4XRQA

Disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i) in complex with pf-3450074
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
215
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFAALSCGATPQDLNTMLNTVGGHQAAMHMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYIDRFYKTIRAEQASQEATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Capsid protein p24
publication title HIV-1 Resistance to the Capsid-Targeting Inhibitor PF74 Results in Altered Dependence on Host Factors Required for Virus Nuclear Entry.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 76
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xrqA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xrqA02
4DGEC 1GWPA 2BUOA 1BAJA 4XRQA 2JPRA 4XFXA 3BP9A 5HGOA 1AFVA 2XGYA 4M0IA 1L6NA 2PWMA 2PXRC 2X2DD 4XFYA 5HGMA 3P05A 3G28A 2M8NA 3DS5A 3NTEA 4PH1A 4PH0A 2XGVA 3G29A 4DGAC 2X82A 4NX4C 2M8LA 3G1IA 2XXMA 4E92A 1G03A 3G1GA 5I4TG 3DS2A 3G26A 1QRJA 2KGFA 4PH2A 5HGKA 2GONA 2XGUA 1U7KA 2M8PA 4J93A 3G0VA 4U0FA 2ONTA 3DS0A 1D1DA 2LF4A 2X83A 4XFZA 1M9FC 1M9XC 4E91A 1A8OA 1M9YC 3DS4A 5DCKA 2PWOA 1M9EC 4U0DA 4WYMA 1E6JP 1EM9A 1EOQA 2XDEA 1AK4C 3G21A 1P7NA 2JYGA 3H4EA 2WLVA 4COCA 2JYLA 4LQWC 2XV6A 2L6EA 3LRYA 4U0AA 2GOLB 4B4NA 5HGNA 4IPYA 2JO0A 3DS1A 4INBA 4U0CA 5HGLA 2XT1A 4HTWA 1M9CC 2Y4ZA 4QNBA 2KODA 3VRLC 3DPHA 3MGEA 3DS3A 2EIAA 4PH3A 4U0EA 4COPA 4XROA 3DTJA 2V4XA 1M9DC 5JPAA 1A43A 1EIAA 4U0BA 1AUMA 2WLVB 3H47A
chains in the Genus database with same CATH superfamily
1GWPA 2BUOA 2K92A 2XZ0D 2PEIA 3BP9A 1KD1Q 2K0XA 5F2KA 1M6NA 2N6YA 2EG5A 3CCLP 1AF8A 3GZLA 3G28A 1GXGA 1VQNP 2M8NA 2KG9A 4H2WC 1RO0A 2GDYA 2PEOA 2XGVA 5KP6B 1L0IA 3GZMA 3G1IA 3G1GA 5I4TG 2K93A 2GONA 3RG2A 1UNKA 2AFEA 2ONTA 1VQLP 2PEJA 1UJZA 3CCSP 2VLOA 2K5XA 1AYIA 4BPFA 1Q82Q 3OW2O 4XFZA 2GYKA 3CC4P 2OTLP 2FAEA 1VQPP 2KW2A 3NY7B 1T8KA 2Z44A 5F2NA 2XDEA 3G6EP 3H0DA 2N98A 1ZNVA 1BXIA 2K0YA 2JYLA 2GOLB 2FQ1A 2P9XA 3HZQA 2FQ2A 2L4BA 1KQSO 1OR5A 2AF8A 2KGCA 4F37A 3CE7A 1E0HA 2AVAA 2N5IA 3U43A 5EJDA 3MGEA 3DS3A 1YHQP 3WBHA 3CC2P 2OTJP 1IUQA 2KR5A 5JPAA 3CPWO 2VLPA 2XZ1C 3EJDA 3H47A 2LPKA 3EJBA 5HV8A 5CZDB 1Q86Q 3GKLC 3CCUP 4PWVB 2Z45A 2MVVA 2PEMA 2PWMA 1Q7YQ 2PXRC 2KG8A 1VQ9P 1DV5A 4XFYA 3P05A 3DS5A 3NTEA 4PH1A 3G71P 1GXHA 1MZ8A 4DGAC 2X82A 2GZIA 1VQOP 1M90Q 1QRJA 2K0DX 2FVAA 2EHTA 2QA4P 2XGUA 4J93A 2X2BA 3LMOA 1D1DA 2QEXP 1M9XC 2Z46A 1ACPA 1M9YC 4H2XC 4GR6A 5DCKA 2PWOA 1K30A 1YJWP 4WYMA 1Q81Q 1E6JP 1VKUA 2M5RA 2KWLA 1AK4C 1L0HA 1K73Q 1DNYA 4QKOA 1FR2A 1M74A 4COCA 2VSQA 2CWOA 2AFDA 2JBGA 2L6EA 2FVEA 2ROQA 4B4NA 1X3OA 4IPYA 1F80D 2JO0A 2MVUA 2GDWA 2KOPA 2KOQA 3DS1A 4IZ6A 4U0CA 2KGEA 2MR7A 5HGLA 1S72P 2QNWA 4BPGA 1YJ9P 1IMQA 1M9CC 2JU1A 2Y4ZA 2JGPA 2WPTA 4BPHA 4COPA 3DTJA 4GR2A 1M9DC 3CD6P 1VQMP 1A43A 1EIAA 4U0BA 1AUMA 4R0MA 1BAJA 3CXCO 2DGYA 1NJIQ 3B5IA 4XRQA 1GPJA 4XFXA 1M1KQ 2N5HA 1AFVA 3G4SP 1L6NA 2X2DD 3CCEP 3CCJP 2JAZA 5HGMA 1K8AQ 3M1MA 3G29A 2MY5A 2GZFA 2M8LA 2GZJA 4E92A 1QVGO 1VQKP 3DS2A 3E2DA 2KGFA 4PH2A 5F2OA 2MR8A 3G0VA 3DS0A 1VQ4P 3I56P 1VQ5P 2OARA 1KC8Q 4PXHB 2L9FA 2KOSA 4E91A 1A8OA 2K2QA 1HY8A 3DS4A 2ERHA 1M9EC 2N50A 2KGAA 1EM9A 3G21A 4H2YC 2NO8A 2FQ0A 2JU2A 5KP8B 2WLVA 1QVFO 1N8RQ 1KLPA 4LQWC 2XV6A 3LRYA 4U0AA 2PENA 4INBA 2KOOA 2KG6A 2JQ4A 2VLQA 1CEIA 2XT1A 1VQ8P 2K94A 2FADA 3VRLC 2CGQA 1RO2A 4U0EA 4PH3A 4DG9A 2DNWA 4HKGA 5EW5E 3CMAP 1Z6MA 4MRTC 2L22A 2WLVB 3Q20A 2N6ZA 1M6EX 1VHNA 4DGEC 2KORA 2PNGA 2LTEA 1VQ6P 2JPRA 5HGOA 2JB0A 2XGYA 3CCQP 4M0IA 2PY8A 2LKIA 3HYBA 2CG5B 2GDXA 4CA3A 3CCRP 4PH0A 2L0QA 2LIWA 1YJNP 1ZMBA 4NX4C 2XXMA 1G03A 1JJ2O 1HQBA 3G26A 1IMPA 1YI2P 2VLNA 2FVFA 5HGKA 5KP7B 4UHPB 1U7KA 2KGDA 2M8PA 2LOLA 4U0FA 3CC7P 1EMVA 2LF4A 2X83A 4NEOA 2PEQA 1M9FC 1VQ7P 2GZEA 5BS2A 2CQ8A 4U0DA 1YIJP 1EOQA 1P7NA 2JYGA 3CMEP 3H4EA 2BHVA 5BS1A 2MD9A 2LIUA 2PEKA 1W2BO 2E1MA 5HGNA 1NQ4A 2MF4A 2CNRA 1YITP 2LL8A 4HTWA 2GZGA 4QNBA 2KODA 3I55P 3CCVP 3DPHA 2LMLA 3RG6C 3B4QA 1K9MQ 2EIAA 3GJNA 4XROA 5HVCA 2V4XA 2FACA 2EHSA 2FHSC 1RNIA 3EJEA 3CCMP 7CEIA 2EFJA
chains in the Genus database with same CATH topology
4DGEC 1GWPA 2BUOA 1BAJA 1Q86Q 3CXCO 2DGYA 1NJIQ 3B5IA 4XRQA 3CCUP 1VQ6P 2JPRA 4XFXA 2PEIA 3BP9A 1KD1Q 2Z45A 5F2KA 1M1KQ 5HGOA 1AFVA 2XGYA 3G4SP 3CCQP 4M0IA 2PY8A 1L6NA 2PEMA 1M6NA 2PWMA 1Q7YQ 2PXRC 2EG5A 3CCLP 1VQ9P 2X2DD 3HYBA 3CCEP 3CCJP 4XFYA 5HGMA 3P05A 3G28A 1VQNP 2M8NA 3DS5A 3NTEA 4PH1A 3CCRP 1RO0A 4PH0A 1K8AQ 3G71P 3M1MA 2PEOA 2XGVA 3G29A 1YJNP 4DGAC 2X82A 1ZMBA 4NX4C 2M8LA 3G1IA 2XXMA 4E92A 1QVGO 1G03A 3G1GA 5I4TG 1VQOP 3DS2A 1M90Q 1JJ2O 1VQKP 3G26A 1QRJA 1YI2P 3E2DA 2KGFA 4PH2A 5HGKA 2GONA 5F2OA 2XGUA 2QA4P 1U7KA 2M8PA 4J93A 3G0VA 4U0FA 3CC7P 2ONTA 3DS0A 1VQLP 1VQ4P 3I56P 1VQ5P 2PEJA 3CCSP 1D1DA 2OARA 2LF4A 2X83A 1KC8Q 1Q82Q 3OW2O 2PEQA 4XFZA 1M9FC 2QEXP 1VQ7P 1M9XC 3CC4P 5BS2A 2OTLP 2Z46A 4E91A 1A8OA 1M9YC 3DS4A 4GR6A 2PWOA 1M9EC 4U0DA 1K30A 5DCKA 1VQPP 1YIJP 4WYMA 1Q81Q 2Z44A 1E6JP 1EM9A 5F2NA 1EOQA 2XDEA 1AK4C 3G21A 1P7NA 3G6EP 2JYGA 3H0DA 1K73Q 3CMEP 3H4EA 2BHVA 5BS1A 1M74A 2WLVA 4COCA 1QVFO 2PEKA 1W2BO 1N8RQ 2E1MA 2CWOA 2JYLA 4LQWC 2XV6A 2L6EA 3LRYA 4U0AA 2GOLB 4B4NA 5HGNA 4IPYA 2P9XA 2PENA 2JO0A 3HZQA 3DS1A 4INBA 4U0CA 1KQSO 1YITP 5HGLA 1S72P 2XT1A 1VQ8P 4HTWA 1YJWP 1YJ9P 1M9CC 2Y4ZA 4QNBA 2KODA 3VRLC 3I55P 3CCVP 3DPHA 3MGEA 1RO2A 3DS3A 3RG6C 1YHQP 1K9MQ 2EIAA 4PH3A 4U0EA 3WBHA 4COPA 3CC2P 4XROA 2OTJP 3DTJA 1IUQA 3CMAP 4GR2A 2V4XA 1M9DC 5JPAA 3CD6P 3CPWO 1A43A 1VQMP 1EIAA 4U0BA 1RNIA 1AUMA 3CCMP 2WLVB 3Q20A 3H47A 1M6EX 2EFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DGE C;  1GWP A;  2BUO A;  1BAJ A;  4XRQ A;  2JPR A;  4XFX A;  3BP9 A;  5HGO A;  1AFV A;  2XGY A;  4M0I A;  1L6N A;  2PWM A;  2PXR C;  2X2D D;  4XFY A;  5HGM A;  3P05 A;  3G28 A;  2M8N A;  3DS5 A;  3NTE A;  4PH1 A;  4PH0 A;  2XGV A;  3G29 A;  4DGA C;  2X82 A;  4NX4 C;  2M8L A;  3G1I A;  2XXM A;  4E92 A;  1G03 A;  3G1G A;  5I4T G;  3DS2 A;  3G26 A;  1QRJ A;  2KGF A;  4PH2 A;  5HGK A;  2GON A;  2XGU A;  1U7K A;  2M8P A;  4J93 A;  3G0V A;  4U0F A;  2ONT A;  3DS0 A;  1D1D A;  2LF4 A;  2X83 A;  4XFZ A;  1M9F C;  1M9X C;  4E91 A;  1A8O A;  1M9Y C;  3DS4 A;  5DCK A;  2PWO A;  1M9E C;  4U0D A;  4WYM A;  1E6J P;  1EM9 A;  1EOQ A;  2XDE A;  1AK4 C;  3G21 A;  1P7N A;  2JYG A;  3H4E A;  2WLV A;  4COC A;  2JYL A;  4LQW C;  2XV6 A;  2L6E A;  3LRY A;  4U0A A;  2GOL B;  4B4N A;  5HGN A;  4IPY A;  2JO0 A;  3DS1 A;  4INB A;  4U0C A;  5HGL A;  2XT1 A;  4HTW A;  1M9C C;  2Y4Z A;  4QNB A;  2KOD A;  3VRL C;  3DPH A;  3MGE A;  3DS3 A;  2EIA A;  4PH3 A;  4U0E A;  4COP A;  4XRO A;  3DTJ A;  2V4X A;  1M9D C;  5JPA A;  1A43 A;  1EIA A;  4U0B A;  1AUM A;  2WLV B;  3H47 A; 
#chains in the Genus database with same CATH topology
 1GWP A;  2BUO A;  2K92 A;  2XZ0 D;  2PEI A;  3BP9 A;  1KD1 Q;  2K0X A;  5F2K A;  1M6N A;  2N6Y A;  2EG5 A;  3CCL P;  1AF8 A;  3GZL A;  3G28 A;  1GXG A;  1VQN P;  2M8N A;  2KG9 A;  4H2W C;  1RO0 A;  2GDY A;  2PEO A;  2XGV A;  5KP6 B;  1L0I A;  3GZM A;  3G1I A;  3G1G A;  5I4T G;  2K93 A;  2GON A;  3RG2 A;  1UNK A;  2AFE A;  2ONT A;  1VQL P;  2PEJ A;  1UJZ A;  3CCS P;  2VLO A;  2K5X A;  1AYI A;  4BPF A;  1Q82 Q;  3OW2 O;  4XFZ A;  2GYK A;  3CC4 P;  2OTL P;  2FAE A;  1VQP P;  2KW2 A;  3NY7 B;  1T8K A;  2Z44 A;  5F2N A;  2XDE A;  3G6E P;  3H0D A;  2N98 A;  1ZNV A;  1BXI A;  2K0Y A;  2JYL A;  2GOL B;  2FQ1 A;  2P9X A;  3HZQ A;  2FQ2 A;  2L4B A;  1KQS O;  1OR5 A;  2AF8 A;  2KGC A;  4F37 A;  3CE7 A;  1E0H A;  2AVA A;  2N5I A;  3U43 A;  5EJD A;  3MGE A;  3DS3 A;  1YHQ P;  3WBH A;  3CC2 P;  2OTJ P;  1IUQ A;  2KR5 A;  5JPA A;  3CPW O;  2VLP A;  2XZ1 C;  3EJD A;  3H47 A;  2LPK A;  3EJB A;  5HV8 A;  5CZD B;  1Q86 Q;  3GKL C;  3CCU P;  4PWV B;  2Z45 A;  2MVV A;  2PEM A;  2PWM A;  1Q7Y Q;  2PXR C;  2KG8 A;  1VQ9 P;  1DV5 A;  4XFY A;  3P05 A;  3DS5 A;  3NTE A;  4PH1 A;  3G71 P;  1GXH A;  1MZ8 A;  4DGA C;  2X82 A;  2GZI A;  1VQO P;  1M90 Q;  1QRJ A;  2K0D X;  2FVA A;  2EHT A;  2QA4 P;  2XGU A;  4J93 A;  2X2B A;  3LMO A;  1D1D A;  2QEX P;  1M9X C;  2Z46 A;  1ACP A;  1M9Y C;  4H2X C;  4GR6 A;  5DCK A;  2PWO A;  1K30 A;  1YJW P;  4WYM A;  1Q81 Q;  1E6J P;  1VKU A;  2M5R A;  2KWL A;  1AK4 C;  1L0H A;  1K73 Q;  1DNY A;  4QKO A;  1FR2 A;  1M74 A;  4COC A;  2VSQ A;  2CWO A;  2AFD A;  2JBG A;  2L6E A;  2FVE A;  2ROQ A;  4B4N A;  1X3O A;  4IPY A;  1F80 D;  2JO0 A;  2MVU A;  2GDW A;  2KOP A;  2KOQ A;  3DS1 A;  4IZ6 A;  4U0C A;  2KGE A;  2MR7 A;  5HGL A;  1S72 P;  2QNW A;  4BPG A;  1YJ9 P;  1IMQ A;  1M9C C;  2JU1 A;  2Y4Z A;  2JGP A;  2WPT A;  4BPH A;  4COP A;  3DTJ A;  4GR2 A;  1M9D C;  3CD6 P;  1VQM P;  1A43 A;  1EIA A;  4U0B A;  1AUM A;  4R0M A;  1BAJ A;  3CXC O;  2DGY A;  1NJI Q;  3B5I A;  4XRQ A;  1GPJ A;  4XFX A;  1M1K Q;  2N5H A;  1AFV A;  3G4S P;  1L6N A;  2X2D D;  3CCE P;  3CCJ P;  2JAZ A;  5HGM A;  1K8A Q;  3M1M A;  3G29 A;  2MY5 A;  2GZF A;  2M8L A;  2GZJ A;  4E92 A;  1QVG O;  1VQK P;  3DS2 A;  3E2D A;  2KGF A;  4PH2 A;  5F2O A;  2MR8 A;  3G0V A;  3DS0 A;  1VQ4 P;  3I56 P;  1VQ5 P;  2OAR A;  1KC8 Q;  4PXH B;  2L9F A;  2KOS A;  4E91 A;  1A8O A;  2K2Q A;  1HY8 A;  3DS4 A;  2ERH A;  1M9E C;  2N50 A;  2KGA A;  1EM9 A;  3G21 A;  4H2Y C;  2NO8 A;  2FQ0 A;  2JU2 A;  5KP8 B;  2WLV A;  1QVF O;  1N8R Q;  1KLP A;  4LQW C;  2XV6 A;  3LRY A;  4U0A A;  2PEN A;  4INB A;  2KOO A;  2KG6 A;  2JQ4 A;  2VLQ A;  1CEI A;  2XT1 A;  1VQ8 P;  2K94 A;  2FAD A;  3VRL C;  2CGQ A;  1RO2 A;  4U0E A;  4PH3 A;  4DG9 A;  2DNW A;  4HKG A;  5EW5 E;  3CMA P;  1Z6M A;  4MRT C;  2L22 A;  2WLV B;  3Q20 A;  2N6Z A;  1M6E X;  1VHN A;  4DGE C;  2KOR A;  2PNG A;  2LTE A;  1VQ6 P;  2JPR A;  5HGO A;  2JB0 A;  2XGY A;  3CCQ P;  4M0I A;  2PY8 A;  2LKI A;  3HYB A;  2CG5 B;  2GDX A;  4CA3 A;  3CCR P;  4PH0 A;  2L0Q A;  2LIW A;  1YJN P;  1ZMB A;  4NX4 C;  2XXM A;  1G03 A;  1JJ2 O;  1HQB A;  3G26 A;  1IMP A;  1YI2 P;  2VLN A;  2FVF A;  5HGK A;  5KP7 B;  4UHP B;  1U7K A;  2KGD A;  2M8P A;  2LOL A;  4U0F A;  3CC7 P;  1EMV A;  2LF4 A;  2X83 A;  4NEO A;  2PEQ A;  1M9F C;  1VQ7 P;  2GZE A;  5BS2 A;  2CQ8 A;  4U0D A;  1YIJ P;  1EOQ A;  1P7N A;  2JYG A;  3CME P;  3H4E A;  2BHV A;  5BS1 A;  2MD9 A;  2LIU A;  2PEK A;  1W2B O;  2E1M A;  5HGN A;  1NQ4 A;  2MF4 A;  2CNR A;  1YIT P;  2LL8 A;  4HTW A;  2GZG A;  4QNB A;  2KOD A;  3I55 P;  3CCV P;  3DPH A;  2LML A;  3RG6 C;  3B4Q A;  1K9M Q;  2EIA A;  3GJN A;  4XRO A;  5HVC A;  2V4X A;  2FAC A;  2EHS A;  2FHS C;  1RNI A;  3EJE A;  3CCM P;  7CEI A;  2EFJ A; 
#chains in the Genus database with same CATH homology
 4DGE C;  1GWP A;  2BUO A;  1BAJ A;  1Q86 Q;  3CXC O;  2DGY A;  1NJI Q;  3B5I A;  4XRQ A;  3CCU P;  1VQ6 P;  2JPR A;  4XFX A;  2PEI A;  3BP9 A;  1KD1 Q;  2Z45 A;  5F2K A;  1M1K Q;  5HGO A;  1AFV A;  2XGY A;  3G4S P;  3CCQ P;  4M0I A;  2PY8 A;  1L6N A;  2PEM A;  1M6N A;  2PWM A;  1Q7Y Q;  2PXR C;  2EG5 A;  3CCL P;  1VQ9 P;  2X2D D;  3HYB A;  3CCE P;  3CCJ P;  4XFY A;  5HGM A;  3P05 A;  3G28 A;  1VQN P;  2M8N A;  3DS5 A;  3NTE A;  4PH1 A;  3CCR P;  1RO0 A;  4PH0 A;  1K8A Q;  3G71 P;  3M1M A;  2PEO A;  2XGV A;  3G29 A;  1YJN P;  4DGA C;  2X82 A;  1ZMB A;  4NX4 C;  2M8L A;  3G1I A;  2XXM A;  4E92 A;  1QVG O;  1G03 A;  3G1G A;  5I4T G;  1VQO P;  3DS2 A;  1M90 Q;  1JJ2 O;  1VQK P;  3G26 A;  1QRJ A;  1YI2 P;  3E2D A;  2KGF A;  4PH2 A;  5HGK A;  2GON A;  5F2O A;  2XGU A;  2QA4 P;  1U7K A;  2M8P A;  4J93 A;  3G0V A;  4U0F A;  3CC7 P;  2ONT A;  3DS0 A;  1VQL P;  1VQ4 P;  3I56 P;  1VQ5 P;  2PEJ A;  3CCS P;  1D1D A;  2OAR A;  2LF4 A;  2X83 A;  1KC8 Q;  1Q82 Q;  3OW2 O;  2PEQ A;  4XFZ A;  1M9F C;  2QEX P;  1VQ7 P;  1M9X C;  3CC4 P;  5BS2 A;  2OTL P;  2Z46 A;  4E91 A;  1A8O A;  1M9Y C;  3DS4 A;  4GR6 A;  2PWO A;  1M9E C;  4U0D A;  1K30 A;  5DCK A;  1VQP P;  1YIJ P;  4WYM A;  1Q81 Q;  2Z44 A;  1E6J P;  1EM9 A;  5F2N A;  1EOQ A;  2XDE A;  1AK4 C;  3G21 A;  1P7N A;  3G6E P;  2JYG A;  3H0D A;  1K73 Q;  3CME P;  3H4E A;  2BHV A;  5BS1 A;  1M74 A;  2WLV A;  4COC A;  1QVF O;  2PEK A;  1W2B O;  1N8R Q;  2E1M A;  2CWO A;  2JYL A;  4LQW C;  2XV6 A;  2L6E A;  3LRY A;  4U0A A;  2GOL B;  4B4N A;  5HGN A;  4IPY A;  2P9X A;  2PEN A;  2JO0 A;  3HZQ A;  3DS1 A;  4INB A;  4U0C A;  1KQS O;  1YIT P;  5HGL A;  1S72 P;  2XT1 A;  1VQ8 P;  4HTW A;  1YJW P;  1YJ9 P;  1M9C C;  2Y4Z A;  4QNB A;  2KOD A;  3VRL C;  3I55 P;  3CCV P;  3DPH A;  3MGE A;  1RO2 A;  3DS3 A;  3RG6 C;  1YHQ P;  1K9M Q;  2EIA A;  4PH3 A;  4U0E A;  3WBH A;  4COP A;  3CC2 P;  4XRO A;  2OTJ P;  3DTJ A;  1IUQ A;  3CMA P;  4GR2 A;  2V4X A;  1M9D C;  5JPA A;  3CD6 P;  3CPW O;  1A43 A;  1VQM P;  1EIA A;  4U0B A;  1RNI A;  1AUM A;  3CCM P;  2WLV B;  3Q20 A;  3H47 A;  1M6E X;  2EFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...