4XRQA

Disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i) in complex with pf-3450074
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
215
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFAALSCGATPQDLNTMLNTVGGHQAAMHMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYIDRFYKTIRAEQASQEATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Capsid protein p24
publication title HIV-1 Resistance to the Capsid-Targeting Inhibitor PF74 Results in Altered Dependence on Host Factors Required for Virus Nuclear Entry.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 76
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xrqA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xrqA02
2X83A 2XDEA 1AK4C 2WLVA 1U7KA 1EM9A 1M9CC 4XFXA 3VRLC 1L6NA 1M9XC 1EIAA 1P7NA 2PXRC 4NX4C 4HTWA 3DPHA 3G28A 5HGLA 5HGMA 4PH1A 2X2DD 2EIAA 2XV6A 4XFZA 3DS1A 3DS4A 5I4TG 5DCKA 1M9YC 2JYGA 3G26A 2M8LA 2ONTA 4DGEC 5HGNA 3H47A 2XGVA 1M9DC 1EOQA 2PWMA 3DS0A 4COCA 5HGKA 2L6EA 3G21A 3MGEA 1M9FC 2X82A 4U0CA 2KODA 2KGFA 1E6JP 1BAJA 4U0DA 4XFYA 4DGAC 4INBA 2BUOA 4PH3A 4B4NA 1QRJA 4QNBA 2JPRA 3DS3A 5HGOA 3NTEA 1G03A 4IPYA 1AUMA 4COPA 3G29A 3P05A 2V4XA 2JYLA 3G0VA 2XXMA 1AFVA 4LQWC 3DS5A 2GONA 1D1DA 3G1IA 4U0FA 2XGUA 4PH0A 2PWOA 2JO0A 2XT1A 1A43A 2M8PA 2M8NA 4M0IA 2WLVB 1GWPA 3H4EA 4U0AA 2LF4A 4U0BA 2Y4ZA 4J93A 3LRYA 3G1GA 5JPAA 1A8OA 4E92A 4XRQA 3DS2A 4E91A 2XGYA 2GOLB 4PH2A 3BP9A 4XROA 4U0EA 4WYMA 1M9EC 3DTJA
chains in the Genus database with same CATH superfamily
2X83A 2XDEA 2K92A 1DV5A 2MY5A 3U43A 2CGQA 1IMQA 4NX4C 2FQ2A 3G28A 5CZDB 2QA4P 3GZMA 5HGLA 4BPHA 3GJNA 1HY8A 2KG8A 2ROQA 1GXGA 4DGEC 2CNRA 3H47A 3G6EP 1VQLP 2FQ0A 1EOQA 2PWMA 2KG6A 3G21A 2Z46A 2FVFA 2NO8A 1M9FC 1K30A 1Q81Q 2E1MA 2KGFA 4DGAC 4INBA 2CG5B 2FVAA 2LMLA 2K0XA 3E2DA 2L4BA 3I55P 1QRJA 4QNBA 2MR8A 2K0YA 1EMVA 2KGAA 3NTEA 2JBGA 4IZ6A 4IPYA 1AUMA 1YI2P 4F37A 2PEKA 2XXMA 1AFVA 4LQWC 2K0DX 2GONA 1D1DA 3G1IA 1K8AQ 2VLOA 2PWOA 2JO0A 5F2NA 4H2WC 2KOOA 1DNYA 2KG9A 1KD1Q 2BHVA 5BS1A 2M8PA 2M8NA 2FHSC 2L22A 2JAZA 2MF4A 2LF4A 4U0BA 1L0HA 1N8RQ 2FVEA 1HQBA 2FACA 2LIUA 1YJWP 5JPAA 1A8OA 3CCRP 3DS2A 2N6YA 1MZ8A 2L0QA 3CPWO 4GR2A 2GDYA 4PH2A 2PEOA 1VQPP 4U0EA 3CC7P 4WYMA 1AK4C 1EM9A 1VQ9P 1YHQP 2GZFA 3VRLC 3B5IA 4H2XC 3EJDA 1IUQA 5HGMA 5BS2A 2KOPA 2X2DD 2EIAA 1ZNVA 4R0MA 4XFZA 1X3OA 3DS4A 2KGCA 5DCKA 2PENA 1M9YC 3G26A 3Q20A 4NEOA 2ONTA 5KP7B 5HGNA 1Z6MA 2KOQA 4CA3A 5HGKA 3CCVP 3CCJP 2GZEA 5EJDA 3CCSP 1RO2A 2FADA 2LL8A 1E6JP 1BAJA 2FAEA 2BUOA 2OTJP 4PH3A 4B4NA 2P9XA 7CEIA 1G03A 4COPA 3P05A 4BPFA 2JYLA 3CE7A 3DS5A 2FQ1A 2QEXP 3I56P 1NJIQ 2XGUA 4PH0A 5F2KA 2XT1A 1KQSO 2N5HA 2MD9A 1GWPA 2GZJA 4UHPB 3B4QA 1VQ8P 1AYIA 3RG6C 3HYBA 5KP6B 2JU2A 2LKIA 2VSQA 4E92A 1BXIA 2GYKA 2PNGA 2GOLB 3G71P 1M1KQ 1M9EC 2QNWA 3HZQA 2CQ8A 4BPGA 2KGDA 2JU1A 2WLVA 5KP8B 1M9CC 2K93A 1VQOP 2AFEA 3CCMP 1EIAA 1P7NA 3GKLC 2LTEA 2KW2A 3DPHA 2KOSA 1QVFO 2XV6A 3DS1A 1RO0A 2PY8A 2XZ0D 2JYGA 2M8LA 2K2QA 1YJ9P 1JJ2O 1YIJP 2LIWA 2KWLA 1M9DC 1QVGO 2L6EA 3MGEA 2EG5A 2CWOA 1VQNP 2X82A 1VQ7P 4U0DA 2DNWA 2JGPA 3EJEA 2N6ZA 1Q7YQ 2VLQA 1RNIA 3CXCO 3GZLA 3DS3A 1Q86Q 5HGOA 1ACPA 3G29A 1VQ4P 1ZMBA 3H0DA 2GDXA 2GZIA 1VQKP 1M74A 1VQMP 3CCQP 2PEIA 3CCLP 2KORA 1UJZA 4QKOA 1A43A 1M6EX 1L0IA 5HVCA 3CMEP 4M0IA 2WLVB 3H4EA 2OTLP 1VQ5P 1UNKA 3WBHA 3CC4P 3LRYA 1AF8A 4DG9A 3M1MA 2VLPA 5HV8A 5F2OA 3BP9A 1S72P 2K5XA 1U7KA 3CCEP 2JB0A 2LOLA 4XFXA 3CCUP 1L6NA 1M9XC 2PXRC 3EJBA 1VKUA 2N5IA 4HTWA 2WPTA 4PH1A 1Q82Q 1IMPA 1NQ4A 5I4TG 1YJNP 1M90Q 2AVAA 2KGEA 2GDWA 3CMAP 2XGVA 1KLPA 2PEQA 3DS0A 4COCA 4GR6A 2GZGA 4PWVB 1VHNA 4PXHB 2L9FA 4U0CA 2KODA 2Z45A 4XFYA 1GXHA 3RG2A 1W2BO 1K9MQ 2JPRA 2EHTA 3OW2O 1E0HA 1T8KA 2EFJA 1M6NA 2M5RA 3NY7B 2PEJA 1YITP 2LPKA 4MRTC 2V4XA 2ERHA 3G0VA 2PEMA 1F80D 4U0FA 2MR7A 2OARA 2X2BA 2AFDA 2XZ1C 2MVUA 4H2YC 1KC8Q 2Z44A 2K94A 1CEIA 2DGYA 4U0AA 2MVVA 2KR5A 2Y4ZA 2N98A 2EHSA 4J93A 2AF8A 3G1GA 3CC2P 4XRQA 2N50A 2VLNA 2JQ4A 4E91A 2XGYA 3CD6P 1OR5A 1GPJA 4XROA 3LMOA 1VQ6P 1K73Q 4HKGA 5EW5E 1FR2A 3DTJA 3G4SP
chains in the Genus database with same CATH topology
3HZQA 2X83A 2XDEA 1AK4C 2WLVA 1U7KA 1EM9A 1VQ9P 1YHQP 3CCEP 1M9CC 1VQOP 4XFXA 3CCUP 3VRLC 1L6NA 3B5IA 1M9XC 3CCMP 1EIAA 1IUQA 1P7NA 2PXRC 4NX4C 4HTWA 3DPHA 3G28A 2QA4P 5HGLA 5HGMA 5BS2A 4PH1A 2X2DD 2EIAA 1Q82Q 1QVFO 2XV6A 4XFZA 3DS1A 1RO0A 3DS4A 5I4TG 5DCKA 1YJNP 2PY8A 2PENA 1M9YC 1M90Q 2JYGA 3G26A 3Q20A 2M8LA 2ONTA 1M1KQ 1YJ9P 1JJ2O 4DGEC 5HGNA 1YIJP 3CMAP 3H47A 2XGVA 3G6EP 1VQLP 1M9DC 2PEQA 1EOQA 1QVGO 2PWMA 3DS0A 4COCA 4GR6A 5HGKA 3CCVP 2L6EA 3CCJP 3G21A 3MGEA 2EG5A 2CWOA 2Z46A 3CCSP 1M9FC 1VQNP 1K30A 1RO2A 2X82A 4U0CA 1Q81Q 2E1MA 2KODA 2KGFA 1E6JP 1BAJA 1VQ7P 2Z45A 4U0DA 4XFYA 4DGAC 4INBA 2BUOA 2OTJP 4PH3A 1Q7YQ 1W2BO 1K9MQ 1RNIA 3E2DA 3I55P 4B4NA 1QRJA 4QNBA 2JPRA 3CXCO 3DS3A 2P9XA 3OW2O 1Q86Q 5HGOA 3NTEA 1G03A 4IPYA 2EFJA 1AUMA 4COPA 1M6NA 3G29A 2PEJA 3P05A 1YITP 1YI2P 2V4XA 2JYLA 1VQ4P 1ZMBA 3G0VA 3H0DA 2PEKA 2XXMA 1VQKP 1AFVA 4LQWC 3DS5A 2GONA 2QEXP 2PEMA 1D1DA 1M74A 3G1IA 4U0FA 3I56P 1VQMP 1NJIQ 1K8AQ 3CCQP 2XGUA 4PH0A 2OARA 2PWOA 2PEIA 2JO0A 5F2KA 3CCLP 2XT1A 5F2NA 1KQSO 1KD1Q 1KC8Q 2BHVA 1A43A 1M6EX 2Z44A 5BS1A 2M8PA 2M8NA 4M0IA 2WLVB 3CMEP 1GWPA 2DGYA 3H4EA 2OTLP 4U0AA 2LF4A 1VQ5P 4U0BA 1N8RQ 2Y4ZA 3WBHA 1VQ8P 3CC4P 4J93A 3LRYA 3RG6C 3G1GA 3HYBA 1YJWP 5JPAA 1A8OA 3CC2P 4E92A 3CCRP 4XRQA 3DS2A 3CPWO 4GR2A 3M1MA 4E91A 2XGYA 3CD6P 2GOLB 5F2OA 4PH2A 2PEOA 3BP9A 4XROA 1VQPP 4U0EA 1VQ6P 1K73Q 1S72P 3CC7P 3G71P 4WYMA 1M9EC 3DTJA 3G4SP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X83 A;  2XDE A;  1AK4 C;  2WLV A;  1U7K A;  1EM9 A;  1M9C C;  4XFX A;  3VRL C;  1L6N A;  1M9X C;  1EIA A;  1P7N A;  2PXR C;  4NX4 C;  4HTW A;  3DPH A;  3G28 A;  5HGL A;  5HGM A;  4PH1 A;  2X2D D;  2EIA A;  2XV6 A;  4XFZ A;  3DS1 A;  3DS4 A;  5I4T G;  5DCK A;  1M9Y C;  2JYG A;  3G26 A;  2M8L A;  2ONT A;  4DGE C;  5HGN A;  3H47 A;  2XGV A;  1M9D C;  1EOQ A;  2PWM A;  3DS0 A;  4COC A;  5HGK A;  2L6E A;  3G21 A;  3MGE A;  1M9F C;  2X82 A;  4U0C A;  2KOD A;  2KGF A;  1E6J P;  1BAJ A;  4U0D A;  4XFY A;  4DGA C;  4INB A;  2BUO A;  4PH3 A;  4B4N A;  1QRJ A;  4QNB A;  2JPR A;  3DS3 A;  5HGO A;  3NTE A;  1G03 A;  4IPY A;  1AUM A;  4COP A;  3G29 A;  3P05 A;  2V4X A;  2JYL A;  3G0V A;  2XXM A;  1AFV A;  4LQW C;  3DS5 A;  2GON A;  1D1D A;  3G1I A;  4U0F A;  2XGU A;  4PH0 A;  2PWO A;  2JO0 A;  2XT1 A;  1A43 A;  2M8P A;  2M8N A;  4M0I A;  2WLV B;  1GWP A;  3H4E A;  4U0A A;  2LF4 A;  4U0B A;  2Y4Z A;  4J93 A;  3LRY A;  3G1G A;  5JPA A;  1A8O A;  4E92 A;  4XRQ A;  3DS2 A;  4E91 A;  2XGY A;  2GOL B;  4PH2 A;  3BP9 A;  4XRO A;  4U0E A;  4WYM A;  1M9E C;  3DTJ A; 
#chains in the Genus database with same CATH topology
 2X83 A;  2XDE A;  2K92 A;  1DV5 A;  2MY5 A;  3U43 A;  2CGQ A;  1IMQ A;  4NX4 C;  2FQ2 A;  3G28 A;  5CZD B;  2QA4 P;  3GZM A;  5HGL A;  4BPH A;  3GJN A;  1HY8 A;  2KG8 A;  2ROQ A;  1GXG A;  4DGE C;  2CNR A;  3H47 A;  3G6E P;  1VQL P;  2FQ0 A;  1EOQ A;  2PWM A;  2KG6 A;  3G21 A;  2Z46 A;  2FVF A;  2NO8 A;  1M9F C;  1K30 A;  1Q81 Q;  2E1M A;  2KGF A;  4DGA C;  4INB A;  2CG5 B;  2FVA A;  2LML A;  2K0X A;  3E2D A;  2L4B A;  3I55 P;  1QRJ A;  4QNB A;  2MR8 A;  2K0Y A;  1EMV A;  2KGA A;  3NTE A;  2JBG A;  4IZ6 A;  4IPY A;  1AUM A;  1YI2 P;  4F37 A;  2PEK A;  2XXM A;  1AFV A;  4LQW C;  2K0D X;  2GON A;  1D1D A;  3G1I A;  1K8A Q;  2VLO A;  2PWO A;  2JO0 A;  5F2N A;  4H2W C;  2KOO A;  1DNY A;  2KG9 A;  1KD1 Q;  2BHV A;  5BS1 A;  2M8P A;  2M8N A;  2FHS C;  2L22 A;  2JAZ A;  2MF4 A;  2LF4 A;  4U0B A;  1L0H A;  1N8R Q;  2FVE A;  1HQB A;  2FAC A;  2LIU A;  1YJW P;  5JPA A;  1A8O A;  3CCR P;  3DS2 A;  2N6Y A;  1MZ8 A;  2L0Q A;  3CPW O;  4GR2 A;  2GDY A;  4PH2 A;  2PEO A;  1VQP P;  4U0E A;  3CC7 P;  4WYM A;  1AK4 C;  1EM9 A;  1VQ9 P;  1YHQ P;  2GZF A;  3VRL C;  3B5I A;  4H2X C;  3EJD A;  1IUQ A;  5HGM A;  5BS2 A;  2KOP A;  2X2D D;  2EIA A;  1ZNV A;  4R0M A;  4XFZ A;  1X3O A;  3DS4 A;  2KGC A;  5DCK A;  2PEN A;  1M9Y C;  3G26 A;  3Q20 A;  4NEO A;  2ONT A;  5KP7 B;  5HGN A;  1Z6M A;  2KOQ A;  4CA3 A;  5HGK A;  3CCV P;  3CCJ P;  2GZE A;  5EJD A;  3CCS P;  1RO2 A;  2FAD A;  2LL8 A;  1E6J P;  1BAJ A;  2FAE A;  2BUO A;  2OTJ P;  4PH3 A;  4B4N A;  2P9X A;  7CEI A;  1G03 A;  4COP A;  3P05 A;  4BPF A;  2JYL A;  3CE7 A;  3DS5 A;  2FQ1 A;  2QEX P;  3I56 P;  1NJI Q;  2XGU A;  4PH0 A;  5F2K A;  2XT1 A;  1KQS O;  2N5H A;  2MD9 A;  1GWP A;  2GZJ A;  4UHP B;  3B4Q A;  1VQ8 P;  1AYI A;  3RG6 C;  3HYB A;  5KP6 B;  2JU2 A;  2LKI A;  2VSQ A;  4E92 A;  1BXI A;  2GYK A;  2PNG A;  2GOL B;  3G71 P;  1M1K Q;  1M9E C;  2QNW A;  3HZQ A;  2CQ8 A;  4BPG A;  2KGD A;  2JU1 A;  2WLV A;  5KP8 B;  1M9C C;  2K93 A;  1VQO P;  2AFE A;  3CCM P;  1EIA A;  1P7N A;  3GKL C;  2LTE A;  2KW2 A;  3DPH A;  2KOS A;  1QVF O;  2XV6 A;  3DS1 A;  1RO0 A;  2PY8 A;  2XZ0 D;  2JYG A;  2M8L A;  2K2Q A;  1YJ9 P;  1JJ2 O;  1YIJ P;  2LIW A;  2KWL A;  1M9D C;  1QVG O;  2L6E A;  3MGE A;  2EG5 A;  2CWO A;  1VQN P;  2X82 A;  1VQ7 P;  4U0D A;  2DNW A;  2JGP A;  3EJE A;  2N6Z A;  1Q7Y Q;  2VLQ A;  1RNI A;  3CXC O;  3GZL A;  3DS3 A;  1Q86 Q;  5HGO A;  1ACP A;  3G29 A;  1VQ4 P;  1ZMB A;  3H0D A;  2GDX A;  2GZI A;  1VQK P;  1M74 A;  1VQM P;  3CCQ P;  2PEI A;  3CCL P;  2KOR A;  1UJZ A;  4QKO A;  1A43 A;  1M6E X;  1L0I A;  5HVC A;  3CME P;  4M0I A;  2WLV B;  3H4E A;  2OTL P;  1VQ5 P;  1UNK A;  3WBH A;  3CC4 P;  3LRY A;  1AF8 A;  4DG9 A;  3M1M A;  2VLP A;  5HV8 A;  5F2O A;  3BP9 A;  1S72 P;  2K5X A;  1U7K A;  3CCE P;  2JB0 A;  2LOL A;  4XFX A;  3CCU P;  1L6N A;  1M9X C;  2PXR C;  3EJB A;  1VKU A;  2N5I A;  4HTW A;  2WPT A;  4PH1 A;  1Q82 Q;  1IMP A;  1NQ4 A;  5I4T G;  1YJN P;  1M90 Q;  2AVA A;  2KGE A;  2GDW A;  3CMA P;  2XGV A;  1KLP A;  2PEQ A;  3DS0 A;  4COC A;  4GR6 A;  2GZG A;  4PWV B;  1VHN A;  4PXH B;  2L9F A;  4U0C A;  2KOD A;  2Z45 A;  4XFY A;  1GXH A;  3RG2 A;  1W2B O;  1K9M Q;  2JPR A;  2EHT A;  3OW2 O;  1E0H A;  1T8K A;  2EFJ A;  1M6N A;  2M5R A;  3NY7 B;  2PEJ A;  1YIT P;  2LPK A;  4MRT C;  2V4X A;  2ERH A;  3G0V A;  2PEM A;  1F80 D;  4U0F A;  2MR7 A;  2OAR A;  2X2B A;  2AFD A;  2XZ1 C;  2MVU A;  4H2Y C;  1KC8 Q;  2Z44 A;  2K94 A;  1CEI A;  2DGY A;  4U0A A;  2MVV A;  2KR5 A;  2Y4Z A;  2N98 A;  2EHS A;  4J93 A;  2AF8 A;  3G1G A;  3CC2 P;  4XRQ A;  2N50 A;  2VLN A;  2JQ4 A;  4E91 A;  2XGY A;  3CD6 P;  1OR5 A;  1GPJ A;  4XRO A;  3LMO A;  1VQ6 P;  1K73 Q;  4HKG A;  5EW5 E;  1FR2 A;  3DTJ A;  3G4S P; 
#chains in the Genus database with same CATH homology
 3HZQ A;  2X83 A;  2XDE A;  1AK4 C;  2WLV A;  1U7K A;  1EM9 A;  1VQ9 P;  1YHQ P;  3CCE P;  1M9C C;  1VQO P;  4XFX A;  3CCU P;  3VRL C;  1L6N A;  3B5I A;  1M9X C;  3CCM P;  1EIA A;  1IUQ A;  1P7N A;  2PXR C;  4NX4 C;  4HTW A;  3DPH A;  3G28 A;  2QA4 P;  5HGL A;  5HGM A;  5BS2 A;  4PH1 A;  2X2D D;  2EIA A;  1Q82 Q;  1QVF O;  2XV6 A;  4XFZ A;  3DS1 A;  1RO0 A;  3DS4 A;  5I4T G;  5DCK A;  1YJN P;  2PY8 A;  2PEN A;  1M9Y C;  1M90 Q;  2JYG A;  3G26 A;  3Q20 A;  2M8L A;  2ONT A;  1M1K Q;  1YJ9 P;  1JJ2 O;  4DGE C;  5HGN A;  1YIJ P;  3CMA P;  3H47 A;  2XGV A;  3G6E P;  1VQL P;  1M9D C;  2PEQ A;  1EOQ A;  1QVG O;  2PWM A;  3DS0 A;  4COC A;  4GR6 A;  5HGK A;  3CCV P;  2L6E A;  3CCJ P;  3G21 A;  3MGE A;  2EG5 A;  2CWO A;  2Z46 A;  3CCS P;  1M9F C;  1VQN P;  1K30 A;  1RO2 A;  2X82 A;  4U0C A;  1Q81 Q;  2E1M A;  2KOD A;  2KGF A;  1E6J P;  1BAJ A;  1VQ7 P;  2Z45 A;  4U0D A;  4XFY A;  4DGA C;  4INB A;  2BUO A;  2OTJ P;  4PH3 A;  1Q7Y Q;  1W2B O;  1K9M Q;  1RNI A;  3E2D A;  3I55 P;  4B4N A;  1QRJ A;  4QNB A;  2JPR A;  3CXC O;  3DS3 A;  2P9X A;  3OW2 O;  1Q86 Q;  5HGO A;  3NTE A;  1G03 A;  4IPY A;  2EFJ A;  1AUM A;  4COP A;  1M6N A;  3G29 A;  2PEJ A;  3P05 A;  1YIT P;  1YI2 P;  2V4X A;  2JYL A;  1VQ4 P;  1ZMB A;  3G0V A;  3H0D A;  2PEK A;  2XXM A;  1VQK P;  1AFV A;  4LQW C;  3DS5 A;  2GON A;  2QEX P;  2PEM A;  1D1D A;  1M74 A;  3G1I A;  4U0F A;  3I56 P;  1VQM P;  1NJI Q;  1K8A Q;  3CCQ P;  2XGU A;  4PH0 A;  2OAR A;  2PWO A;  2PEI A;  2JO0 A;  5F2K A;  3CCL P;  2XT1 A;  5F2N A;  1KQS O;  1KD1 Q;  1KC8 Q;  2BHV A;  1A43 A;  1M6E X;  2Z44 A;  5BS1 A;  2M8P A;  2M8N A;  4M0I A;  2WLV B;  3CME P;  1GWP A;  2DGY A;  3H4E A;  2OTL P;  4U0A A;  2LF4 A;  1VQ5 P;  4U0B A;  1N8R Q;  2Y4Z A;  3WBH A;  1VQ8 P;  3CC4 P;  4J93 A;  3LRY A;  3RG6 C;  3G1G A;  3HYB A;  1YJW P;  5JPA A;  1A8O A;  3CC2 P;  4E92 A;  3CCR P;  4XRQ A;  3DS2 A;  3CPW O;  4GR2 A;  3M1M A;  4E91 A;  2XGY A;  3CD6 P;  2GOL B;  5F2O A;  4PH2 A;  2PEO A;  3BP9 A;  4XRO A;  1VQP P;  4U0E A;  1VQ6 P;  1K73 Q;  1S72 P;  3CC7 P;  3G71 P;  4WYM A;  1M9E C;  3DTJ A;  3G4S P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...