;  4XFY A;  4E92 A;  3H47 A;  1Q82 Q;  1KQS O;  2KR5 A;  1X3O A;  1M9X C;  2KGC A;  3H0D A;  1EMV A;  2LOL A;  3GZM A;  2KWL A;  3EJD A;  1DV5 A;  4PWV B;  2QA4 P;  4GR6 A;  2PWM A;  3CCU P;  1M6N A;  2LIU A;  4IZ6 A;  1YJW P;  2GZF A;  5HGK A;  1QRJ A;  1L0H A;  2CGQ A;  5KP8 B;  3CCE P;  4XRO A;  3GKL C;  1VQM P;  1VQ7 P;  2N5H A;  2KG9 A;  2LML A;  2VLQ A;  1ZMB A;  1ZNV A;  3RG2 A;  4NX4 C;  1A43 A;  2MD9 A;  1Q86 Q;  5BS1 A;  3RG6 C;  2KOD A;  3WBH A;  2FQ0 A;  4J93 A;  2N6Y A;  1M9F C;  2FAD A;  2MVV A;  3H4E A;  3G1I A;  3LMO A;  2KOQ A;  3G1G A;  3DPH A;  2MR8 A;  2X2B A;  2GZE A;  2JU2 A;  2GZJ A;  3NY7 B;  2XZ1 C;  3LRY A;  1JJ2 O;  2PWO A;  2K94 A;  3U43 A;  2Z46 A;  1P7N A;  4H2W C;  1U7K A;  2PEO A;  2X82 A;  3CCV P;  2LIW A;  2K0Y A;  5HGO A;  1NQ4 A;  2K5X A;  3G0V A;  2KG8 A;  3P05 A;  4XFX A;  3B4Q A;  4INB A;  4PH0 A;  1VQP P;  1M1K Q;  2KGE A;  1M6E X;  4R0M A;  2XGY A;  3M1M A;  3CD6 P;  4GR2 A;  1M9E C;  3EJE A;  2JPR A;  3G28 A;  1M9D C;  4CA3 A;  2MR7 A;  1GWP A;  1VKU A;  2K2Q A;  7CEI A;  1YHQ P;  2PEK A;  2BUO A;  2CNR A;  2LTE A;  2K0D X;  2EIA A;  3HZQ A;  3DTJ A;  5HVC A;  1BAJ A;  2FHS C;  2L9F A;  3DS4 A;  2FQ2 A;  2XT1 A;  2X83 A;  2XDE A;  1NJI Q;  2KW2 A;  1GXG A;  3GJN A;  4DG9 A;  2XXM A;  1K30 A;  5KP7 B;  2N98 A;  2KOR A;  2GDX A;  4IPY A;  2GZI A;  2M5R A;  2JYL A;  3CCR P; 
#chains in the Genus database with same CATH homology
 1Q86 Q;  5F2K A;  5BS1 A;  2GON A;  5HGM A;  3RG6 C;  5JPA A;  2KOD A;  1Q7Y Q;  4HTW A;  1QVG O;  3VRL C;  3WBH A;  1IUQ A;  2PEN A;  4J93 A;  4XFZ A;  3DS5 A;  3DS1 A;  4XRQ A;  1RO0 A;  2P9X A;  1M9F C;  3CCJ P;  2WLV B;  1S72 P;  1L6N A;  1EM9 A;  2M8L A;  1VQ6 P;  4COC A;  1YJ9 P;  5F2O A;  2XGV A;  3H4E A;  3G1I A;  3DS3 A;  1EIA A;  2PEI A;  3CCM P;  2OTJ P;  2LF4 A;  2EFJ A;  2M8N A;  4U0B A;  1Q81 Q;  3CCQ P;  3CC4 P;  3G1G A;  1KD1 Q;  3DPH A;  3G21 A;  2X2D D;  1M90 Q;  3G71 P;  1E6J P;  1AUM A;  4WYM A;  3CC2 P;  3I55 P;  3LRY A;  3G4S P;  1JJ2 O;  4U0E A;  2PEM A;  3Q20 A;  1YIT P;  2E1M A;  4LQW C;  2PWO A;  4COP A;  3CCL P;  3CXC O;  2PXR C;  1D1D A;  1EOQ A;  2BHV A;  2Z46 A;  1P7N A;  1K73 Q;  1U7K A;  1VQ8 P;  4U0D A;  2PEO A;  3DS0 A;  1VQO P;  2X82 A;  3CCV P;  5HGL A;  1M74 A;  1G03 A;  2ONT A;  1M9Y C;  3G26 A;  5BS2 A;  2OTL P;  5HGO A;  3G0V A;  1K9M Q;  3NTE A;  3P05 A;  4XFY A;  5I4T G;  4E92 A;  3H47 A;  1VQL P;  2JO0 A;  3BP9 A;  1A8O A;  4XFX A;  3I56 P;  1Q82 Q;  4INB A;  1KQS O;  2PY8 A;  2QEX P;  2M8P A;  4QNB A;  1M9X C;  2PEQ A;  2WLV A;  1VQ9 P;  3OW2 O;  4PH0 A;  1VQP P;  1VQN P;  4B4N A;  2V4X A;  2JYG A;  1M1K Q;  3H0D A;  1N8R Q;  1M6E X;  4PH1 A;  3HYB A;  3DS2 A;  2XGY A;  3M1M A;  3CME P;  3CD6 P;  4GR2 A;  4DGE C;  1M9E C;  2OAR A;  2JPR A;  2QA4 P;  4GR6 A;  3G28 A;  2PWM A;  1VQ4 P;  4DGA C;  3CCU P;  2PEJ A;  1M6N A;  1M9D C;  3CPW O;  1YJW P;  4E91 A;  3B5I A;  2DGY A;  1GWP A;  1YIJ P;  2KGF A;  1YHQ P;  1K8A Q;  2EG5 A;  2PEK A;  2BUO A;  3G6E P;  5HGK A;  1QRJ A;  1YJN P;  1QVF O;  4M0I A;  3CC7 P;  2EIA A;  2Y4Z A;  4U0A A;  5HGN A;  1BAJ A;  3DTJ A;  3HZQ A;  1YI2 P;  3DS4 A;  3CCE P;  4PH2 A;  2XT1 A;  1VQ5 P;  4XRO A;  3CMA P;  2X83 A;  2XV6 A;  5F2N A;  2GOL B;  2XDE A;  1VQM P;  3MGE A;  1NJI Q;  3CCS P;  1KC8 Q;  1RO2 A;  1VQ7 P;  2CWO A;  4U0F A;  2L6E A;  3G29 A;  2XGU A;  2XXM A;  2Z45 A;  1VQK P;  1RNI A;  3E2D A;  1W2B O;  1K30 A;  2Z44 A;  1M9C C;  4U0C A;  1AFV A;  1ZMB A;  5DCK A;  1AK4 C;  4IPY A;  4NX4 C;  1A43 A;  4PH3 A;  2JYL A;  3CCR P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...