4U0EA

Hexameric hiv-1 ca in complex with pf3450074
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
209
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQETETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
total genus 73
structure length 209
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0eA02
1U7KA 2ONTA 3VRLC 3DS1A 1M9FC 1D1DA 4COPA 2JPRA 3DPHA 1BAJA 1G03A 1A8OA 3DS4A 1GWPA 4U0FA 4XROA 1AFVA 4M0IA 2PWMA 1AK4C 4U0AA 2BUOA 5JPAA 2L6EA 4XFZA 1E6JP 3G0VA 5HGLA 4U0BA 2M8NA 5HGMA 3NTEA 2XDEA 2PWOA 3G1GA 5HGNA 3LRYA 4HTWA 2KODA 4XFXA 4U0CA 3P05A 5DCKA 4PH1A 2X82A 4PH0A 3MGEA 1A43A 2X2DD 4DGEC 2WLVA 2EIAA 4WYMA 4J93A 4E92A 1EM9A 4XRQA 4E91A 4DGAC 1AUMA 1M9EC 3G1IA 2JYGA 1QRJA 5HGOA 3H4EA 5HGKA 4LQWC 2XXMA 4COCA 2WLVB 2M8LA 1M9DC 4INBA 3H47A 3DTJA 4IPYA 3DS0A 5I4TG 2KGFA 3G28A 3DS2A 4QNBA 3G21A 1M9CC 1EIAA 1P7NA 2LF4A 2XV6A 4PH2A 2XGVA 2PXRC 2GONA 2XGUA 2XGYA 3BP9A 4U0DA 4XFYA 2X83A 1EOQA 4U0EA 2M8PA 4NX4C 2JYLA 3DS5A 2V4XA 4PH3A 3DS3A 2Y4ZA 3G26A 2GOLB 2XT1A 1M9YC 3G29A 4B4NA 2JO0A 1M9XC 1L6NA
chains in the Genus database with same CATH superfamily
2CWOA 3VRLC 2AFDA 2KGDA 5EW5E 2JPRA 5F2OA 2KGAA 1BAJA 1G03A 1A8OA 1MZ8A 5KP7B 2VLOA 2PEOA 2VSQA 4H2WC 2MVVA 2VLNA 2AVAA 1Q86Q 2L6EA 1E6JP 2PEMA 2XZ0D 4GR6A 5HGMA 1YIJP 2XDEA 2GZFA 3G1GA 2PENA 2KGEA 5HGNA 2GZIA 4XFXA 2PY8A 2FVFA 1X3OA 2K2QA 1CEIA 1FR2A 2WLVA 2EIAA 4WYMA 3CXCO 2MY5A 5EJDA 1L0IA 3E2DA 4XRQA 1E0HA 1M9EC 1VQPP 3G1IA 1QRJA 2KG6A 2XXMA 4COCA 2Z45A 4HKGA 2FVEA 4INBA 3DTJA 1VHNA 3CC4P 1VQMP 2FHSC 1M9CC 4GR2A 2K0YA 2L4BA 2ROQA 4PH2A 1Q7YQ 2EG5A 2XGVA 3CCRP 4BPFA 4DG9A 4BPGA 1N8RQ 1T8KA 2FQ0A 4U0DA 1K30A 5HV8A 3CCSP 4XFYA 2JYLA 3DS5A 2JAZA 2K0DX 2Y4ZA 2LIWA 3LMOA 1VQ4P 2K94A 2Z44A 4B4NA 3CCJP 3EJEA 2MVUA 1U7KA 3HZQA 2KG9A 3CE7A 1D1DA 1AF8A 2AF8A 2LOLA 4H2YC 1IMQA 1AFVA 3OW2O 2PWMA 2K93A 2GDYA 4NEOA 1AK4C 2BUOA 4XFZA 3H0DA 2CGQA 5HGLA 1M1KQ 2PEJA 3LRYA 4HTWA 2LPKA 5CZDB 4U0CA 3B5IA 2DNWA 4PH0A 1HY8A 1A43A 2K5XA 2JU1A 4DGEC 2LTEA 4R0MA 2GZGA 1S72P 2FADA 3CD6P 1W2BO 2BHVA 1EM9A 4E91A 2FAEA 4PXHB 1YI2P 1AUMA 2KWLA 2N6ZA 3CMAP 3CCEP 2QNWA 4LQWC 4IZ6A 1ZMBA 4F37A 1K8AQ 1ZNVA 1M9DC 2N5IA 4IPYA 4PWVB 1F80D 2EFJA 2KGFA 2E1MA 2GZJA 2L9FA 3GKLC 1EIAA 2GDXA 2OARA 2XV6A 2OTLP 1GXGA 2LL8A 4MRTC 2N50A 2PXRC 2DGYA 2L0QA 2CNRA 2PNGA 1Q82Q 3BP9A 2X83A 1GXHA 1VQKP 2M8PA 3GZLA 2V4XA 4PH3A 2KOQA 4CA3A 2K92A 5KP6B 2FQ1A 1YHQP 1M90Q 1M9XC 1L6NA 3DS1A 2KR5A 2ERHA 2KOSA 1M6NA 1UJZA 3DS4A 1GWPA 2Z46A 2LKIA 5F2NA 1M6EX 3GJNA 1Z6MA 5JPAA 3G0VA 4BPHA 1YJ9P 2KORA 2M8NA 3NTEA 2PWOA 2GZEA 4QKOA 5BS2A 1GPJA 4PH1A 3RG2A 3GZMA 2GDWA 2PEKA 3MGEA 1JJ2O 3HYBA 3EJDA 1NQ4A 3RG6C 2KOPA 4E92A 2CQ8A 4DGAC 2AFEA 2PEQA 5HGOA 3H4EA 5HGKA 2WLVB 1YITP 2M8LA 2KG8A 1K9MQ 5I4TG 2KOOA 1VQ7P 4QNBA 1KQSO 1BXIA 1P7NA 2LF4A 2FACA 1L0HA 3EJBA 2VLQA 3CPWO 3NY7B 2GONA 2XGUA 1RO0A 2XGYA 1UNKA 1EOQA 2X2BA 4U0EA 4NX4C 3CC2P 4UHPB 3CC7P 1KLPA 2P9XA 2GOLB 2QA4P 2XT1A 2JBGA 2JQ4A 1IMPA 3G29A 2N6YA 2JO0A 2KW2A 2EHSA 1RNIA 2ONTA 1VQ5P 1IUQA 1VKUA 1DNYA 5HVCA 4H2XC 1M9FC 3WBHA 4COPA 3DPHA 1ACPA 1KD1Q 1RO2A 4U0FA 4XROA 1AYIA 4M0IA 3G6EP 2MF4A 2JU2A 2MD9A 4U0AA 2QEXP 3U43A 2EHTA 2N5HA 1NJIQ 4U0BA 1OR5A 3CMEP 1VQLP 2KODA 5BS1A 5DCKA 3P05A 1VQ8P 2X82A 2XZ1C 2X2DD 3CCVP 5KP8B 2MR8A 1Q81Q 1QVGO 1EMVA 3CCUP 4J93A 2L22A 2WPTA 3I55P 1QVFO 1DV5A 1KC8Q 1VQNP 2JYGA 3G4SP 3I56P 1K73Q 2M5RA 1VQOP 7CEIA 2LIUA 2K0XA 2CG5B 3H47A 1YJWP 3CCLP 3DS0A 2LMLA 3G28A 3DS2A 3M1MA 3G21A 3CCMP 2MR7A 2JGPA 3CCQP 3B4QA 1VQ9P 1M74A 2N98A 2OTJP 2JB0A 2GYKA 2KGCA 3G71P 1YJNP 2FVAA 2PEIA 3DS3A 2FQ2A 3Q20A 3G26A 2VLPA 1M9YC 2NO8A 5F2KA 1HQBA 1VQ6P
chains in the Genus database with same CATH topology
1U7KA 1RNIA 2ONTA 1VQ5P 1IUQA 2CWOA 3VRLC 3DS1A 3HZQA 1M9FC 1D1DA 3WBHA 4COPA 1M6NA 2JPRA 3DPHA 5F2OA 1KD1Q 1BAJA 1G03A 1A8OA 1RO2A 1GWPA 3DS4A 2Z46A 4U0FA 5F2NA 4XROA 1AFVA 2PEOA 1M6EX 4M0IA 3OW2O 2PWMA 3G6EP 1AK4C 1Q86Q 2QEXP 4U0AA 2BUOA 5JPAA 2L6EA 4XFZA 1E6JP 3G0VA 3H0DA 1NJIQ 2PEMA 1YJ9P 5HGLA 4U0BA 1M1KQ 2M8NA 4GR6A 5HGMA 3NTEA 1YIJP 2XDEA 2PWOA 2PEJA 2PENA 3G1GA 3CMEP 5HGNA 3LRYA 1VQLP 4HTWA 2KODA 5BS1A 5BS2A 4XFXA 2PY8A 4U0CA 3P05A 3B5IA 5DCKA 4PH1A 1VQ8P 2X82A 4PH0A 2PEKA 3MGEA 1A43A 2X2DD 4DGEC 3CCVP 1JJ2O 2WLVA 3HYBA 2EIAA 4WYMA 3CXCO 1S72P 1Q81Q 1QVGO 3CD6P 3CCUP 4J93A 3RG6C 3I55P 1W2BO 1QVFO 2BHVA 4E92A 3E2DA 1KC8Q 1EM9A 4XRQA 4E91A 1YI2P 4DGAC 1AUMA 1M9EC 3CMAP 1VQNP 1VQPP 3G1IA 2JYGA 3G4SP 1QRJA 2PEQA 3CCEP 3I56P 5HGOA 3H4EA 5HGKA 4LQWC 2XXMA 4COCA 1VQOP 1K73Q 2WLVB 1YITP 2Z45A 1ZMBA 1K8AQ 2M8LA 1M9DC 4INBA 3H47A 3DTJA 1YJWP 1K9MQ 4IPYA 3CCLP 3DS0A 5I4TG 2EFJA 2KGFA 1VQMP 3G28A 3CC4P 1VQ7P 3DS2A 2E1MA 4QNBA 3G21A 3M1MA 1M9CC 1EIAA 1KQSO 3CCMP 4GR2A 2OARA 1P7NA 2LF4A 2XV6A 4PH2A 3CCQP 2OTLP 1Q7YQ 1VQ9P 1M74A 2EG5A 2XGVA 2PXRC 3CCRP 2DGYA 2OTJP 3CPWO 2GONA 2XGUA 1N8RQ 1RO0A 1Q82Q 2XGYA 3BP9A 4U0DA 1K30A 3CCSP 4XFYA 2X83A 1EOQA 3G71P 1YJNP 1VQKP 4U0EA 2M8PA 4NX4C 2JYLA 3DS5A 3CC2P 2PEIA 2V4XA 4PH3A 3DS3A 3Q20A 3CC7P 2Y4ZA 3G26A 2P9XA 2GOLB 2QA4P 2XT1A 1M9YC 1VQ4P 3G29A 5F2KA 2Z44A 4B4NA 3CCJP 1YHQP 1VQ6P 2JO0A 1M90Q 1M9XC 1L6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U7K A;  2ONT A;  3VRL C;  3DS1 A;  1M9F C;  1D1D A;  4COP A;  2JPR A;  3DPH A;  1BAJ A;  1G03 A;  1A8O A;  3DS4 A;  1GWP A;  4U0F A;  4XRO A;  1AFV A;  4M0I A;  2PWM A;  1AK4 C;  4U0A A;  2BUO A;  5JPA A;  2L6E A;  4XFZ A;  1E6J P;  3G0V A;  5HGL A;  4U0B A;  2M8N A;  5HGM A;  3NTE A;  2XDE A;  2PWO A;  3G1G A;  5HGN A;  3LRY A;  4HTW A;  2KOD A;  4XFX A;  4U0C A;  3P05 A;  5DCK A;  4PH1 A;  2X82 A;  4PH0 A;  3MGE A;  1A43 A;  2X2D D;  4DGE C;  2WLV A;  2EIA A;  4WYM A;  4J93 A;  4E92 A;  1EM9 A;  4XRQ A;  4E91 A;  4DGA C;  1AUM A;  1M9E C;  3G1I A;  2JYG A;  1QRJ A;  5HGO A;  3H4E A;  5HGK A;  4LQW C;  2XXM A;  4COC A;  2WLV B;  2M8L A;  1M9D C;  4INB A;  3H47 A;  3DTJ A;  4IPY A;  3DS0 A;  5I4T G;  2KGF A;  3G28 A;  3DS2 A;  4QNB A;  3G21 A;  1M9C C;  1EIA A;  1P7N A;  2LF4 A;  2XV6 A;  4PH2 A;  2XGV A;  2PXR C;  2GON A;  2XGU A;  2XGY A;  3BP9 A;  4U0D A;  4XFY A;  2X83 A;  1EOQ A;  4U0E A;  2M8P A;  4NX4 C;  2JYL A;  3DS5 A;  2V4X A;  4PH3 A;  3DS3 A;  2Y4Z A;  3G26 A;  2GOL B;  2XT1 A;  1M9Y C;  3G29 A;  4B4N A;  2JO0 A;  1M9X C;  1L6N A; 
#chains in the Genus database with same CATH topology
 2CWO A;  3VRL C;  2AFD A;  2KGD A;  5EW5 E;  2JPR A;  5F2O A;  2KGA A;  1BAJ A;  1G03 A;  1A8O A;  1MZ8 A;  5KP7 B;  2VLO A;  2PEO A;  2VSQ A;  4H2W C;  2MVV A;  2VLN A;  2AVA A;  1Q86 Q;  2L6E A;  1E6J P;  2PEM A;  2XZ0 D;  4GR6 A;  5HGM A;  1YIJ P;  2XDE A;  2GZF A;  3G1G A;  2PEN A;  2KGE A;  5HGN A;  2GZI A;  4XFX A;  2PY8 A;  2FVF A;  1X3O A;  2K2Q A;  1CEI A;  1FR2 A;  2WLV A;  2EIA A;  4WYM A;  3CXC O;  2MY5 A;  5EJD A;  1L0I A;  3E2D A;  4XRQ A;  1E0H A;  1M9E C;  1VQP P;  3G1I A;  1QRJ A;  2KG6 A;  2XXM A;  4COC A;  2Z45 A;  4HKG A;  2FVE A;  4INB A;  3DTJ A;  1VHN A;  3CC4 P;  1VQM P;  2FHS C;  1M9C C;  4GR2 A;  2K0Y A;  2L4B A;  2ROQ A;  4PH2 A;  1Q7Y Q;  2EG5 A;  2XGV A;  3CCR P;  4BPF A;  4DG9 A;  4BPG A;  1N8R Q;  1T8K A;  2FQ0 A;  4U0D A;  1K30 A;  5HV8 A;  3CCS P;  4XFY A;  2JYL A;  3DS5 A;  2JAZ A;  2K0D X;  2Y4Z A;  2LIW A;  3LMO A;  1VQ4 P;  2K94 A;  2Z44 A;  4B4N A;  3CCJ P;  3EJE A;  2MVU A;  1U7K A;  3HZQ A;  2KG9 A;  3CE7 A;  1D1D A;  1AF8 A;  2AF8 A;  2LOL A;  4H2Y C;  1IMQ A;  1AFV A;  3OW2 O;  2PWM A;  2K93 A;  2GDY A;  4NEO A;  1AK4 C;  2BUO A;  4XFZ A;  3H0D A;  2CGQ A;  5HGL A;  1M1K Q;  2PEJ A;  3LRY A;  4HTW A;  2LPK A;  5CZD B;  4U0C A;  3B5I A;  2DNW A;  4PH0 A;  1HY8 A;  1A43 A;  2K5X A;  2JU1 A;  4DGE C;  2LTE A;  4R0M A;  2GZG A;  1S72 P;  2FAD A;  3CD6 P;  1W2B O;  2BHV A;  1EM9 A;  4E91 A;  2FAE A;  4PXH B;  1YI2 P;  1AUM A;  2KWL A;  2N6Z A;  3CMA P;  3CCE P;  2QNW A;  4LQW C;  4IZ6 A;  1ZMB A;  4F37 A;  1K8A Q;  1ZNV A;  1M9D C;  2N5I A;  4IPY A;  4PWV B;  1F80 D;  2EFJ A;  2KGF A;  2E1M A;  2GZJ A;  2L9F A;  3GKL C;  1EIA A;  2GDX A;  2OAR A;  2XV6 A;  2OTL P;  1GXG A;  2LL8 A;  4MRT C;  2N50 A;  2PXR C;  2DGY A;  2L0Q A;  2CNR A;  2PNG A;  1Q82 Q;  3BP9 A;  2X83 A;  1GXH A;  1VQK P;  2M8P A;  3GZL A;  2V4X A;  4PH3 A;  2KOQ A;  4CA3 A;  2K92 A;  5KP6 B;  2FQ1 A;  1YHQ P;  1M90 Q;  1M9X C;  1L6N A;  3DS1 A;  2KR5 A;  2ERH A;  2KOS A;  1M6N A;  1UJZ A;  3DS4 A;  1GWP A;  2Z46 A;  2LKI A;  5F2N A;  1M6E X;  3GJN A;  1Z6M A;  5JPA A;  3G0V A;  4BPH A;  1YJ9 P;  2KOR A;  2M8N A;  3NTE A;  2PWO A;  2GZE A;  4QKO A;  5BS2 A;  1GPJ A;  4PH1 A;  3RG2 A;  3GZM A;  2GDW A;  2PEK A;  3MGE A;  1JJ2 O;  3HYB A;  3EJD A;  1NQ4 A;  3RG6 C;  2KOP A;  4E92 A;  2CQ8 A;  4DGA C;  2AFE A;  2PEQ A;  5HGO A;  3H4E A;  5HGK A;  2WLV B;  1YIT P;  2M8L A;  2KG8 A;  1K9M Q;  5I4T G;  2KOO A;  1VQ7 P;  4QNB A;  1KQS O;  1BXI A;  1P7N A;  2LF4 A;  2FAC A;  1L0H A;  3EJB A;  2VLQ A;  3CPW O;  3NY7 B;  2GON A;  2XGU A;  1RO0 A;  2XGY A;  1UNK A;  1EOQ A;  2X2B A;  4U0E A;  4NX4 C;  3CC2 P;  4UHP B;  3CC7 P;  1KLP A;  2P9X A;  2GOL B;  2QA4 P;  2XT1 A;  2JBG A;  2JQ4 A;  1IMP A;  3G29 A;  2N6Y A;  2JO0 A;  2KW2 A;  2EHS A;  1RNI A;  2ONT A;  1VQ5 P;  1IUQ A;  1VKU A;  1DNY A;  5HVC A;  4H2X C;  1M9F C;  3WBH A;  4COP A;  3DPH A;  1ACP A;  1KD1 Q;  1RO2 A;  4U0F A;  4XRO A;  1AYI A;  4M0I A;  3G6E P;  2MF4 A;  2JU2 A;  2MD9 A;  4U0A A;  2QEX P;  3U43 A;  2EHT A;  2N5H A;  1NJI Q;  4U0B A;  1OR5 A;  3CME P;  1VQL P;  2KOD A;  5BS1 A;  5DCK A;  3P05 A;  1VQ8 P;  2X82 A;  2XZ1 C;  2X2D D;  3CCV P;  5KP8 B;  2MR8 A;  1Q81 Q;  1QVG O;  1EMV A;  3CCU P;  4J93 A;  2L22 A;  2WPT A;  3I55 P;  1QVF O;  1DV5 A;  1KC8 Q;  1VQN P;  2JYG A;  3G4S P;  3I56 P;  1K73 Q;  2M5R A;  1VQO P;  7CEI A;  2LIU A;  2K0X A;  2CG5 B;  3H47 A;  1YJW P;  3CCL P;  3DS0 A;  2LML A;  3G28 A;  3DS2 A;  3M1M A;  3G21 A;  3CCM P;  2MR7 A;  2JGP A;  3CCQ P;  3B4Q A;  1VQ9 P;  1M74 A;  2N98 A;  2OTJ P;  2JB0 A;  2GYK A;  2KGC A;  3G71 P;  1YJN P;  2FVA A;  2PEI A;  3DS3 A;  2FQ2 A;  3Q20 A;  3G26 A;  2VLP A;  1M9Y C;  2NO8 A;  5F2K A;  1HQB A;  1VQ6 P; 
#chains in the Genus database with same CATH homology
 1U7K A;  1RNI A;  2ONT A;  1VQ5 P;  1IUQ A;  2CWO A;  3VRL C;  3DS1 A;  3HZQ A;  1M9F C;  1D1D A;  3WBH A;  4COP A;  1M6N A;  2JPR A;  3DPH A;  5F2O A;  1KD1 Q;  1BAJ A;  1G03 A;  1A8O A;  1RO2 A;  1GWP A;  3DS4 A;  2Z46 A;  4U0F A;  5F2N A;  4XRO A;  1AFV A;  2PEO A;  1M6E X;  4M0I A;  3OW2 O;  2PWM A;  3G6E P;  1AK4 C;  1Q86 Q;  2QEX P;  4U0A A;  2BUO A;  5JPA A;  2L6E A;  4XFZ A;  1E6J P;  3G0V A;  3H0D A;  1NJI Q;  2PEM A;  1YJ9 P;  5HGL A;  4U0B A;  1M1K Q;  2M8N A;  4GR6 A;  5HGM A;  3NTE A;  1YIJ P;  2XDE A;  2PWO A;  2PEJ A;  2PEN A;  3G1G A;  3CME P;  5HGN A;  3LRY A;  1VQL P;  4HTW A;  2KOD A;  5BS1 A;  5BS2 A;  4XFX A;  2PY8 A;  4U0C A;  3P05 A;  3B5I A;  5DCK A;  4PH1 A;  1VQ8 P;  2X82 A;  4PH0 A;  2PEK A;  3MGE A;  1A43 A;  2X2D D;  4DGE C;  3CCV P;  1JJ2 O;  2WLV A;  3HYB A;  2EIA A;  4WYM A;  3CXC O;  1S72 P;  1Q81 Q;  1QVG O;  3CD6 P;  3CCU P;  4J93 A;  3RG6 C;  3I55 P;  1W2B O;  1QVF O;  2BHV A;  4E92 A;  3E2D A;  1KC8 Q;  1EM9 A;  4XRQ A;  4E91 A;  1YI2 P;  4DGA C;  1AUM A;  1M9E C;  3CMA P;  1VQN P;  1VQP P;  3G1I A;  2JYG A;  3G4S P;  1QRJ A;  2PEQ A;  3CCE P;  3I56 P;  5HGO A;  3H4E A;  5HGK A;  4LQW C;  2XXM A;  4COC A;  1VQO P;  1K73 Q;  2WLV B;  1YIT P;  2Z45 A;  1ZMB A;  1K8A Q;  2M8L A;  1M9D C;  4INB A;  3H47 A;  3DTJ A;  1YJW P;  1K9M Q;  4IPY A;  3CCL P;  3DS0 A;  5I4T G;  2EFJ A;  2KGF A;  1VQM P;  3G28 A;  3CC4 P;  1VQ7 P;  3DS2 A;  2E1M A;  4QNB A;  3G21 A;  3M1M A;  1M9C C;  1EIA A;  1KQS O;  3CCM P;  4GR2 A;  2OAR A;  1P7N A;  2LF4 A;  2XV6 A;  4PH2 A;  3CCQ P;  2OTL P;  1Q7Y Q;  1VQ9 P;  1M74 A;  2EG5 A;  2XGV A;  2PXR C;  3CCR P;  2DGY A;  2OTJ P;  3CPW O;  2GON A;  2XGU A;  1N8R Q;  1RO0 A;  1Q82 Q;  2XGY A;  3BP9 A;  4U0D A;  1K30 A;  3CCS P;  4XFY A;  2X83 A;  1EOQ A;  3G71 P;  1YJN P;  1VQK P;  4U0E A;  2M8P A;  4NX4 C;  2JYL A;  3DS5 A;  3CC2 P;  2PEI A;  2V4X A;  4PH3 A;  3DS3 A;  3Q20 A;  3CC7 P;  2Y4Z A;  3G26 A;  2P9X A;  2GOL B;  2QA4 P;  2XT1 A;  1M9Y C;  1VQ4 P;  3G29 A;  5F2K A;  2Z44 A;  4B4N A;  3CCJ P;  1YHQ P;  1VQ6 P;  2JO0 A;  1M90 Q;  1M9X C;  1L6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...