4XRQA

Disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i) in complex with pf-3450074
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
215
Chain Sequence
b'PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFAALSCGATPQDLNTMLNTVGGHQAAMHMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYIDRFYKTIRAEQASQEATETLLVQNANPDCKTILKALGPGATLEEMMTACQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
molecule tags Viral protein
source organism Human immunodeficiency virus 1
publication title HIV-1 Resistance to the Capsid-Targeting Inhibitor PF74 Results in Altered Dependence on Host Factors Required for Virus Nuclear Entry.
pubmed doi rcsb
total genus 76
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xrqA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xrqA02
1A43A 4E92A 3G21A 2PXRC 2X83A 4WYMA 4XFXA 4U0DA 4M0IA 2XXMA 4U0CA 4COPA 2XGVA 4DGAC 2X82A 3DS2A 3DS5A 3DS1A 4XRQA 2KODA 3DS4A 2JPRA 4INBA 2XGYA 4PH3A 4U0AA 3G28A 4E91A 2Y4ZA 5I4TG 2M8NA 2X2DD 1EM9A 2WLVA 1EOQA 1M9YC 2XDEA 3H47A 4PH0A 4IPYA 2XV6A 1EIAA 3G26A 2JO0A 1U7KA 1P7NA 2LF4A 5JPAA 4PH1A 1GWPA 2JYGA 1AK4C 1M9DC 3DPHA 1M9FC 2EIAA 1M9EC 2M8PA 2JYLA 2L6EA 2XGUA 2PWMA 4XFZA 2V4XA 1AUMA 4U0BA 4XFYA 2KGFA 4LQWC 1A8OA 5HGOA 4NX4C 2ONTA 3NTEA 3BP9A 3VRLC 3H4EA 2M8LA 1G03A 4DGEC 2WLVB 4QNBA 3MGEA 1M9CC 1D1DA 4PH2A 1BAJA 4B4NA 1E6JP 1AFVA 4XROA 3LRYA 4U0EA 2PWOA 5HGKA 5HGMA 3G29A 3DTJA 3DS3A 2GOLB 4HTWA 5HGLA 4COCA 2BUOA 1L6NA 5HGNA 1M9XC 3G0VA 2GONA 3P05A 4J93A 5DCKA 4U0FA 3G1IA 3DS0A 3G1GA 1QRJA 2XT1A
chains in the Genus database with same CATH superfamily
3G21A 1L0HA 2JQ4A 1UJZA 2KWLA 2P9XA 3M1MA 2AFDA 4WYMA 4NEOA 4HKGA 2XXMA 1UNKA 4COPA 2FQ1A 2KG6A 3CCEP 2VLNA 2CNRA 2EG5A 1QVFO 1RNIA 1VQMP 2FVEA 3GZLA 1VQ4P 4INBA 4PH3A 1Q86Q 2FAEA 2L9FA 5F2OA 4U0AA 3G28A 2ERHA 1AF8A 4E91A 2Y4ZA 2EHSA 2K0DX 2XZ1C 1YI2P 1M1KQ 2WLVA 2GZFA 4H2WC 4PH0A 5HV8A 2XV6A 1EIAA 3WBHA 2L0QA 2JU2A 1T8KA 2LF4A 4H2XC 1GWPA 1OR5A 3CCLP 2GDYA 1YJWP 2LPKA 1RO2A 1L0IA 3GJNA 2GDXA 2CQ8A 3CC7P 5BS1A 2PENA 2KOSA 1M74A 5F2KA 1K30A 3NTEA 3H4EA 2JAZA 3MGEA 3CXCO 3G71P 3CPWO 4B4NA 1AFVA 1IMQA 2KOPA 1Q7YQ 4U0EA 2GZJA 1VQNP 5HGKA 4PWVB 3G29A 3I56P 1ZMBA 5HGLA 3GKLC 1L6NA 5HGNA 1M9XC 2ROQA 1E0HA 2FACA 1K8AQ 2Z46A 3CE7A 2LTEA 2PNGA 1YJNP 1KQSO 3H0DA 4CA3A 3B5IA 4QKOA 4XFXA 1QVGO 2JBGA 4M0IA 2LIUA 5EW5E 1Z6MA 2XGVA 4DGAC 2X82A 3DS5A 2N5HA 3HYBA 4XRQA 2KODA 2N50A 3DS4A 5KP8B 1VQOP 2JPRA 3U43A 3B4QA 4BPFA 2Z45A 2M8NA 4UHPB 1VHNA 1KD1Q 2VLOA 2AFEA 3H47A 2FADA 3CCVP 1U7KA 5JPAA 4GR6A 3OW2O 3E2DA 1Q81Q 1VQKP 2EIAA 1M9EC 1VKUA 2M8PA 2JYLA 1VQ5P 2XGUA 2PWMA 4XFZA 2V4XA 2OTLP 4U0BA 2KW2A 5HGOA 3RG6C 4NX4C 4DG9A 2LIWA 3VRLC 2M8LA 2WPTA 4DGEC 2WLVB 1M6EX 2VLPA 2GZGA 2LOLA 3GZMA 1E6JP 2KOOA 2MR8A 2FQ0A 2QNWA 1CEIA 2PEQA 2KGEA 3G0VA 2DNWA 3P05A 2Z44A 4U0FA 3CCQP 4R0MA 2KGDA 3Q20A 2AVAA 2K93A 1A43A 4E92A 3CCMP 3CMEP 1ZNVA 1K9MQ 2FVFA 1JJ2O 2GDWA 2PXRC 3HZQA 2X83A 1Q82Q 3CCJP 2QEXP 5EJDA 5BS2A 3DS2A 3DS1A 2PEIA 2LMLA 7CEIA 2XGYA 1RO0A 1YJ9P 2MY5A 5I4TG 2LKIA 2BHVA 1W2BO 5KP7B 1VQPP 3CD6P 2X2DD 2JB0A 1DV5A 1EOQA 3EJBA 1M9YC 5CZDB 4PXHB 2VLQA 4PH1A 2KGAA 2JYGA 2N6YA 1AK4C 1M9DC 2PEJA 1M9FC 2L22A 2K0YA 4XFYA 2X2BA 2KGFA 1HQBA 2JU1A 2JGPA 2L4BA 3EJDA 3BP9A 2CWOA 2XZ0D 2DGYA 1ACPA 2N98A 2GZIA 2FHSC 2FVAA 1D1DA 2K5XA 4PH2A 1GPJA 4XROA 3CCSP 2PWOA 2MVVA 1EMVA 2KG8A 4F37A 5HGMA 1IMPA 3DTJA 1K73Q 2GOLB 4HTWA 1YIJP 2GONA 4J93A 5DCKA 3G1IA 1X3OA 3RG2A 3DS0A 3G1GA 2XT1A 3G6EP 1GXHA 4BPHA 2EFJA 1YITP 4MRTC 4U0DA 2FQ2A 2GYKA 2KGCA 4U0CA 1AYIA 2GZEA 1M90Q 1VQ8P 2PEOA 2EHTA 4BPGA 2NO8A 2K94A 1MZ8A 2PEMA 1FR2A 3CC4P 1DNYA 2M5RA 1VQ7P 2KORA 1M6NA 5HVCA 4H2YC 2N5IA 1EM9A 2K92A 2XDEA 1KLPA 3EJEA 2N6ZA 4IPYA 2KR5A 2KG9A 3G26A 2JO0A 1YHQP 1P7NA 1VQ9P 3DPHA 3CCRP 3G4SP 2PEKA 2K2QA 2L6EA 4IZ6A 2MF4A 1AUMA 3LMOA 4LQWC 3I55P 1NJIQ 1A8OA 3CMAP 2ONTA 2VSQA 3NY7B 2QA4P 1G03A 1VQLP 1VQ6P 1KC8Q 2K0XA 2KOQA 4QNBA 2LL8A 1M9CC 2OARA 2AF8A 3CC2P 1BAJA 2E1MA 1N8RQ 3LRYA 2MVUA 2CGQA 1BXIA 1NQ4A 4GR2A 3DS3A 1IUQA 2OTJP 1S72P 1HY8A 4COCA 2BUOA 2MD9A 1F80D 5KP6B 2CG5B 2PY8A 3CCUP 2MR7A 1GXGA 1QRJA 5F2NA
chains in the Genus database with same CATH topology
1A43A 4E92A 3G21A 3G6EP 3CCMP 1KQSO 1K9MQ 3CMEP 2EFJA 3H0DA 1YITP 1JJ2O 3B5IA 2PXRC 2P9XA 3M1MA 3HZQA 2X83A 4WYMA 4XFXA 4U0DA 1QVGO 4M0IA 1Q82Q 2XXMA 4U0CA 4COPA 3CCJP 3CCEP 2QEXP 2XGVA 1M90Q 4DGAC 1VQ8P 2PEOA 5BS2A 2X82A 3DS2A 3DS5A 3DS1A 3HYBA 4XRQA 2EG5A 2KODA 2PEIA 1QVFO 1RNIA 1VQMP 3DS4A 1VQOP 1VQ4P 2JPRA 4INBA 2XGYA 2PEMA 4PH3A 1RO0A 1YJ9P 1Q86Q 3CC4P 5F2OA 4U0AA 3G28A 1VQ7P 4E91A 2Y4ZA 1M6NA 5I4TG 2BHVA 1W2BO 2Z45A 1VQPP 2M8NA 3CD6P 1YI2P 1KD1Q 1M1KQ 2X2DD 1EM9A 2WLVA 1EOQA 1M9YC 2XDEA 3H47A 4PH0A 4IPYA 2XV6A 1EIAA 3G26A 2JO0A 3WBHA 3CCVP 1YHQP 1U7KA 1P7NA 2LF4A 5JPAA 1VQ9P 4PH1A 1GWPA 2JYGA 4GR6A 3CCLP 1AK4C 1M9DC 3DPHA 3OW2O 1RO2A 3E2DA 2PEJA 3CCRP 1YJWP 5F2NA 1M9FC 1Q81Q 1VQKP 3G4SP 2EIAA 1M9EC 2PEKA 3CC7P 5BS1A 2M8PA 2JYLA 2L6EA 1VQ5P 2XGUA 2PWMA 4XFZA 2V4XA 1AUMA 2PENA 2OTLP 4U0BA 4XFYA 2KGFA 4LQWC 3I55P 1NJIQ 1A8OA 5HGOA 1M74A 3RG6C 3CMAP 4NX4C 5F2KA 2ONTA 1K30A 1YJNP 3NTEA 3BP9A 3VRLC 2CWOA 3H4EA 2M8LA 2QA4P 1G03A 2DGYA 1VQLP 4DGEC 1VQ6P 1KC8Q 2WLVB 1M6EX 4QNBA 3MGEA 1M9CC 2OARA 3CXCO 1D1DA 3CC2P 4PH2A 3G71P 3CPWO 1BAJA 4B4NA 2E1MA 1E6JP 1AFVA 1N8RQ 4XROA 3LRYA 1Q7YQ 4U0EA 3CCSP 1VQNP 2PWOA 5HGKA 5HGMA 3G29A 3DTJA 4GR2A 3I56P 3DS3A 1IUQA 2OTJP 1K73Q 1S72P 2GOLB 4HTWA 1ZMBA 5HGLA 1YIJP 4COCA 2BUOA 1L6NA 2PEQA 5HGNA 1M9XC 3G0VA 2GONA 3P05A 4J93A 2Z44A 2PY8A 3CCUP 5DCKA 4U0FA 3CCQP 3G1IA 1K8AQ 2Z46A 3Q20A 3DS0A 3G1GA 1QRJA 2XT1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A43 A;  4E92 A;  3G21 A;  2PXR C;  2X83 A;  4WYM A;  4XFX A;  4U0D A;  4M0I A;  2XXM A;  4U0C A;  4COP A;  2XGV A;  4DGA C;  2X82 A;  3DS2 A;  3DS5 A;  3DS1 A;  4XRQ A;  2KOD A;  3DS4 A;  2JPR A;  4INB A;  2XGY A;  4PH3 A;  4U0A A;  3G28 A;  4E91 A;  2Y4Z A;  5I4T G;  2M8N A;  2X2D D;  1EM9 A;  2WLV A;  1EOQ A;  1M9Y C;  2XDE A;  3H47 A;  4PH0 A;  4IPY A;  2XV6 A;  1EIA A;  3G26 A;  2JO0 A;  1U7K A;  1P7N A;  2LF4 A;  5JPA A;  4PH1 A;  1GWP A;  2JYG A;  1AK4 C;  1M9D C;  3DPH A;  1M9F C;  2EIA A;  1M9E C;  2M8P A;  2JYL A;  2L6E A;  2XGU A;  2PWM A;  4XFZ A;  2V4X A;  1AUM A;  4U0B A;  4XFY A;  2KGF A;  4LQW C;  1A8O A;  5HGO A;  4NX4 C;  2ONT A;  3NTE A;  3BP9 A;  3VRL C;  3H4E A;  2M8L A;  1G03 A;  4DGE C;  2WLV B;  4QNB A;  3MGE A;  1M9C C;  1D1D A;  4PH2 A;  1BAJ A;  4B4N A;  1E6J P;  1AFV A;  4XRO A;  3LRY A;  4U0E A;  2PWO A;  5HGK A;  5HGM A;  3G29 A;  3DTJ A;  3DS3 A;  2GOL B;  4HTW A;  5HGL A;  4COC A;  2BUO A;  1L6N A;  5HGN A;  1M9X C;  3G0V A;  2GON A;  3P05 A;  4J93 A;  5DCK A;  4U0F A;  3G1I A;  3DS0 A;  3G1G A;  1QRJ A;  2XT1 A; 
#chains in the Genus database with same CATH topology
 3G21 A;  1L0H A;  2JQ4 A;  1UJZ A;  2KWL A;  2P9X A;  3M1M A;  2AFD A;  4WYM A;  4NEO A;  4HKG A;  2XXM A;  1UNK A;  4COP A;  2FQ1 A;  2KG6 A;  3CCE P;  2VLN A;  2CNR A;  2EG5 A;  1QVF O;  1RNI A;  1VQM P;  2FVE A;  3GZL A;  1VQ4 P;  4INB A;  4PH3 A;  1Q86 Q;  2FAE A;  2L9F A;  5F2O A;  4U0A A;  3G28 A;  2ERH A;  1AF8 A;  4E91 A;  2Y4Z A;  2EHS A;  2K0D X;  2XZ1 C;  1YI2 P;  1M1K Q;  2WLV A;  2GZF A;  4H2W C;  4PH0 A;  5HV8 A;  2XV6 A;  1EIA A;  3WBH A;  2L0Q A;  2JU2 A;  1T8K A;  2LF4 A;  4H2X C;  1GWP A;  1OR5 A;  3CCL P;  2GDY A;  1YJW P;  2LPK A;  1RO2 A;  1L0I A;  3GJN A;  2GDX A;  2CQ8 A;  3CC7 P;  5BS1 A;  2PEN A;  2KOS A;  1M74 A;  5F2K A;  1K30 A;  3NTE A;  3H4E A;  2JAZ A;  3MGE A;  3CXC O;  3G71 P;  3CPW O;  4B4N A;  1AFV A;  1IMQ A;  2KOP A;  1Q7Y Q;  4U0E A;  2GZJ A;  1VQN P;  5HGK A;  4PWV B;  3G29 A;  3I56 P;  1ZMB A;  5HGL A;  3GKL C;  1L6N A;  5HGN A;  1M9X C;  2ROQ A;  1E0H A;  2FAC A;  1K8A Q;  2Z46 A;  3CE7 A;  2LTE A;  2PNG A;  1YJN P;  1KQS O;  3H0D A;  4CA3 A;  3B5I A;  4QKO A;  4XFX A;  1QVG O;  2JBG A;  4M0I A;  2LIU A;  5EW5 E;  1Z6M A;  2XGV A;  4DGA C;  2X82 A;  3DS5 A;  2N5H A;  3HYB A;  4XRQ A;  2KOD A;  2N50 A;  3DS4 A;  5KP8 B;  1VQO P;  2JPR A;  3U43 A;  3B4Q A;  4BPF A;  2Z45 A;  2M8N A;  4UHP B;  1VHN A;  1KD1 Q;  2VLO A;  2AFE A;  3H47 A;  2FAD A;  3CCV P;  1U7K A;  5JPA A;  4GR6 A;  3OW2 O;  3E2D A;  1Q81 Q;  1VQK P;  2EIA A;  1M9E C;  1VKU A;  2M8P A;  2JYL A;  1VQ5 P;  2XGU A;  2PWM A;  4XFZ A;  2V4X A;  2OTL P;  4U0B A;  2KW2 A;  5HGO A;  3RG6 C;  4NX4 C;  4DG9 A;  2LIW A;  3VRL C;  2M8L A;  2WPT A;  4DGE C;  2WLV B;  1M6E X;  2VLP A;  2GZG A;  2LOL A;  3GZM A;  1E6J P;  2KOO A;  2MR8 A;  2FQ0 A;  2QNW A;  1CEI A;  2PEQ A;  2KGE A;  3G0V A;  2DNW A;  3P05 A;  2Z44 A;  4U0F A;  3CCQ P;  4R0M A;  2KGD A;  3Q20 A;  2AVA A;  2K93 A;  1A43 A;  4E92 A;  3CCM P;  3CME P;  1ZNV A;  1K9M Q;  2FVF A;  1JJ2 O;  2GDW A;  2PXR C;  3HZQ A;  2X83 A;  1Q82 Q;  3CCJ P;  2QEX P;  5EJD A;  5BS2 A;  3DS2 A;  3DS1 A;  2PEI A;  2LML A;  7CEI A;  2XGY A;  1RO0 A;  1YJ9 P;  2MY5 A;  5I4T G;  2LKI A;  2BHV A;  1W2B O;  5KP7 B;  1VQP P;  3CD6 P;  2X2D D;  2JB0 A;  1DV5 A;  1EOQ A;  3EJB A;  1M9Y C;  5CZD B;  4PXH B;  2VLQ A;  4PH1 A;  2KGA A;  2JYG A;  2N6Y A;  1AK4 C;  1M9D C;  2PEJ A;  1M9F C;  2L22 A;  2K0Y A;  4XFY A;  2X2B A;  2KGF A;  1HQB A;  2JU1 A;  2JGP A;  2L4B A;  3EJD A;  3BP9 A;  2CWO A;  2XZ0 D;  2DGY A;  1ACP A;  2N98 A;  2GZI A;  2FHS C;  2FVA A;  1D1D A;  2K5X A;  4PH2 A;  1GPJ A;  4XRO A;  3CCS P;  2PWO A;  2MVV A;  1EMV A;  2KG8 A;  4F37 A;  5HGM A;  1IMP A;  3DTJ A;  1K73 Q;  2GOL B;  4HTW A;  1YIJ P;  2GON A;  4J93 A;  5DCK A;  3G1I A;  1X3O A;  3RG2 A;  3DS0 A;  3G1G A;  2XT1 A;  3G6E P;  1GXH A;  4BPH A;  2EFJ A;  1YIT P;  4MRT C;  4U0D A;  2FQ2 A;  2GYK A;  2KGC A;  4U0C A;  1AYI A;  2GZE A;  1M90 Q;  1VQ8 P;  2PEO A;  2EHT A;  4BPG A;  2NO8 A;  2K94 A;  1MZ8 A;  2PEM A;  1FR2 A;  3CC4 P;  1DNY A;  2M5R A;  1VQ7 P;  2KOR A;  1M6N A;  5HVC A;  4H2Y C;  2N5I A;  1EM9 A;  2K92 A;  2XDE A;  1KLP A;  3EJE A;  2N6Z A;  4IPY A;  2KR5 A;  2KG9 A;  3G26 A;  2JO0 A;  1YHQ P;  1P7N A;  1VQ9 P;  3DPH A;  3CCR P;  3G4S P;  2PEK A;  2K2Q A;  2L6E A;  4IZ6 A;  2MF4 A;  1AUM A;  3LMO A;  4LQW C;  3I55 P;  1NJI Q;  1A8O A;  3CMA P;  2ONT A;  2VSQ A;  3NY7 B;  2QA4 P;  1G03 A;  1VQL P;  1VQ6 P;  1KC8 Q;  2K0X A;  2KOQ A;  4QNB A;  2LL8 A;  1M9C C;  2OAR A;  2AF8 A;  3CC2 P;  1BAJ A;  2E1M A;  1N8R Q;  3LRY A;  2MVU A;  2CGQ A;  1BXI A;  1NQ4 A;  4GR2 A;  3DS3 A;  1IUQ A;  2OTJ P;  1S72 P;  1HY8 A;  4COC A;  2BUO A;  2MD9 A;  1F80 D;  5KP6 B;  2CG5 B;  2PY8 A;  3CCU P;  2MR7 A;  1GXG A;  1QRJ A;  5F2N A; 
#chains in the Genus database with same CATH homology
 1A43 A;  4E92 A;  3G21 A;  3G6E P;  3CCM P;  1KQS O;  1K9M Q;  3CME P;  2EFJ A;  3H0D A;  1YIT P;  1JJ2 O;  3B5I A;  2PXR C;  2P9X A;  3M1M A;  3HZQ A;  2X83 A;  4WYM A;  4XFX A;  4U0D A;  1QVG O;  4M0I A;  1Q82 Q;  2XXM A;  4U0C A;  4COP A;  3CCJ P;  3CCE P;  2QEX P;  2XGV A;  1M90 Q;  4DGA C;  1VQ8 P;  2PEO A;  5BS2 A;  2X82 A;  3DS2 A;  3DS5 A;  3DS1 A;  3HYB A;  4XRQ A;  2EG5 A;  2KOD A;  2PEI A;  1QVF O;  1RNI A;  1VQM P;  3DS4 A;  1VQO P;  1VQ4 P;  2JPR A;  4INB A;  2XGY A;  2PEM A;  4PH3 A;  1RO0 A;  1YJ9 P;  1Q86 Q;  3CC4 P;  5F2O A;  4U0A A;  3G28 A;  1VQ7 P;  4E91 A;  2Y4Z A;  1M6N A;  5I4T G;  2BHV A;  1W2B O;  2Z45 A;  1VQP P;  2M8N A;  3CD6 P;  1YI2 P;  1KD1 Q;  1M1K Q;  2X2D D;  1EM9 A;  2WLV A;  1EOQ A;  1M9Y C;  2XDE A;  3H47 A;  4PH0 A;  4IPY A;  2XV6 A;  1EIA A;  3G26 A;  2JO0 A;  3WBH A;  3CCV P;  1YHQ P;  1U7K A;  1P7N A;  2LF4 A;  5JPA A;  1VQ9 P;  4PH1 A;  1GWP A;  2JYG A;  4GR6 A;  3CCL P;  1AK4 C;  1M9D C;  3DPH A;  3OW2 O;  1RO2 A;  3E2D A;  2PEJ A;  3CCR P;  1YJW P;  5F2N A;  1M9F C;  1Q81 Q;  1VQK P;  3G4S P;  2EIA A;  1M9E C;  2PEK A;  3CC7 P;  5BS1 A;  2M8P A;  2JYL A;  2L6E A;  1VQ5 P;  2XGU A;  2PWM A;  4XFZ A;  2V4X A;  1AUM A;  2PEN A;  2OTL P;  4U0B A;  4XFY A;  2KGF A;  4LQW C;  3I55 P;  1NJI Q;  1A8O A;  5HGO A;  1M74 A;  3RG6 C;  3CMA P;  4NX4 C;  5F2K A;  2ONT A;  1K30 A;  1YJN P;  3NTE A;  3BP9 A;  3VRL C;  2CWO A;  3H4E A;  2M8L A;  2QA4 P;  1G03 A;  2DGY A;  1VQL P;  4DGE C;  1VQ6 P;  1KC8 Q;  2WLV B;  1M6E X;  4QNB A;  3MGE A;  1M9C C;  2OAR A;  3CXC O;  1D1D A;  3CC2 P;  4PH2 A;  3G71 P;  3CPW O;  1BAJ A;  4B4N A;  2E1M A;  1E6J P;  1AFV A;  1N8R Q;  4XRO A;  3LRY A;  1Q7Y Q;  4U0E A;  3CCS P;  1VQN P;  2PWO A;  5HGK A;  5HGM A;  3G29 A;  3DTJ A;  4GR2 A;  3I56 P;  3DS3 A;  1IUQ A;  2OTJ P;  1K73 Q;  1S72 P;  2GOL B;  4HTW A;  1ZMB A;  5HGL A;  1YIJ P;  4COC A;  2BUO A;  1L6N A;  2PEQ A;  5HGN A;  1M9X C;  3G0V A;  2GON A;  3P05 A;  4J93 A;  2Z44 A;  2PY8 A;  3CCU P;  5DCK A;  4U0F A;  3CCQ P;  3G1I A;  1K8A Q;  2Z46 A;  3Q20 A;  3DS0 A;  3G1G A;  1QRJ A;  2XT1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...