4U0EA

Hexameric hiv-1 ca in complex with pf3450074
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
209
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQETETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein p24
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
total genus 73
structure length 209
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0eA02
2M8PA 2X83A 2XGYA 3G26A 4XROA 4U0FA 5HGOA 5HGNA 2JO0A 5HGMA 3MGEA 4U0AA 2L6EA 3BP9A 4XFYA 1QRJA 3G0VA 2JYGA 3G29A 2M8LA 3G21A 1M9FC 1E6JP 2KODA 4PH0A 2EIAA 4WYMA 2WLVB 4HTWA 2ONTA 1GWPA 3DS2A 4COPA 3G28A 2GOLB 3H4EA 4J93A 2BUOA 3G1GA 1M9DC 1AK4C 3NTEA 4PH3A 3DS0A 1EOQA 4DGAC 4B4NA 1P7NA 1L6NA 4PH2A 4E91A 2XXMA 1M9EC 1D1DA 1EIAA 1A8OA 2XT1A 2JYLA 2XGUA 3P05A 3LRYA 2PWOA 2WLVA 1M9XC 4IPYA 1M9YC 3DS1A 2XGVA 2M8NA 3DS5A 3DS4A 4INBA 2KGFA 2PXRC 4QNBA 4U0EA 3G1IA 5I4TG 4NX4C 3DTJA 2JPRA 3DPHA 1A43A 4XFXA 2XDEA 2XV6A 4LQWC 1AUMA 2V4XA 4COCA 4U0DA 2X82A 4XFZA 2LF4A 1U7KA 3VRLC 2X2DD 1BAJA 2GONA 4U0BA 5HGLA 4XRQA 1M9CC 4E92A 4DGEC 1AFVA 2PWMA 4PH1A 5DCKA 4M0IA 5HGKA 1EM9A 4U0CA 3DS3A 5JPAA 1G03A 3H47A 2Y4ZA
chains in the Genus database with same CATH superfamily
2AF8A 2X83A 3G26A 2VLNA 5HGOA 5HGNA 2LIWA 4PXHB 4IZ6A 2JU1A 2VSQA 3BP9A 2KW2A 1BXIA 2N6ZA 1Z6MA 1X3OA 3G0VA 3CC4P 3CCEP 3LMOA 2FVFA 1Q82Q 1E6JP 3DS2A 1M6NA 2EFJA 3HZQA 1YJNP 1GXHA 2GDYA 3G71P 5CZDB 3M1MA 5KP8B 3CCRP 2ROQA 2KGCA 1RO2A 3HYBA 3G1GA 1M9DC 5KP7B 2OTLP 1AYIA 2E1MA 3EJDA 2XXMA 1EIAA 1A8OA 1ZNVA 1UJZA 1VQ5P 2WLVA 3I56P 1M9XC 1Q81Q 1M9YC 2JAZA 2L9FA 2XGVA 2GDWA 2JU2A 3RG2A 3B4QA 2PXRC 3G1IA 3NY7B 7CEIA 1RO0A 1M74A 1VKUA 1T8KA 3CCSP 1A43A 4XFXA 2XDEA 2JGPA 2CG5B 2KOPA 4H2XC 2OTJP 2L22A 3VRLC 3CD6P 1BAJA 1M6EX 2PNGA 4U0BA 4XRQA 4H2WC 4DGEC 3CPWO 2KOQA 5DCKA 2N50A 5HGKA 1E0HA 2N5HA 3DS3A 3GZLA 2EHSA 2FVAA 3U43A 2GYKA 2JBGA 1DV5A 2N98A 2M8PA 1K73Q 2CQ8A 1IMPA 2OARA 4NEOA 2MD9A 2P9XA 5HGMA 1M90Q 2AFEA 1NJIQ 2M8LA 1IUQA 1M9FC 2FAEA 3G6EP 4WYMA 2WLVB 2ONTA 2GDXA 2FQ1A 2PEKA 2Z45A 2KOSA 4J93A 1L0IA 2LIUA 1ZMBA 3I55P 3NTEA 1EOQA 2AVAA 2K0YA 3CMEP 5F2OA 4E91A 1D1DA 3H0DA 2XGUA 3P05A 2Z44A 2PEMA 2M8NA 1GXGA 2L4BA 1QVGO 3GKLC 2PY8A 4UHPB 2ERHA 1YI2P 2KGFA 4U0EA 2GZIA 1VQMP 3GZMA 4NX4C 3DPHA 1W2BO 5EW5E 3EJEA 4COCA 2BHVA 3EJBA 2LF4A 1VQKP 1AF8A 1FR2A 1VQ9P 3CC2P 2GZGA 3CXCO 1M9CC 2LOLA 4BPHA 1AFVA 5HV8A 4F37A 1NQ4A 2KR5A 1GPJA 5JPAA 3H47A 2MY5A 2Y4ZA 1KC8Q 1VQOP 2CWOA 4H2YC 4XROA 2GZEA 4U0FA 2KG8A 5BS2A 2JO0A 3CCUP 1Q86Q 3MGEA 1IMQA 2FQ0A 2L6EA 2KG9A 4XFYA 1UNKA 2VLQA 1QRJA 2JYGA 3G29A 5HVCA 3WBHA 3E2DA 2KODA 2EIAA 4COPA 1GWPA 1HY8A 2JQ4A 2N6YA 2QNWA 5BS1A 2PENA 5F2KA 2FVEA 3CCVP 4PH3A 4BPFA 5KP6B 1RNIA 3DS0A 3CCMP 4B4NA 1VQ4P 2GZJA 1P7NA 1M1KQ 4PH2A 2XZ1C 1M9EC 2N5IA 2LMLA 2MVUA 1DNYA 4IPYA 2LPKA 2LKIA 1S72P 3DS1A 2PEIA 1KD1Q 1VQ7P 2EG5A 3DS5A 2K5XA 1VQPP 4INBA 2KGEA 2X2BA 2PEOA 5I4TG 1L0HA 1YITP 2MR8A 3DTJA 3GJNA 1YJWP 2KWLA 3G4SP 2XV6A 4LQWC 1AUMA 4U0DA 2X82A 4XFZA 2DNWA 2GZFA 1CEIA 3CCLP 1HQBA 2X2DD 2LTEA 2DGYA 3CCJP 2VLPA 3RG6C 2NO8A 1OR5A 1MZ8A 2KGDA 4E92A 2L0QA 4MRTC 2FADA 4M0IA 1EM9A 1EMVA 2KOOA 2JYLA 4CA3A 1VQNP 2XGYA 2CNRA 4GR6A 1YJ9P 4U0AA 2K93A 2JB0A 2Z46A 1N8RQ 1QVFO 3G21A 2FACA 2K92A 2PEQA 4PH0A 4HTWA 1F80D 2K0XA 2FQ2A 2MR7A 3G28A 2K2QA 2WPTA 2VLOA 2GOLB 3H4EA 1K9MQ 2BUOA 1Q7YQ 2LL8A 1AK4C 1K30A 1VHNA 5EJDA 4DGAC 1L6NA 4GR2A 5F2NA 2K94A 2KGAA 3CE7A 2XT1A 1ACPA 2FHSC 2QA4P 3CC7P 4PWVB 3LRYA 2PWOA 2CGQA 3OW2O 2AFDA 2KORA 4QKOA 1YHQP 3DS4A 4QNBA 2MVVA 1JJ2O 4BPGA 2MF4A 2EHTA 2JPRA 2K0DX 1K8AQ 3Q20A 2KG6A 2V4XA 1VQLP 4HKGA 1U7KA 1VQ8P 3CCQP 3B5IA 2QEXP 1KLPA 2PEJA 2GONA 5HGLA 1VQ6P 4R0MA 3CMAP 2M5RA 2PWMA 4PH1A 4DG9A 1KQSO 4U0CA 1YIJP 1G03A 2XZ0D
chains in the Genus database with same CATH topology
1VQOP 2M8PA 2X83A 1VQNP 2XGYA 3G26A 1K73Q 2OARA 2CWOA 4XROA 4GR6A 4U0FA 5HGOA 5HGNA 5BS2A 1YJ9P 2JO0A 2P9XA 3CCUP 5HGMA 3MGEA 1Q86Q 1M90Q 4U0AA 2L6EA 3BP9A 4XFYA 1NJIQ 2Z46A 1N8RQ 1QVFO 1QRJA 3G0VA 2JYGA 3G29A 2M8LA 3G21A 3CC4P 3CCEP 1IUQA 1Q82Q 3WBHA 1M9FC 3E2DA 1E6JP 2KODA 2PEQA 3G6EP 4PH0A 2EIAA 4WYMA 2WLVB 4HTWA 2ONTA 1GWPA 2PEKA 3DS2A 4COPA 1M6NA 2EFJA 3HZQA 3G28A 1YJNP 5BS1A 2Z45A 3G71P 3M1MA 3CCRP 2PENA 2GOLB 3H4EA 4J93A 1RO2A 1K9MQ 3HYBA 2BUOA 3G1GA 1M9DC 5F2KA 1Q7YQ 2OTLP 1ZMBA 3I55P 1AK4C 3CCVP 3NTEA 2E1MA 4PH3A 1K30A 1RNIA 3DS0A 1EOQA 4DGAC 3CCMP 4B4NA 1VQ4P 1P7NA 1L6NA 4PH2A 4GR2A 5F2NA 1M1KQ 3CMEP 5F2OA 4E91A 2XXMA 1M9EC 1D1DA 1EIAA 1A8OA 2XT1A 3H0DA 2QA4P 2JYLA 3CC7P 2XGUA 3P05A 1VQ5P 3LRYA 2PWOA 2WLVA 3I56P 1M9XC 4IPYA 1Q81Q 3OW2O 1M9YC 1S72P 2Z44A 3DS1A 2PEMA 2PEIA 1KD1Q 1VQ7P 2XGVA 2M8NA 2EG5A 3DS5A 1QVGO 1VQPP 2PY8A 1YHQP 1YI2P 3DS4A 4INBA 2KGFA 2PXRC 4QNBA 4U0EA 3G1IA 1RO0A 2PEOA 5I4TG 1JJ2O 1VQMP 1M74A 1YITP 4NX4C 3DTJA 1YJWP 3CCSP 2JPRA 3DPHA 3G4SP 1A43A 1W2BO 1K8AQ 4XFXA 2XDEA 3Q20A 2XV6A 4LQWC 1AUMA 2V4XA 4COCA 4U0DA 2X82A 2OTJP 4XFZA 1VQLP 2BHVA 2LF4A 1U7KA 1VQ8P 3CCLP 1VQKP 3VRLC 3CD6P 2X2DD 3CCQP 3B5IA 1BAJA 2QEXP 1VQ9P 2PEJA 1M6EX 2DGYA 3CC2P 3CCJP 2GONA 4U0BA 5HGLA 4XRQA 1VQ6P 3RG6C 3CXCO 1M9CC 3CMAP 4E92A 4DGEC 3CPWO 1AFVA 1KC8Q 2PWMA 4PH1A 5DCKA 4M0IA 1KQSO 5HGKA 1EM9A 4U0CA 3DS3A 1YIJP 5JPAA 1G03A 3H47A 2Y4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M8P A;  2X83 A;  2XGY A;  3G26 A;  4XRO A;  4U0F A;  5HGO A;  5HGN A;  2JO0 A;  5HGM A;  3MGE A;  4U0A A;  2L6E A;  3BP9 A;  4XFY A;  1QRJ A;  3G0V A;  2JYG A;  3G29 A;  2M8L A;  3G21 A;  1M9F C;  1E6J P;  2KOD A;  4PH0 A;  2EIA A;  4WYM A;  2WLV B;  4HTW A;  2ONT A;  1GWP A;  3DS2 A;  4COP A;  3G28 A;  2GOL B;  3H4E A;  4J93 A;  2BUO A;  3G1G A;  1M9D C;  1AK4 C;  3NTE A;  4PH3 A;  3DS0 A;  1EOQ A;  4DGA C;  4B4N A;  1P7N A;  1L6N A;  4PH2 A;  4E91 A;  2XXM A;  1M9E C;  1D1D A;  1EIA A;  1A8O A;  2XT1 A;  2JYL A;  2XGU A;  3P05 A;  3LRY A;  2PWO A;  2WLV A;  1M9X C;  4IPY A;  1M9Y C;  3DS1 A;  2XGV A;  2M8N A;  3DS5 A;  3DS4 A;  4INB A;  2KGF A;  2PXR C;  4QNB A;  4U0E A;  3G1I A;  5I4T G;  4NX4 C;  3DTJ A;  2JPR A;  3DPH A;  1A43 A;  4XFX A;  2XDE A;  2XV6 A;  4LQW C;  1AUM A;  2V4X A;  4COC A;  4U0D A;  2X82 A;  4XFZ A;  2LF4 A;  1U7K A;  3VRL C;  2X2D D;  1BAJ A;  2GON A;  4U0B A;  5HGL A;  4XRQ A;  1M9C C;  4E92 A;  4DGE C;  1AFV A;  2PWM A;  4PH1 A;  5DCK A;  4M0I A;  5HGK A;  1EM9 A;  4U0C A;  3DS3 A;  5JPA A;  1G03 A;  3H47 A;  2Y4Z A; 
#chains in the Genus database with same CATH topology
 2AF8 A;  2X83 A;  3G26 A;  2VLN A;  5HGO A;  5HGN A;  2LIW A;  4PXH B;  4IZ6 A;  2JU1 A;  2VSQ A;  3BP9 A;  2KW2 A;  1BXI A;  2N6Z A;  1Z6M A;  1X3O A;  3G0V A;  3CC4 P;  3CCE P;  3LMO A;  2FVF A;  1Q82 Q;  1E6J P;  3DS2 A;  1M6N A;  2EFJ A;  3HZQ A;  1YJN P;  1GXH A;  2GDY A;  3G71 P;  5CZD B;  3M1M A;  5KP8 B;  3CCR P;  2ROQ A;  2KGC A;  1RO2 A;  3HYB A;  3G1G A;  1M9D C;  5KP7 B;  2OTL P;  1AYI A;  2E1M A;  3EJD A;  2XXM A;  1EIA A;  1A8O A;  1ZNV A;  1UJZ A;  1VQ5 P;  2WLV A;  3I56 P;  1M9X C;  1Q81 Q;  1M9Y C;  2JAZ A;  2L9F A;  2XGV A;  2GDW A;  2JU2 A;  3RG2 A;  3B4Q A;  2PXR C;  3G1I A;  3NY7 B;  7CEI A;  1RO0 A;  1M74 A;  1VKU A;  1T8K A;  3CCS P;  1A43 A;  4XFX A;  2XDE A;  2JGP A;  2CG5 B;  2KOP A;  4H2X C;  2OTJ P;  2L22 A;  3VRL C;  3CD6 P;  1BAJ A;  1M6E X;  2PNG A;  4U0B A;  4XRQ A;  4H2W C;  4DGE C;  3CPW O;  2KOQ A;  5DCK A;  2N50 A;  5HGK A;  1E0H A;  2N5H A;  3DS3 A;  3GZL A;  2EHS A;  2FVA A;  3U43 A;  2GYK A;  2JBG A;  1DV5 A;  2N98 A;  2M8P A;  1K73 Q;  2CQ8 A;  1IMP A;  2OAR A;  4NEO A;  2MD9 A;  2P9X A;  5HGM A;  1M90 Q;  2AFE A;  1NJI Q;  2M8L A;  1IUQ A;  1M9F C;  2FAE A;  3G6E P;  4WYM A;  2WLV B;  2ONT A;  2GDX A;  2FQ1 A;  2PEK A;  2Z45 A;  2KOS A;  4J93 A;  1L0I A;  2LIU A;  1ZMB A;  3I55 P;  3NTE A;  1EOQ A;  2AVA A;  2K0Y A;  3CME P;  5F2O A;  4E91 A;  1D1D A;  3H0D A;  2XGU A;  3P05 A;  2Z44 A;  2PEM A;  2M8N A;  1GXG A;  2L4B A;  1QVG O;  3GKL C;  2PY8 A;  4UHP B;  2ERH A;  1YI2 P;  2KGF A;  4U0E A;  2GZI A;  1VQM P;  3GZM A;  4NX4 C;  3DPH A;  1W2B O;  5EW5 E;  3EJE A;  4COC A;  2BHV A;  3EJB A;  2LF4 A;  1VQK P;  1AF8 A;  1FR2 A;  1VQ9 P;  3CC2 P;  2GZG A;  3CXC O;  1M9C C;  2LOL A;  4BPH A;  1AFV A;  5HV8 A;  4F37 A;  1NQ4 A;  2KR5 A;  1GPJ A;  5JPA A;  3H47 A;  2MY5 A;  2Y4Z A;  1KC8 Q;  1VQO P;  2CWO A;  4H2Y C;  4XRO A;  2GZE A;  4U0F A;  2KG8 A;  5BS2 A;  2JO0 A;  3CCU P;  1Q86 Q;  3MGE A;  1IMQ A;  2FQ0 A;  2L6E A;  2KG9 A;  4XFY A;  1UNK A;  2VLQ A;  1QRJ A;  2JYG A;  3G29 A;  5HVC A;  3WBH A;  3E2D A;  2KOD A;  2EIA A;  4COP A;  1GWP A;  1HY8 A;  2JQ4 A;  2N6Y A;  2QNW A;  5BS1 A;  2PEN A;  5F2K A;  2FVE A;  3CCV P;  4PH3 A;  4BPF A;  5KP6 B;  1RNI A;  3DS0 A;  3CCM P;  4B4N A;  1VQ4 P;  2GZJ A;  1P7N A;  1M1K Q;  4PH2 A;  2XZ1 C;  1M9E C;  2N5I A;  2LML A;  2MVU A;  1DNY A;  4IPY A;  2LPK A;  2LKI A;  1S72 P;  3DS1 A;  2PEI A;  1KD1 Q;  1VQ7 P;  2EG5 A;  3DS5 A;  2K5X A;  1VQP P;  4INB A;  2KGE A;  2X2B A;  2PEO A;  5I4T G;  1L0H A;  1YIT P;  2MR8 A;  3DTJ A;  3GJN A;  1YJW P;  2KWL A;  3G4S P;  2XV6 A;  4LQW C;  1AUM A;  4U0D A;  2X82 A;  4XFZ A;  2DNW A;  2GZF A;  1CEI A;  3CCL P;  1HQB A;  2X2D D;  2LTE A;  2DGY A;  3CCJ P;  2VLP A;  3RG6 C;  2NO8 A;  1OR5 A;  1MZ8 A;  2KGD A;  4E92 A;  2L0Q A;  4MRT C;  2FAD A;  4M0I A;  1EM9 A;  1EMV A;  2KOO A;  2JYL A;  4CA3 A;  1VQN P;  2XGY A;  2CNR A;  4GR6 A;  1YJ9 P;  4U0A A;  2K93 A;  2JB0 A;  2Z46 A;  1N8R Q;  1QVF O;  3G21 A;  2FAC A;  2K92 A;  2PEQ A;  4PH0 A;  4HTW A;  1F80 D;  2K0X A;  2FQ2 A;  2MR7 A;  3G28 A;  2K2Q A;  2WPT A;  2VLO A;  2GOL B;  3H4E A;  1K9M Q;  2BUO A;  1Q7Y Q;  2LL8 A;  1AK4 C;  1K30 A;  1VHN A;  5EJD A;  4DGA C;  1L6N A;  4GR2 A;  5F2N A;  2K94 A;  2KGA A;  3CE7 A;  2XT1 A;  1ACP A;  2FHS C;  2QA4 P;  3CC7 P;  4PWV B;  3LRY A;  2PWO A;  2CGQ A;  3OW2 O;  2AFD A;  2KOR A;  4QKO A;  1YHQ P;  3DS4 A;  4QNB A;  2MVV A;  1JJ2 O;  4BPG A;  2MF4 A;  2EHT A;  2JPR A;  2K0D X;  1K8A Q;  3Q20 A;  2KG6 A;  2V4X A;  1VQL P;  4HKG A;  1U7K A;  1VQ8 P;  3CCQ P;  3B5I A;  2QEX P;  1KLP A;  2PEJ A;  2GON A;  5HGL A;  1VQ6 P;  4R0M A;  3CMA P;  2M5R A;  2PWM A;  4PH1 A;  4DG9 A;  1KQS O;  4U0C A;  1YIJ P;  1G03 A;  2XZ0 D; 
#chains in the Genus database with same CATH homology
 1VQO P;  2M8P A;  2X83 A;  1VQN P;  2XGY A;  3G26 A;  1K73 Q;  2OAR A;  2CWO A;  4XRO A;  4GR6 A;  4U0F A;  5HGO A;  5HGN A;  5BS2 A;  1YJ9 P;  2JO0 A;  2P9X A;  3CCU P;  5HGM A;  3MGE A;  1Q86 Q;  1M90 Q;  4U0A A;  2L6E A;  3BP9 A;  4XFY A;  1NJI Q;  2Z46 A;  1N8R Q;  1QVF O;  1QRJ A;  3G0V A;  2JYG A;  3G29 A;  2M8L A;  3G21 A;  3CC4 P;  3CCE P;  1IUQ A;  1Q82 Q;  3WBH A;  1M9F C;  3E2D A;  1E6J P;  2KOD A;  2PEQ A;  3G6E P;  4PH0 A;  2EIA A;  4WYM A;  2WLV B;  4HTW A;  2ONT A;  1GWP A;  2PEK A;  3DS2 A;  4COP A;  1M6N A;  2EFJ A;  3HZQ A;  3G28 A;  1YJN P;  5BS1 A;  2Z45 A;  3G71 P;  3M1M A;  3CCR P;  2PEN A;  2GOL B;  3H4E A;  4J93 A;  1RO2 A;  1K9M Q;  3HYB A;  2BUO A;  3G1G A;  1M9D C;  5F2K A;  1Q7Y Q;  2OTL P;  1ZMB A;  3I55 P;  1AK4 C;  3CCV P;  3NTE A;  2E1M A;  4PH3 A;  1K30 A;  1RNI A;  3DS0 A;  1EOQ A;  4DGA C;  3CCM P;  4B4N A;  1VQ4 P;  1P7N A;  1L6N A;  4PH2 A;  4GR2 A;  5F2N A;  1M1K Q;  3CME P;  5F2O A;  4E91 A;  2XXM A;  1M9E C;  1D1D A;  1EIA A;  1A8O A;  2XT1 A;  3H0D A;  2QA4 P;  2JYL A;  3CC7 P;  2XGU A;  3P05 A;  1VQ5 P;  3LRY A;  2PWO A;  2WLV A;  3I56 P;  1M9X C;  4IPY A;  1Q81 Q;  3OW2 O;  1M9Y C;  1S72 P;  2Z44 A;  3DS1 A;  2PEM A;  2PEI A;  1KD1 Q;  1VQ7 P;  2XGV A;  2M8N A;  2EG5 A;  3DS5 A;  1QVG O;  1VQP P;  2PY8 A;  1YHQ P;  1YI2 P;  3DS4 A;  4INB A;  2KGF A;  2PXR C;  4QNB A;  4U0E A;  3G1I A;  1RO0 A;  2PEO A;  5I4T G;  1JJ2 O;  1VQM P;  1M74 A;  1YIT P;  4NX4 C;  3DTJ A;  1YJW P;  3CCS P;  2JPR A;  3DPH A;  3G4S P;  1A43 A;  1W2B O;  1K8A Q;  4XFX A;  2XDE A;  3Q20 A;  2XV6 A;  4LQW C;  1AUM A;  2V4X A;  4COC A;  4U0D A;  2X82 A;  2OTJ P;  4XFZ A;  1VQL P;  2BHV A;  2LF4 A;  1U7K A;  1VQ8 P;  3CCL P;  1VQK P;  3VRL C;  3CD6 P;  2X2D D;  3CCQ P;  3B5I A;  1BAJ A;  2QEX P;  1VQ9 P;  2PEJ A;  1M6E X;  2DGY A;  3CC2 P;  3CCJ P;  2GON A;  4U0B A;  5HGL A;  4XRQ A;  1VQ6 P;  3RG6 C;  3CXC O;  1M9C C;  3CMA P;  4E92 A;  4DGE C;  3CPW O;  1AFV A;  1KC8 Q;  2PWM A;  4PH1 A;  5DCK A;  4M0I A;  1KQS O;  5HGK A;  1EM9 A;  4U0C A;  3DS3 A;  1YIJ P;  5JPA A;  1G03 A;  3H47 A;  2Y4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...