4U0EA

Hexameric hiv-1 ca in complex with pf3450074
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
219
structure length
209
Chain Sequence
PIVQNQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFSALSCGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQETETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Host Cofactors and Pharmacologic Ligands Share an Essential Interface in HIV-1 Capsid That Is Lost upon Disassembly.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 group m subtype b
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 73
structure length 209
sequence length 219
ec nomenclature
pdb deposition date 2014-07-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4u0eA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4u0eA02
5DCKA 1M9YC 4LQWC 3DS2A 4DGEC 3G0VA 2XDEA 3DS3A 2Y4ZA 1GWPA 2PWOA 4U0BA 3G1IA 4M0IA 3G21A 3G1GA 2XGYA 1M9EC 4U0EA 2JYGA 2M8PA 1AFVA 2XT1A 2M8NA 3DS1A 3DS0A 4COCA 2JO0A 5HGLA 2BUOA 3LRYA 1M9CC 4WYMA 1D1DA 2L6EA 1EM9A 2XXMA 4PH1A 2WLVB 3DTJA 2PXRC 4COPA 1A43A 1BAJA 2XV6A 4XRQA 3H47A 5HGNA 1L6NA 3P05A 2WLVA 5HGMA 4DGAC 3NTEA 2LF4A 3MGEA 4HTWA 1EIAA 3G29A 2ONTA 4XFZA 2GOLB 2EIAA 1E6JP 2XGUA 4U0DA 4U0CA 3BP9A 4XROA 3G28A 5I4TG 3DS4A 1M9XC 5HGKA 4B4NA 4E92A 4U0FA 2KGFA 2GONA 2X2DD 2XGVA 2V4XA 4QNBA 1U7KA 1P7NA 4IPYA 1AK4C 4J93A 1EOQA 3H4EA 5HGOA 4PH3A 4XFYA 4U0AA 3G26A 4INBA 2X83A 4E91A 1AUMA 4NX4C 2PWMA 3DS5A 1M9DC 3VRLC 4PH2A 2M8LA 1G03A 2KODA 4PH0A 2X82A 3DPHA 1A8OA 1QRJA 5JPAA 4XFXA 2JYLA 2JPRA 1M9FC
chains in the Genus database with same CATH superfamily
1M74A 1M9YC 2FACA 2K0DX 4LQWC 2Y4ZA 3HZQA 4U0BA 3G1IA 4M0IA 2M5RA 1ZNVA 2JYGA 3DS0A 2N98A 1YJ9P 2GZFA 2KGAA 1HY8A 1K73Q 2KOQA 2XXMA 2KOOA 3CPWO 2WLVB 4H2WC 3DTJA 2PXRC 2ROQA 3I55P 4CA3A 1BAJA 1GXGA 2DNWA 4XRQA 1VQKP 2CGQA 4GR6A 3RG6C 5HGMA 1VQLP 4HTWA 2ONTA 5F2NA 4PXHB 1E6JP 2JQ4A 2EHTA 3GJNA 3BP9A 4XROA 4UHPB 2MY5A 5I4TG 3DS4A 1CEIA 4B4NA 2ERHA 4E92A 2GONA 2E1MA 5HV8A 2X2DD 2XGVA 2V4XA 4QKOA 2Z46A 2N6YA 3CCQP 2NO8A 4NEOA 2K93A 1VQOP 4J93A 1EOQA 2Z44A 1M90Q 1VQ6P 2PY8A 4U0AA 3G26A 3GZLA 3CC2P 2GDXA 2PWMA 2KW2A 3E2DA 2LIWA 4PH2A 2KGCA 2N6ZA 1A8OA 2AFEA 5KP7B 1M6EX 2AFDA 2EHSA 2MR8A 5F2OA 3M1MA 1UJZA 1VQMP 1IMQA 5CZDB 4GR2A 3DS3A 1GWPA 1ACPA 2PWOA 4BPFA 1Q82Q 2CG5B 2M8PA 1L0HA 2JO0A 2VLPA 5HGLA 5KP8B 2BUOA 3LRYA 1W2BO 2K0YA 3EJEA 1M9CC 1D1DA 3G6EP 2L4BA 1X3OA 3CCEP 1ZMBA 1VQ5P 1YHQP 2K92A 3HYBA 1IUQA 5EW5E 3H47A 5HGNA 2L9FA 4F37A 1VQNP 2GZGA 3CC4P 2JB0A 1QVGO 1AF8A 2EIAA 2XGUA 2GDWA 4U0DA 2GZEA 2N50A 1M6NA 2JU2A 1YJWP 1N8RQ 1M9XC 3EJDA 2FAEA 4U0FA 2GZJA 2OTLP 2KGFA 2MF4A 4R0MA 1YITP 1IMPA 4BPGA 1RO0A 1F80D 2KORA 4IPYA 2GDYA 3CCLP 2N5HA 3CCMP 2WPTA 2X2BA 3CCUP 2FVAA 4INBA 2X83A 4E91A 2PEJA 1AUMA 4NX4C 1MZ8A 1M9DC 2LPKA 2GYKA 1K30A 2KGDA 1M1KQ 1GXHA 4PH0A 2X82A 1GPJA 2LKIA 1QRJA 5JPAA 4XFXA 2JGPA 2JYLA 1S72P 2OARA 5DCKA 2VLNA 2FVFA 2KWLA 3CCJP 4H2XC 2L22A 3WBHA 3DS2A 2GZIA 2N5IA 1VQ4P 3H0DA 1KC8Q 1DV5A 1Q86Q 2JAZA 2AF8A 3G21A 1JJ2O 1K8AQ 2XGYA 2KG9A 2K5XA 3B5IA 1AFVA 2XT1A 3DS1A 4COCA 1HQBA 2CWOA 5BS2A 1EM9A 2KG8A 4PH1A 1DNYA 1L0IA 2XV6A 3G71P 2MVVA 2K2QA 3U43A 3P05A 4HKGA 2LF4A 3MGEA 2MR7A 3G29A 4XFZA 2GOLB 2K0XA 4U0CA 2PEMA 2KOSA 2KOPA 1YI2P 3G28A 2PEOA 1FR2A 2KGEA 2FQ2A 3CCRP 5KP6B 2BHVA 4QNBA 5HVCA 2EFJA 1VQ9P 1P7NA 1Z6MA 2LMLA 2QEXP 2VLOA 2FADA 2EG5A 2JU1A 2VLQA 5HGOA 4XFYA 3VRLC 4IZ6A 4DG9A 1OR5A 1RNIA 2M8LA 2LL8A 3CMAP 1G03A 2QA4P 1NJIQ 5F2KA 2MD9A 3CXCO 1EMVA 2KG6A 2LOLA 1M9FC 3RG2A 4H2YC 5EJDA 3GZMA 3Q20A 3I56P 2LIUA 2CQ8A 2LTEA 4DGEC 2FHSC 3G0VA 1VQ8P 2XDEA 2P9XA 2K94A 1E0HA 2L0QA 1VQ7P 1VKUA 3G1GA 1T8KA 1M9EC 1Q81Q 4U0EA 2M8NA 1QVFO 1KQSO 4PWVB 2PEKA 2FVEA 4WYMA 2L6EA 1UNKA 3CC7P 1NQ4A 1K9MQ 2Z45A 3CCVP 3B4QA 4MRTC 2VSQA 3CMEP 4COPA 1A43A 2CNRA 1L6NA 2WLVA 3NY7B 3LMOA 4DGAC 3NTEA 2PNGA 4BPHA 1BXIA 7CEIA 1EIAA 2XZ0D 1RO2A 1VQPP 5HGKA 2DGYA 2OTJP 2FQ1A 3OW2O 1AYIA 1Q7YQ 3G4SP 1U7KA 3EJBA 1KLPA 1AK4C 3CD6P 3H4EA 2AVAA 1YJNP 2KR5A 2PEQA 2PEIA 2XZ1C 4PH3A 2MVUA 2QNWA 3CE7A 3DS5A 2PENA 1VHNA 2KODA 3DPHA 2FQ0A 1KD1Q 5BS1A 3CCSP 2JBGA 2JPRA 1YIJP 3GKLC
chains in the Genus database with same CATH topology
1M74A 5DCKA 1M9YC 5F2OA 3CCJP 3M1MA 3Q20A 3I56P 3WBHA 1VQMP 4LQWC 3DS2A 4DGEC 3G0VA 1VQ4P 1VQ8P 2XDEA 2P9XA 3H0DA 4GR2A 1KC8Q 3DS3A 1Q86Q 2Y4ZA 3HZQA 1GWPA 1VQ7P 2PWOA 4U0BA 3G1IA 4M0IA 3G21A 1JJ2O 3G1GA 2XGYA 1Q81Q 1M9EC 1K8AQ 3B5IA 1Q82Q 4U0EA 2JYGA 2M8PA 1AFVA 2XT1A 2M8NA 1QVFO 3DS1A 3DS0A 4COCA 2JO0A 1YJ9P 5HGLA 1KQSO 2BUOA 2PEKA 2CWOA 3LRYA 1W2BO 5BS2A 1M9CC 4WYMA 1D1DA 3G6EP 2L6EA 1K73Q 1EM9A 3CC7P 2XXMA 3CCEP 1ZMBA 1K9MQ 4PH1A 3CPWO 2WLVB 2Z45A 3CCVP 1VQ5P 1YHQP 3DTJA 2PXRC 3I55P 3CMEP 4COPA 1A43A 1BAJA 3HYBA 2XV6A 1IUQA 3G71P 4XRQA 3H47A 5HGNA 1VQKP 1L6NA 4GR6A 3P05A 2WLVA 3RG6C 1VQNP 5HGMA 4DGAC 3NTEA 2LF4A 3CC4P 3MGEA 1VQLP 1QVGO 4HTWA 1EIAA 3G29A 2ONTA 4XFZA 5F2NA 2GOLB 2EIAA 1E6JP 2XGUA 4U0DA 4U0CA 2PEMA 1M6NA 1YI2P 1YJWP 3BP9A 4XROA 3G28A 5I4TG 1N8RQ 1RO2A 3DS4A 1VQPP 1M9XC 5HGKA 2DGYA 2PEOA 4B4NA 2OTJP 3OW2O 4E92A 4U0FA 2OTLP 2KGFA 2GONA 2E1MA 2X2DD 1YITP 3CCRP 2XGVA 2BHVA 2V4XA 1Q7YQ 2Z46A 4QNBA 3G4SP 1RO0A 2EFJA 1U7KA 1VQ9P 1P7NA 3CC2P 4IPYA 3CCQP 3CCLP 2QEXP 3CCMP 1AK4C 2EG5A 4J93A 1VQOP 3CD6P 1EOQA 2Z44A 3H4EA 1M90Q 1YJNP 2PEQA 2PEIA 5HGOA 3CCUP 4PH3A 4XFYA 1VQ6P 2PY8A 4U0AA 3G26A 4INBA 2X83A 4E91A 1AUMA 4NX4C 2PWMA 2PEJA 1M9DC 2PENA 3DS5A 3E2DA 1K30A 4PH2A 1RNIA 2M8LA 3VRLC 3CMAP 1G03A 2QA4P 1M1KQ 1NJIQ 2KODA 4PH0A 2X82A 3DPHA 1A8OA 1KD1Q 1QRJA 5JPAA 5F2KA 5BS1A 1M6EX 3CCSP 4XFXA 2JYLA 2JPRA 3CXCO 1S72P 1YIJP 1M9FC 2OARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DCK A;  1M9Y C;  4LQW C;  3DS2 A;  4DGE C;  3G0V A;  2XDE A;  3DS3 A;  2Y4Z A;  1GWP A;  2PWO A;  4U0B A;  3G1I A;  4M0I A;  3G21 A;  3G1G A;  2XGY A;  1M9E C;  4U0E A;  2JYG A;  2M8P A;  1AFV A;  2XT1 A;  2M8N A;  3DS1 A;  3DS0 A;  4COC A;  2JO0 A;  5HGL A;  2BUO A;  3LRY A;  1M9C C;  4WYM A;  1D1D A;  2L6E A;  1EM9 A;  2XXM A;  4PH1 A;  2WLV B;  3DTJ A;  2PXR C;  4COP A;  1A43 A;  1BAJ A;  2XV6 A;  4XRQ A;  3H47 A;  5HGN A;  1L6N A;  3P05 A;  2WLV A;  5HGM A;  4DGA C;  3NTE A;  2LF4 A;  3MGE A;  4HTW A;  1EIA A;  3G29 A;  2ONT A;  4XFZ A;  2GOL B;  2EIA A;  1E6J P;  2XGU A;  4U0D A;  4U0C A;  3BP9 A;  4XRO A;  3G28 A;  5I4T G;  3DS4 A;  1M9X C;  5HGK A;  4B4N A;  4E92 A;  4U0F A;  2KGF A;  2GON A;  2X2D D;  2XGV A;  2V4X A;  4QNB A;  1U7K A;  1P7N A;  4IPY A;  1AK4 C;  4J93 A;  1EOQ A;  3H4E A;  5HGO A;  4PH3 A;  4XFY A;  4U0A A;  3G26 A;  4INB A;  2X83 A;  4E91 A;  1AUM A;  4NX4 C;  2PWM A;  3DS5 A;  1M9D C;  3VRL C;  4PH2 A;  2M8L A;  1G03 A;  2KOD A;  4PH0 A;  2X82 A;  3DPH A;  1A8O A;  1QRJ A;  5JPA A;  4XFX A;  2JYL A;  2JPR A;  1M9F C; 
#chains in the Genus database with same CATH topology
 1M74 A;  1M9Y C;  2FAC A;  2K0D X;  4LQW C;  2Y4Z A;  3HZQ A;  4U0B A;  3G1I A;  4M0I A;  2M5R A;  1ZNV A;  2JYG A;  3DS0 A;  2N98 A;  1YJ9 P;  2GZF A;  2KGA A;  1HY8 A;  1K73 Q;  2KOQ A;  2XXM A;  2KOO A;  3CPW O;  2WLV B;  4H2W C;  3DTJ A;  2PXR C;  2ROQ A;  3I55 P;  4CA3 A;  1BAJ A;  1GXG A;  2DNW A;  4XRQ A;  1VQK P;  2CGQ A;  4GR6 A;  3RG6 C;  5HGM A;  1VQL P;  4HTW A;  2ONT A;  5F2N A;  4PXH B;  1E6J P;  2JQ4 A;  2EHT A;  3GJN A;  3BP9 A;  4XRO A;  4UHP B;  2MY5 A;  5I4T G;  3DS4 A;  1CEI A;  4B4N A;  2ERH A;  4E92 A;  2GON A;  2E1M A;  5HV8 A;  2X2D D;  2XGV A;  2V4X A;  4QKO A;  2Z46 A;  2N6Y A;  3CCQ P;  2NO8 A;  4NEO A;  2K93 A;  1VQO P;  4J93 A;  1EOQ A;  2Z44 A;  1M90 Q;  1VQ6 P;  2PY8 A;  4U0A A;  3G26 A;  3GZL A;  3CC2 P;  2GDX A;  2PWM A;  2KW2 A;  3E2D A;  2LIW A;  4PH2 A;  2KGC A;  2N6Z A;  1A8O A;  2AFE A;  5KP7 B;  1M6E X;  2AFD A;  2EHS A;  2MR8 A;  5F2O A;  3M1M A;  1UJZ A;  1VQM P;  1IMQ A;  5CZD B;  4GR2 A;  3DS3 A;  1GWP A;  1ACP A;  2PWO A;  4BPF A;  1Q82 Q;  2CG5 B;  2M8P A;  1L0H A;  2JO0 A;  2VLP A;  5HGL A;  5KP8 B;  2BUO A;  3LRY A;  1W2B O;  2K0Y A;  3EJE A;  1M9C C;  1D1D A;  3G6E P;  2L4B A;  1X3O A;  3CCE P;  1ZMB A;  1VQ5 P;  1YHQ P;  2K92 A;  3HYB A;  1IUQ A;  5EW5 E;  3H47 A;  5HGN A;  2L9F A;  4F37 A;  1VQN P;  2GZG A;  3CC4 P;  2JB0 A;  1QVG O;  1AF8 A;  2EIA A;  2XGU A;  2GDW A;  4U0D A;  2GZE A;  2N50 A;  1M6N A;  2JU2 A;  1YJW P;  1N8R Q;  1M9X C;  3EJD A;  2FAE A;  4U0F A;  2GZJ A;  2OTL P;  2KGF A;  2MF4 A;  4R0M A;  1YIT P;  1IMP A;  4BPG A;  1RO0 A;  1F80 D;  2KOR A;  4IPY A;  2GDY A;  3CCL P;  2N5H A;  3CCM P;  2WPT A;  2X2B A;  3CCU P;  2FVA A;  4INB A;  2X83 A;  4E91 A;  2PEJ A;  1AUM A;  4NX4 C;  1MZ8 A;  1M9D C;  2LPK A;  2GYK A;  1K30 A;  2KGD A;  1M1K Q;  1GXH A;  4PH0 A;  2X82 A;  1GPJ A;  2LKI A;  1QRJ A;  5JPA A;  4XFX A;  2JGP A;  2JYL A;  1S72 P;  2OAR A;  5DCK A;  2VLN A;  2FVF A;  2KWL A;  3CCJ P;  4H2X C;  2L22 A;  3WBH A;  3DS2 A;  2GZI A;  2N5I A;  1VQ4 P;  3H0D A;  1KC8 Q;  1DV5 A;  1Q86 Q;  2JAZ A;  2AF8 A;  3G21 A;  1JJ2 O;  1K8A Q;  2XGY A;  2KG9 A;  2K5X A;  3B5I A;  1AFV A;  2XT1 A;  3DS1 A;  4COC A;  1HQB A;  2CWO A;  5BS2 A;  1EM9 A;  2KG8 A;  4PH1 A;  1DNY A;  1L0I A;  2XV6 A;  3G71 P;  2MVV A;  2K2Q A;  3U43 A;  3P05 A;  4HKG A;  2LF4 A;  3MGE A;  2MR7 A;  3G29 A;  4XFZ A;  2GOL B;  2K0X A;  4U0C A;  2PEM A;  2KOS A;  2KOP A;  1YI2 P;  3G28 A;  2PEO A;  1FR2 A;  2KGE A;  2FQ2 A;  3CCR P;  5KP6 B;  2BHV A;  4QNB A;  5HVC A;  2EFJ A;  1VQ9 P;  1P7N A;  1Z6M A;  2LML A;  2QEX P;  2VLO A;  2FAD A;  2EG5 A;  2JU1 A;  2VLQ A;  5HGO A;  4XFY A;  3VRL C;  4IZ6 A;  4DG9 A;  1OR5 A;  1RNI A;  2M8L A;  2LL8 A;  3CMA P;  1G03 A;  2QA4 P;  1NJI Q;  5F2K A;  2MD9 A;  3CXC O;  1EMV A;  2KG6 A;  2LOL A;  1M9F C;  3RG2 A;  4H2Y C;  5EJD A;  3GZM A;  3Q20 A;  3I56 P;  2LIU A;  2CQ8 A;  2LTE A;  4DGE C;  2FHS C;  3G0V A;  1VQ8 P;  2XDE A;  2P9X A;  2K94 A;  1E0H A;  2L0Q A;  1VQ7 P;  1VKU A;  3G1G A;  1T8K A;  1M9E C;  1Q81 Q;  4U0E A;  2M8N A;  1QVF O;  1KQS O;  4PWV B;  2PEK A;  2FVE A;  4WYM A;  2L6E A;  1UNK A;  3CC7 P;  1NQ4 A;  1K9M Q;  2Z45 A;  3CCV P;  3B4Q A;  4MRT C;  2VSQ A;  3CME P;  4COP A;  1A43 A;  2CNR A;  1L6N A;  2WLV A;  3NY7 B;  3LMO A;  4DGA C;  3NTE A;  2PNG A;  4BPH A;  1BXI A;  7CEI A;  1EIA A;  2XZ0 D;  1RO2 A;  1VQP P;  5HGK A;  2DGY A;  2OTJ P;  2FQ1 A;  3OW2 O;  1AYI A;  1Q7Y Q;  3G4S P;  1U7K A;  3EJB A;  1KLP A;  1AK4 C;  3CD6 P;  3H4E A;  2AVA A;  1YJN P;  2KR5 A;  2PEQ A;  2PEI A;  2XZ1 C;  4PH3 A;  2MVU A;  2QNW A;  3CE7 A;  3DS5 A;  2PEN A;  1VHN A;  2KOD A;  3DPH A;  2FQ0 A;  1KD1 Q;  5BS1 A;  3CCS P;  2JBG A;  2JPR A;  1YIJ P;  3GKL C; 
#chains in the Genus database with same CATH homology
 1M74 A;  5DCK A;  1M9Y C;  5F2O A;  3CCJ P;  3M1M A;  3Q20 A;  3I56 P;  3WBH A;  1VQM P;  4LQW C;  3DS2 A;  4DGE C;  3G0V A;  1VQ4 P;  1VQ8 P;  2XDE A;  2P9X A;  3H0D A;  4GR2 A;  1KC8 Q;  3DS3 A;  1Q86 Q;  2Y4Z A;  3HZQ A;  1GWP A;  1VQ7 P;  2PWO A;  4U0B A;  3G1I A;  4M0I A;  3G21 A;  1JJ2 O;  3G1G A;  2XGY A;  1Q81 Q;  1M9E C;  1K8A Q;  3B5I A;  1Q82 Q;  4U0E A;  2JYG A;  2M8P A;  1AFV A;  2XT1 A;  2M8N A;  1QVF O;  3DS1 A;  3DS0 A;  4COC A;  2JO0 A;  1YJ9 P;  5HGL A;  1KQS O;  2BUO A;  2PEK A;  2CWO A;  3LRY A;  1W2B O;  5BS2 A;  1M9C C;  4WYM A;  1D1D A;  3G6E P;  2L6E A;  1K73 Q;  1EM9 A;  3CC7 P;  2XXM A;  3CCE P;  1ZMB A;  1K9M Q;  4PH1 A;  3CPW O;  2WLV B;  2Z45 A;  3CCV P;  1VQ5 P;  1YHQ P;  3DTJ A;  2PXR C;  3I55 P;  3CME P;  4COP A;  1A43 A;  1BAJ A;  3HYB A;  2XV6 A;  1IUQ A;  3G71 P;  4XRQ A;  3H47 A;  5HGN A;  1VQK P;  1L6N A;  4GR6 A;  3P05 A;  2WLV A;  3RG6 C;  1VQN P;  5HGM A;  4DGA C;  3NTE A;  2LF4 A;  3CC4 P;  3MGE A;  1VQL P;  1QVG O;  4HTW A;  1EIA A;  3G29 A;  2ONT A;  4XFZ A;  5F2N A;  2GOL B;  2EIA A;  1E6J P;  2XGU A;  4U0D A;  4U0C A;  2PEM A;  1M6N A;  1YI2 P;  1YJW P;  3BP9 A;  4XRO A;  3G28 A;  5I4T G;  1N8R Q;  1RO2 A;  3DS4 A;  1VQP P;  1M9X C;  5HGK A;  2DGY A;  2PEO A;  4B4N A;  2OTJ P;  3OW2 O;  4E92 A;  4U0F A;  2OTL P;  2KGF A;  2GON A;  2E1M A;  2X2D D;  1YIT P;  3CCR P;  2XGV A;  2BHV A;  2V4X A;  1Q7Y Q;  2Z46 A;  4QNB A;  3G4S P;  1RO0 A;  2EFJ A;  1U7K A;  1VQ9 P;  1P7N A;  3CC2 P;  4IPY A;  3CCQ P;  3CCL P;  2QEX P;  3CCM P;  1AK4 C;  2EG5 A;  4J93 A;  1VQO P;  3CD6 P;  1EOQ A;  2Z44 A;  3H4E A;  1M90 Q;  1YJN P;  2PEQ A;  2PEI A;  5HGO A;  3CCU P;  4PH3 A;  4XFY A;  1VQ6 P;  2PY8 A;  4U0A A;  3G26 A;  4INB A;  2X83 A;  4E91 A;  1AUM A;  4NX4 C;  2PWM A;  2PEJ A;  1M9D C;  2PEN A;  3DS5 A;  3E2D A;  1K30 A;  4PH2 A;  1RNI A;  2M8L A;  3VRL C;  3CMA P;  1G03 A;  2QA4 P;  1M1K Q;  1NJI Q;  2KOD A;  4PH0 A;  2X82 A;  3DPH A;  1A8O A;  1KD1 Q;  1QRJ A;  5JPA A;  5F2K A;  5BS1 A;  1M6E X;  3CCS P;  4XFX A;  2JYL A;  2JPR A;  3CXC O;  1S72 P;  1YIJ P;  1M9F C;  2OAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...