4XRQA

Disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i) in complex with pf-3450074
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
215
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFAALSCGATPQDLNTMLNTVGGHQAAMHMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYIDRFYKTIRAEQASQEATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title HIV-1 Resistance to the Capsid-Targeting Inhibitor PF74 Results in Altered Dependence on Host Factors Required for Virus Nuclear Entry.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 76
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xrqA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xrqA02
1M9DC 4INBA 3DTJA 1GWPA 1M9EC 1BAJA 3DPHA 3G21A 3H47A 1AUMA 3BP9A 2XGVA 1M9YC 4WYMA 4B4NA 4U0FA 1L6NA 1D1DA 2V4XA 2ONTA 5I4TG 4PH3A 1A8OA 4DGEC 1M9XC 1U7KA 5HGMA 3DS3A 4XRQA 5HGOA 4DGAC 5DCKA 2BUOA 5HGNA 2XXMA 4M0IA 1G03A 4J93A 4U0AA 1A43A 2XDEA 4XFZA 2PWOA 4E92A 4COCA 4E91A 4NX4C 2X2DD 2WLVA 2Y4ZA 3NTEA 5JPAA 4U0BA 4PH0A 2WLVB 3DS0A 1EIAA 1EOQA 2PWMA 2GOLB 3G26A 2JO0A 1M9FC 3G1GA 2XGYA 2XGUA 2PXRC 4U0DA 4PH1A 3LRYA 3G29A 4U0EA 3G0VA 2X82A 1QRJA 3G1IA 4HTWA 2GONA 2JPRA 3DS2A 3P05A 4LQWC 4XFXA 4IPYA 4XFYA 1E6JP 2KODA 2M8LA 2EIAA 4PH2A 3DS4A 2M8PA 5HGLA 4COPA 1AK4C 4XROA 2M8NA 2JYGA 2X83A 1M9CC 3H4EA 3MGEA 1AFVA 2XV6A 3DS5A 2KGFA 5HGKA 4QNBA 2L6EA 2XT1A 3VRLC 3DS1A 4U0CA 2JYLA 1EM9A 1P7NA 2LF4A 3G28A
chains in the Genus database with same CATH superfamily
2KG6A 1DV5A 1RNIA 1GWPA 4F37A 2PNGA 3DPHA 1AUMA 3BP9A 1YJ9P 1S72P 2XGVA 2PEOA 3GZMA 2K2QA 1VQKP 1YITP 1K9MQ 1HQBA 4U0FA 2K5XA 2KORA 2KOOA 1BXIA 4PH3A 1A8OA 4DGEC 2WPTA 5F2OA 1U7KA 3DS3A 5KP7B 3G71P 1M6NA 3B5IA 2PENA 2Z44A 5HGNA 2XXMA 1A43A 2LPKA 2GZGA 2GYKA 2N5HA 2KOSA 1OR5A 5BS1A 2EFJA 2KG9A 2K0YA 2OTJP 2GOLB 4R0MA 2JO0A 2VLQA 3CMAP 1M9FC 3CCEP 4HKGA 3CMEP 3G0VA 3G1IA 3Q20A 1W2BO 3DS2A 2Z46A 1VQPP 2EIAA 4PH2A 3CC7P 4COPA 1M1KQ 2M8NA 2MVVA 3CC2P 4IZ6A 2VSQA 1M9CC 1Q81Q 2CNRA 2JQ4A 3CCMP 4GR6A 2M5RA 3I55P 5HGKA 1EMVA 2L6EA 4MRTC 4U0CA 1EM9A 3GKLC 2LIUA 4UHPB 2FQ1A 3DTJA 1Q86Q 3GZLA 3I56P 3CCSP 4H2WC 2AFEA 3WBHA 4GR2A 1VQ5P 2NO8A 2DGYA 2CGQA 4WYMA 4B4NA 2LKIA 2EHTA 7CEIA 1QVGO 1VQ9P 1M9XC 1N8RQ 1M90Q 2EG5A 5HGMA 1ZNVA 2KGDA 1GXGA 4XRQA 1AYIA 4DGAC 4M0IA 1VKUA 2XDEA 1VQNP 5KP8B 4XFZA 3GJNA 3CC4P 1KLPA 4COCA 4E91A 2K94A 2WLVA 2Y4ZA 5JPAA 2ERHA 2CQ8A 4U0BA 2P9XA 1EIAA 2QEXP 2JBGA 2K0DX 3CCLP 3G26A 1YJWP 2N5IA 1FR2A 4QKOA 2PXRC 2GZFA 2QNWA 5HV8A 3G29A 4U0EA 1VQ6P 4DG9A 4PXHB 2PY8A 2MD9A 2MF4A 5HGLA 1RO0A 2MR7A 2L0QA 1VQLP 1NQ4A 1ACPA 1YJNP 1Z6MA 3MGEA 5F2KA 2VLOA 2XV6A 2FQ2A 3B4QA 2LTEA 3VRLC 1UNKA 2VLNA 1AF8A 2JYLA 2FQ0A 2FVFA 1P7NA 2QA4P 1CEIA 1Q82Q 2FVEA 2KOPA 1KC8Q 4BPHA 3CCQP 2K92A 1M9EC 1BAJA 2XZ1C 1L0HA 2GDXA 3H47A 1T8KA 3G21A 3E2DA 1VHNA 1F80D 1M74A 1ZMBA 2MR8A 1K8AQ 3CCUP 2K93A 1D1DA 2V4XA 5F2NA 1Q7YQ 5CZDB 5I4TG 1YHQP 2GDWA 2JU1A 1KQSO 5DCKA 2BUOA 2L4BA 1G03A 4J93A 2E1MA 2X2BA 4U0AA 2N98A 2GZIA 3EJBA 1MZ8A 3H0DA 2GZEA 2N6ZA 3CE7A 1NJIQ 2N6YA 1E0HA 2Z45A 4E92A 3HYBA 1UJZA 3NTEA 2MY5A 3U43A 4PH0A 2WLVB 2KGAA 2DNWA 1VQMP 2PWMA 2KGEA 2XGUA 3EJEA 3G6EP 3RG6C 2X82A 4H2YC 4HTWA 2JPRA 2KGCA 2CG5B 4XFXA 4IPYA 4XFYA 1E6JP 2AFDA 2LIWA 2ROQA 3CD6P 1KD1Q 2CWOA 1AK4C 1IMQA 2KWLA 1YI2P 1K30A 1L0IA 1VQ4P 2FAEA 1DNYA 2GDYA 4CA3A 3DS1A 1X3OA 5KP6B 3OW2O 2FVAA 2LF4A 1M9DC 4INBA 4NEOA 2KR5A 2L9FA 1GXHA 2XZ0D 2PEJA 3NY7B 1VQ8P 1M9YC 2K0XA 1GPJA 2MVUA 1L6NA 2ONTA 2AF8A 3CXCO 2L22A 3CCRP 2JGPA 4BPFA 5HGOA 2FADA 2KOQA 5HVCA 3CPWO 2FHSC 3EJDA 4H2XC 2VLPA 1QVFO 1JJ2O 2PWOA 4PWVB 1RO2A 5BS2A 2N50A 1IMPA 4NX4C 1IUQA 3CCVP 2X2DD 2OARA 2FACA 2KW2A 1K73Q 2PEIA 2JU2A 1VQ7P 2KG8A 3DS0A 1EOQA 2LOLA 2PEQA 3RG2A 1M6EX 3G1GA 2XGYA 2JAZA 5EJDA 4U0DA 4PH1A 3LRYA 5EW5E 1QRJA 3LMOA 3G4SP 2OTLP 2EHSA 2GONA 2GZJA 3P05A 3CCJP 4LQWC 2LMLA 3M1MA 2KODA 2M8LA 1VQOP 2PEKA 2LL8A 3DS4A 2M8PA 4XROA 1YIJP 2JYGA 2X83A 2AVAA 2BHVA 3H4EA 1AFVA 2PEMA 3HZQA 2JB0A 3DS5A 2KGFA 4QNBA 4BPGA 1HY8A 2XT1A 3G28A
chains in the Genus database with same CATH topology
1M9DC 4INBA 3DTJA 1Q82Q 1RNIA 1Q86Q 1GWPA 3I56P 3CCSP 1KC8Q 3CCQP 1M9EC 1BAJA 3DPHA 3G21A 3H47A 1AUMA 3BP9A 3WBHA 4GR2A 1VQ5P 2XGVA 2PEOA 1YJ9P 1S72P 2PEJA 3E2DA 2DGYA 1VQ8P 1M9YC 4WYMA 4B4NA 1VQKP 1M74A 1YITP 1K9MQ 3CC7P 1ZMBA 1K8AQ 4U0FA 3CCUP 1L6NA 1D1DA 2V4XA 2ONTA 5F2NA 1Q7YQ 5I4TG 3CXCO 4PH3A 1A8OA 4DGEC 1M9XC 1YHQP 1QVGO 1VQ9P 5F2OA 1N8RQ 1M90Q 1U7KA 5HGMA 2EG5A 3CCRP 3DS3A 3G71P 1KQSO 4XRQA 1M6NA 5HGOA 4DGAC 3B5IA 2PENA 2BUOA 2Z44A 5DCKA 5HGNA 2XXMA 4M0IA 3CPWO 1G03A 4J93A 2E1MA 4U0AA 1A43A 2XDEA 3H0DA 1VQNP 1QVFO 4XFZA 1JJ2O 2PWOA 1NJIQ 3CC4P 1RO2A 5BS2A 2Z45A 4E92A 3HYBA 4COCA 4E91A 4NX4C 1IUQA 5BS1A 3CCVP 2X2DD 2OARA 2WLVA 2Y4ZA 3NTEA 5JPAA 2EFJA 1K73Q 4U0BA 2PEIA 1VQ7P 4PH0A 2WLVB 3DS0A 2P9XA 1VQMP 1EIAA 1EOQA 2QEXP 2OTJP 2PWMA 2PEQA 3CCLP 2GOLB 3G26A 2JO0A 3CMAP 1YJWP 1M9FC 3CCEP 1M6EX 3G1GA 2XGYA 2XGUA 2PXRC 3G6EP 3RG6C 4U0DA 4PH1A 3LRYA 3CMEP 3G29A 2QA4P 4U0EA 3G0VA 2X82A 1QRJA 3G1IA 3Q20A 3G4SP 2OTLP 1W2BO 4HTWA 2GONA 2JPRA 3DS2A 3P05A 3CCJP 1VQ6P 4LQWC 4XFXA 4IPYA 3M1MA 4XFYA 1E6JP 2KODA 2Z46A 1VQPP 2M8LA 2EIAA 2PY8A 1VQOP 4PH2A 2PEKA 3DS4A 3CD6P 2M8PA 1KD1Q 5HGLA 4COPA 2CWOA 1AK4C 4XROA 1YI2P 1YIJP 2M8NA 1RO0A 1M1KQ 2JYGA 1K30A 3CC2P 1VQ4P 2X83A 1M9CC 2BHVA 1Q81Q 1VQLP 1YJNP 3H4EA 3CCMP 4GR6A 3MGEA 5F2KA 1AFVA 3I55P 2PEMA 2XV6A 3HZQA 3DS5A 2KGFA 5HGKA 4QNBA 2L6EA 2XT1A 3VRLC 3DS1A 4U0CA 2JYLA 1EM9A 3OW2O 1P7NA 2LF4A 3G28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M9D C;  4INB A;  3DTJ A;  1GWP A;  1M9E C;  1BAJ A;  3DPH A;  3G21 A;  3H47 A;  1AUM A;  3BP9 A;  2XGV A;  1M9Y C;  4WYM A;  4B4N A;  4U0F A;  1L6N A;  1D1D A;  2V4X A;  2ONT A;  5I4T G;  4PH3 A;  1A8O A;  4DGE C;  1M9X C;  1U7K A;  5HGM A;  3DS3 A;  4XRQ A;  5HGO A;  4DGA C;  5DCK A;  2BUO A;  5HGN A;  2XXM A;  4M0I A;  1G03 A;  4J93 A;  4U0A A;  1A43 A;  2XDE A;  4XFZ A;  2PWO A;  4E92 A;  4COC A;  4E91 A;  4NX4 C;  2X2D D;  2WLV A;  2Y4Z A;  3NTE A;  5JPA A;  4U0B A;  4PH0 A;  2WLV B;  3DS0 A;  1EIA A;  1EOQ A;  2PWM A;  2GOL B;  3G26 A;  2JO0 A;  1M9F C;  3G1G A;  2XGY A;  2XGU A;  2PXR C;  4U0D A;  4PH1 A;  3LRY A;  3G29 A;  4U0E A;  3G0V A;  2X82 A;  1QRJ A;  3G1I A;  4HTW A;  2GON A;  2JPR A;  3DS2 A;  3P05 A;  4LQW C;  4XFX A;  4IPY A;  4XFY A;  1E6J P;  2KOD A;  2M8L A;  2EIA A;  4PH2 A;  3DS4 A;  2M8P A;  5HGL A;  4COP A;  1AK4 C;  4XRO A;  2M8N A;  2JYG A;  2X83 A;  1M9C C;  3H4E A;  3MGE A;  1AFV A;  2XV6 A;  3DS5 A;  2KGF A;  5HGK A;  4QNB A;  2L6E A;  2XT1 A;  3VRL C;  3DS1 A;  4U0C A;  2JYL A;  1EM9 A;  1P7N A;  2LF4 A;  3G28 A; 
#chains in the Genus database with same CATH topology
 2KG6 A;  1DV5 A;  1RNI A;  1GWP A;  4F37 A;  2PNG A;  3DPH A;  1AUM A;  3BP9 A;  1YJ9 P;  1S72 P;  2XGV A;  2PEO A;  3GZM A;  2K2Q A;  1VQK P;  1YIT P;  1K9M Q;  1HQB A;  4U0F A;  2K5X A;  2KOR A;  2KOO A;  1BXI A;  4PH3 A;  1A8O A;  4DGE C;  2WPT A;  5F2O A;  1U7K A;  3DS3 A;  5KP7 B;  3G71 P;  1M6N A;  3B5I A;  2PEN A;  2Z44 A;  5HGN A;  2XXM A;  1A43 A;  2LPK A;  2GZG A;  2GYK A;  2N5H A;  2KOS A;  1OR5 A;  5BS1 A;  2EFJ A;  2KG9 A;  2K0Y A;  2OTJ P;  2GOL B;  4R0M A;  2JO0 A;  2VLQ A;  3CMA P;  1M9F C;  3CCE P;  4HKG A;  3CME P;  3G0V A;  3G1I A;  3Q20 A;  1W2B O;  3DS2 A;  2Z46 A;  1VQP P;  2EIA A;  4PH2 A;  3CC7 P;  4COP A;  1M1K Q;  2M8N A;  2MVV A;  3CC2 P;  4IZ6 A;  2VSQ A;  1M9C C;  1Q81 Q;  2CNR A;  2JQ4 A;  3CCM P;  4GR6 A;  2M5R A;  3I55 P;  5HGK A;  1EMV A;  2L6E A;  4MRT C;  4U0C A;  1EM9 A;  3GKL C;  2LIU A;  4UHP B;  2FQ1 A;  3DTJ A;  1Q86 Q;  3GZL A;  3I56 P;  3CCS P;  4H2W C;  2AFE A;  3WBH A;  4GR2 A;  1VQ5 P;  2NO8 A;  2DGY A;  2CGQ A;  4WYM A;  4B4N A;  2LKI A;  2EHT A;  7CEI A;  1QVG O;  1VQ9 P;  1M9X C;  1N8R Q;  1M90 Q;  2EG5 A;  5HGM A;  1ZNV A;  2KGD A;  1GXG A;  4XRQ A;  1AYI A;  4DGA C;  4M0I A;  1VKU A;  2XDE A;  1VQN P;  5KP8 B;  4XFZ A;  3GJN A;  3CC4 P;  1KLP A;  4COC A;  4E91 A;  2K94 A;  2WLV A;  2Y4Z A;  5JPA A;  2ERH A;  2CQ8 A;  4U0B A;  2P9X A;  1EIA A;  2QEX P;  2JBG A;  2K0D X;  3CCL P;  3G26 A;  1YJW P;  2N5I A;  1FR2 A;  4QKO A;  2PXR C;  2GZF A;  2QNW A;  5HV8 A;  3G29 A;  4U0E A;  1VQ6 P;  4DG9 A;  4PXH B;  2PY8 A;  2MD9 A;  2MF4 A;  5HGL A;  1RO0 A;  2MR7 A;  2L0Q A;  1VQL P;  1NQ4 A;  1ACP A;  1YJN P;  1Z6M A;  3MGE A;  5F2K A;  2VLO A;  2XV6 A;  2FQ2 A;  3B4Q A;  2LTE A;  3VRL C;  1UNK A;  2VLN A;  1AF8 A;  2JYL A;  2FQ0 A;  2FVF A;  1P7N A;  2QA4 P;  1CEI A;  1Q82 Q;  2FVE A;  2KOP A;  1KC8 Q;  4BPH A;  3CCQ P;  2K92 A;  1M9E C;  1BAJ A;  2XZ1 C;  1L0H A;  2GDX A;  3H47 A;  1T8K A;  3G21 A;  3E2D A;  1VHN A;  1F80 D;  1M74 A;  1ZMB A;  2MR8 A;  1K8A Q;  3CCU P;  2K93 A;  1D1D A;  2V4X A;  5F2N A;  1Q7Y Q;  5CZD B;  5I4T G;  1YHQ P;  2GDW A;  2JU1 A;  1KQS O;  5DCK A;  2BUO A;  2L4B A;  1G03 A;  4J93 A;  2E1M A;  2X2B A;  4U0A A;  2N98 A;  2GZI A;  3EJB A;  1MZ8 A;  3H0D A;  2GZE A;  2N6Z A;  3CE7 A;  1NJI Q;  2N6Y A;  1E0H A;  2Z45 A;  4E92 A;  3HYB A;  1UJZ A;  3NTE A;  2MY5 A;  3U43 A;  4PH0 A;  2WLV B;  2KGA A;  2DNW A;  1VQM P;  2PWM A;  2KGE A;  2XGU A;  3EJE A;  3G6E P;  3RG6 C;  2X82 A;  4H2Y C;  4HTW A;  2JPR A;  2KGC A;  2CG5 B;  4XFX A;  4IPY A;  4XFY A;  1E6J P;  2AFD A;  2LIW A;  2ROQ A;  3CD6 P;  1KD1 Q;  2CWO A;  1AK4 C;  1IMQ A;  2KWL A;  1YI2 P;  1K30 A;  1L0I A;  1VQ4 P;  2FAE A;  1DNY A;  2GDY A;  4CA3 A;  3DS1 A;  1X3O A;  5KP6 B;  3OW2 O;  2FVA A;  2LF4 A;  1M9D C;  4INB A;  4NEO A;  2KR5 A;  2L9F A;  1GXH A;  2XZ0 D;  2PEJ A;  3NY7 B;  1VQ8 P;  1M9Y C;  2K0X A;  1GPJ A;  2MVU A;  1L6N A;  2ONT A;  2AF8 A;  3CXC O;  2L22 A;  3CCR P;  2JGP A;  4BPF A;  5HGO A;  2FAD A;  2KOQ A;  5HVC A;  3CPW O;  2FHS C;  3EJD A;  4H2X C;  2VLP A;  1QVF O;  1JJ2 O;  2PWO A;  4PWV B;  1RO2 A;  5BS2 A;  2N50 A;  1IMP A;  4NX4 C;  1IUQ A;  3CCV P;  2X2D D;  2OAR A;  2FAC A;  2KW2 A;  1K73 Q;  2PEI A;  2JU2 A;  1VQ7 P;  2KG8 A;  3DS0 A;  1EOQ A;  2LOL A;  2PEQ A;  3RG2 A;  1M6E X;  3G1G A;  2XGY A;  2JAZ A;  5EJD A;  4U0D A;  4PH1 A;  3LRY A;  5EW5 E;  1QRJ A;  3LMO A;  3G4S P;  2OTL P;  2EHS A;  2GON A;  2GZJ A;  3P05 A;  3CCJ P;  4LQW C;  2LML A;  3M1M A;  2KOD A;  2M8L A;  1VQO P;  2PEK A;  2LL8 A;  3DS4 A;  2M8P A;  4XRO A;  1YIJ P;  2JYG A;  2X83 A;  2AVA A;  2BHV A;  3H4E A;  1AFV A;  2PEM A;  3HZQ A;  2JB0 A;  3DS5 A;  2KGF A;  4QNB A;  4BPG A;  1HY8 A;  2XT1 A;  3G28 A; 
#chains in the Genus database with same CATH homology
 1M9D C;  4INB A;  3DTJ A;  1Q82 Q;  1RNI A;  1Q86 Q;  1GWP A;  3I56 P;  3CCS P;  1KC8 Q;  3CCQ P;  1M9E C;  1BAJ A;  3DPH A;  3G21 A;  3H47 A;  1AUM A;  3BP9 A;  3WBH A;  4GR2 A;  1VQ5 P;  2XGV A;  2PEO A;  1YJ9 P;  1S72 P;  2PEJ A;  3E2D A;  2DGY A;  1VQ8 P;  1M9Y C;  4WYM A;  4B4N A;  1VQK P;  1M74 A;  1YIT P;  1K9M Q;  3CC7 P;  1ZMB A;  1K8A Q;  4U0F A;  3CCU P;  1L6N A;  1D1D A;  2V4X A;  2ONT A;  5F2N A;  1Q7Y Q;  5I4T G;  3CXC O;  4PH3 A;  1A8O A;  4DGE C;  1M9X C;  1YHQ P;  1QVG O;  1VQ9 P;  5F2O A;  1N8R Q;  1M90 Q;  1U7K A;  5HGM A;  2EG5 A;  3CCR P;  3DS3 A;  3G71 P;  1KQS O;  4XRQ A;  1M6N A;  5HGO A;  4DGA C;  3B5I A;  2PEN A;  2BUO A;  2Z44 A;  5DCK A;  5HGN A;  2XXM A;  4M0I A;  3CPW O;  1G03 A;  4J93 A;  2E1M A;  4U0A A;  1A43 A;  2XDE A;  3H0D A;  1VQN P;  1QVF O;  4XFZ A;  1JJ2 O;  2PWO A;  1NJI Q;  3CC4 P;  1RO2 A;  5BS2 A;  2Z45 A;  4E92 A;  3HYB A;  4COC A;  4E91 A;  4NX4 C;  1IUQ A;  5BS1 A;  3CCV P;  2X2D D;  2OAR A;  2WLV A;  2Y4Z A;  3NTE A;  5JPA A;  2EFJ A;  1K73 Q;  4U0B A;  2PEI A;  1VQ7 P;  4PH0 A;  2WLV B;  3DS0 A;  2P9X A;  1VQM P;  1EIA A;  1EOQ A;  2QEX P;  2OTJ P;  2PWM A;  2PEQ A;  3CCL P;  2GOL B;  3G26 A;  2JO0 A;  3CMA P;  1YJW P;  1M9F C;  3CCE P;  1M6E X;  3G1G A;  2XGY A;  2XGU A;  2PXR C;  3G6E P;  3RG6 C;  4U0D A;  4PH1 A;  3LRY A;  3CME P;  3G29 A;  2QA4 P;  4U0E A;  3G0V A;  2X82 A;  1QRJ A;  3G1I A;  3Q20 A;  3G4S P;  2OTL P;  1W2B O;  4HTW A;  2GON A;  2JPR A;  3DS2 A;  3P05 A;  3CCJ P;  1VQ6 P;  4LQW C;  4XFX A;  4IPY A;  3M1M A;  4XFY A;  1E6J P;  2KOD A;  2Z46 A;  1VQP P;  2M8L A;  2EIA A;  2PY8 A;  1VQO P;  4PH2 A;  2PEK A;  3DS4 A;  3CD6 P;  2M8P A;  1KD1 Q;  5HGL A;  4COP A;  2CWO A;  1AK4 C;  4XRO A;  1YI2 P;  1YIJ P;  2M8N A;  1RO0 A;  1M1K Q;  2JYG A;  1K30 A;  3CC2 P;  1VQ4 P;  2X83 A;  1M9C C;  2BHV A;  1Q81 Q;  1VQL P;  1YJN P;  3H4E A;  3CCM P;  4GR6 A;  3MGE A;  5F2K A;  1AFV A;  3I55 P;  2PEM A;  2XV6 A;  3HZQ A;  3DS5 A;  2KGF A;  5HGK A;  4QNB A;  2L6E A;  2XT1 A;  3VRL C;  3DS1 A;  4U0C A;  2JYL A;  1EM9 A;  3OW2 O;  1P7N A;  2LF4 A;  3G28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...