4XRQA

Disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i) in complex with pf-3450074
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
215
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFAALSCGATPQDLNTMLNTVGGHQAAMHMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYIDRFYKTIRAEQASQEATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 Resistance to the Capsid-Targeting Inhibitor PF74 Results in Altered Dependence on Host Factors Required for Virus Nuclear Entry.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 76
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xrqA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xrqA02
2XT1A 1AFVA 4PH0A 1GWPA 2GOLB 4B4NA 4E91A 1EIAA 4XRQA 2XGVA 2PWMA 4DGAC 2LF4A 3G29A 2BUOA 1L6NA 2JPRA 1D1DA 4U0FA 1BAJA 2JYGA 2JO0A 1A43A 4XFZA 4J93A 3DTJA 1M9YC 1M9CC 5HGKA 3G0VA 3DS5A 5DCKA 1M9DC 4INBA 3MGEA 2GONA 5HGNA 4PH1A 2PXRC 1U7KA 2M8NA 2XV6A 2WLVA 5HGOA 5I4TG 2ONTA 3DS0A 4U0BA 2M8PA 3G1IA 4COPA 1M9XC 3LRYA 3DPHA 4NX4C 5HGMA 3DS2A 3VRLC 2WLVB 3DS1A 2X82A 3DS4A 1M9EC 5HGLA 2X2DD 2XGYA 5JPAA 2Y4ZA 2EIAA 3H47A 4COCA 2JYLA 4XROA 2L6EA 3DS3A 1A8OA 3H4EA 2KGFA 4LQWC 1AUMA 3G28A 1EOQA 3G26A 2X83A 4WYMA 2PWOA 1QRJA 4QNBA 1P7NA 1G03A 1M9FC 4U0AA 2XGUA 4M0IA 4PH2A 4XFYA 2M8LA 2V4XA 1EM9A 2KODA 4U0CA 1AK4C 3NTEA 4HTWA 4DGEC 4IPYA 3BP9A 4U0EA 4XFXA 4PH3A 2XXMA 1E6JP 3G21A 3G1GA 4E92A 4U0DA 3P05A 2XDEA
chains in the Genus database with same CATH superfamily
1AFVA 2N5HA 2L4BA 1KD1Q 2N98A 3LMOA 1D1DA 1BAJA 2GZFA 2JYGA 5KP6B 4J93A 1N8RQ 1M9CC 5HGKA 1M90Q 1VQOP 1FR2A 5DCKA 1M9DC 1Q7YQ 5HGNA 1MZ8A 2AFEA 2XZ1C 1U7KA 2M5RA 4IZ6A 2JU1A 1NJIQ 2KWLA 2MF4A 1YJWP 1M9XC 1AF8A 3LRYA 3DPHA 4NX4C 2QA4P 2CNRA 1QVGO 1S72P 3VRLC 1IUQA 3GZMA 5EJDA 2EG5A 2OTLP 2L9FA 1VQ9P 2FVEA 2K5XA 2DNWA 5JPAA 2Z45A 2LL8A 2PENA 2JYLA 2VLNA 3B5IA 3G28A 2PEMA 2FACA 4QNBA 3CE7A 3E2DA 2KOPA 3G6EP 1VQ5P 2CQ8A 1K8AQ 2CWOA 2XGUA 2M8LA 2MVUA 2KODA 1M6NA 4DGEC 2VSQA 4IPYA 3BP9A 1L0IA 2PNGA 2XXMA 1E6JP 1JJ2O 2N50A 5I4TG 3CMAP 2GDWA 4B4NA 3Q20A 1GXHA 2LMLA 2OTJP 4UHPB 1X3OA 2GZEA 3WBHA 3I55P 2JO0A 5F2OA 1L0HA 4PXHB 1M74A 3GKLC 4PWVB 2KR5A 2FQ0A 2GYKA 1K30A 2KG9A 3MGEA 2FQ1A 2PXRC 2FAEA 5KP7B 2KG6A 2AVAA 2XV6A 5HGOA 2FQ2A 3RG6C 4COPA 2M8PA 3G1IA 1YHQP 2FHSC 2LTEA 4BPGA 1VQ4P 1DV5A 3G71P 4R0MA 1BXIA 2E1MA 2GDYA 2LIUA 2PEJA 2KORA 4QKOA 2WLVB 2MD9A 1GPJA 1YJNP 2X82A 3CCJP 2Y4ZA 2EIAA 2ERHA 1VQPP 3GJNA 2L6EA 4H2WC 1A8OA 1AUMA 3M1MA 2JAZA 2JQ4A 2LIWA 2Z44A 3HZQA 3CC2P 5F2KA 1QVFO 3CXCO 1M6EX 1P7NA 5EW5E 2N6YA 2KGAA 2JGPA 2CGQA 1OR5A 2AFDA 4HTWA 1ZNVA 1K73Q 2PEIA 4PH3A 5HV8A 2KG8A 1RNIA 2XDEA 2KGDA 4PH0A 2GOLB 3CCVP 1YJ9P 1EIAA 4NEOA 4XRQA 2XGVA 5CZDB 1HY8A 4GR2A 2LF4A 5BS2A 3G29A 2BUOA 1L6NA 1K9MQ 1A43A 4XFZA 1F80D 3DTJA 2PEOA 1E0HA 2FVAA 3G0VA 3DS5A 2DGYA 2FVFA 1CEIA 2OARA 2KOQA 4INBA 1IMQA 2GONA 2QNWA 1EMVA 3G4SP 1NQ4A 2JU2A 2GDXA 1ZMBA 3B4QA 2ONTA 3CCSP 4U0BA 4F37A 5F2NA 5HGMA 2MR8A 3CCQP 2K0YA 3I56P 3DS1A 4H2YC 1W2BO 1M9EC 2VLOA 5HGLA 2X2DD 2BHVA 2XGYA 2MVVA 1AYIA 3DS3A 1DNYA 2KGFA 3CMEP 1GXGA 1YIJP 1EOQA 3G26A 3CC7P 1HQBA 2KOOA 2K0DX 2LOLA 1Z6MA 2MY5A 2Z46A 3HYBA 1G03A 1T8KA 3CCUP 1M9FC 2LKIA 1VQ6P 2QEXP 4DG9A 4PH2A 4XFYA 2WPTA 1VHNA 4U0CA 3CCEP 2XZ0D 4BPFA 3CD6P 1RO0A 2X2BA 2K0XA 4GR6A 3G21A 1IMPA 2XT1A 2KOSA 2K93A 1GWPA 1M1KQ 4E91A 2GZJA 2K94A 3GZLA 3NY7B 2GZIA 2CG5B 2K2QA 2PWMA 3CPWO 3CCRP 4DGAC 3U43A 2P9XA 1KQSO 2JPRA 4HKGA 4U0FA 1VQ7P 2L22A 1M9YC 2MR7A 1KC8Q 1RO2A 2K92A 3EJDA 3CCLP 2JBGA 2L0QA 2EHSA 4PH1A 4BPHA 2M8NA 2EHTA 1VQMP 2WLVA 2KW2A 2KGCA 5BS1A 3DS0A 3OW2O 2LPKA 3EJBA 2PY8A 4CA3A 1YITP 3DS2A 3H0DA 3DS4A 1VQ8P 2AF8A 1Q81Q 1VQKP 2GZGA 3H47A 2KGEA 4COCA 4XROA 2N5IA 3CCMP 2EFJA 3H4EA 2FADA 4MRTC 5HVCA 4LQWC 3EJEA 2NO8A 2X83A 2ROQA 3RG2A 4WYMA 1YI2P 2PWOA 1KLPA 7CEIA 2VLQA 1QRJA 1Q82Q 2N6ZA 2VLPA 1VQLP 4U0AA 1UNKA 4M0IA 2JB0A 4H2XC 2V4XA 1Q86Q 1EM9A 1AK4C 3NTEA 1UJZA 1VQNP 4U0EA 2PEKA 4XFXA 5KP8B 3G1GA 4E92A 3CC4P 4U0DA 3P05A 2PEQA 1VKUA 1ACPA
chains in the Genus database with same CATH topology
2XT1A 3CMAP 1AFVA 4PH0A 1GWPA 2GOLB 1M1KQ 4B4NA 4E91A 3CCVP 3Q20A 1YJ9P 1EIAA 4XRQA 2XGVA 2OTJP 2PWMA 3CPWO 3CCRP 1KD1Q 4DGAC 4GR2A 2LF4A 2P9XA 3WBHA 5BS2A 3G29A 1KQSO 2BUOA 1L6NA 2JPRA 3I55P 1D1DA 1K9MQ 4U0FA 1BAJA 2JYGA 2JO0A 1VQ7P 5F2OA 1A43A 4XFZA 4J93A 1M74A 3DTJA 1M9YC 1N8RQ 2PEOA 1M9CC 5HGKA 1KC8Q 3G0VA 1RO2A 3DS5A 2DGYA 1VQOP 1M90Q 3CCLP 5DCKA 1M9DC 1K30A 2OARA 4INBA 1Q7YQ 3MGEA 2GONA 5HGNA 4PH1A 2PXRC 1U7KA 2M8NA 3G4SP 1VQMP 2XV6A 2WLVA 5BS1A 5HGOA 5I4TG 1ZMBA 1NJIQ 3RG6C 2ONTA 3CCSP 3DS0A 4U0BA 2M8PA 3G1IA 4COPA 1YHQP 3OW2O 1YJWP 1M9XC 2PY8A 3LRYA 1VQ4P 3G71P 3DPHA 4NX4C 5F2NA 1YITP 2QA4P 5HGMA 3CCQP 1QVGO 2E1MA 1S72P 3DS2A 3VRLC 3I56P 2PEJA 1IUQA 2WLVB 3DS1A 3H0DA 1YJNP 2X82A 2EG5A 3DS4A 1M9EC 3CCJP 5HGLA 1W2BO 2X2DD 1VQ8P 2BHVA 2OTLP 2XGYA 1VQ9P 1Q81Q 1VQKP 2Z45A 5JPAA 2Y4ZA 2EIAA 2PENA 1VQPP 3H47A 4COCA 2JYLA 4XROA 3CCMP 2L6EA 3DS3A 2EFJA 1A8OA 3H4EA 3B5IA 2KGFA 4LQWC 1AUMA 3CMEP 3M1MA 3G28A 1YIJP 1EOQA 3G26A 2X83A 2Z44A 3HZQA 4WYMA 2PEMA 1YI2P 3CC7P 2PWOA 3CC2P 1QRJA 5F2KA 4QNBA 1QVFO 1Q82Q 3E2DA 3CXCO 3G6EP 2Z46A 1M6EX 1P7NA 3HYBA 1G03A 3CCUP 1VQ5P 1M9FC 1K8AQ 2CWOA 1VQLP 4U0AA 1VQ6P 2QEXP 2XGUA 4M0IA 4PH2A 4XFYA 2M8LA 2V4XA 1Q86Q 1EM9A 2KODA 4U0CA 1M6NA 1AK4C 3NTEA 4HTWA 4DGEC 4IPYA 3CCEP 3CD6P 1RO0A 1VQNP 3BP9A 4U0EA 2PEKA 1K73Q 2PEIA 4XFXA 4PH3A 2XXMA 4GR6A 1E6JP 3G21A 3G1GA 1JJ2O 4E92A 3CC4P 4U0DA 3P05A 1RNIA 2PEQA 2XDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT1 A;  1AFV A;  4PH0 A;  1GWP A;  2GOL B;  4B4N A;  4E91 A;  1EIA A;  4XRQ A;  2XGV A;  2PWM A;  4DGA C;  2LF4 A;  3G29 A;  2BUO A;  1L6N A;  2JPR A;  1D1D A;  4U0F A;  1BAJ A;  2JYG A;  2JO0 A;  1A43 A;  4XFZ A;  4J93 A;  3DTJ A;  1M9Y C;  1M9C C;  5HGK A;  3G0V A;  3DS5 A;  5DCK A;  1M9D C;  4INB A;  3MGE A;  2GON A;  5HGN A;  4PH1 A;  2PXR C;  1U7K A;  2M8N A;  2XV6 A;  2WLV A;  5HGO A;  5I4T G;  2ONT A;  3DS0 A;  4U0B A;  2M8P A;  3G1I A;  4COP A;  1M9X C;  3LRY A;  3DPH A;  4NX4 C;  5HGM A;  3DS2 A;  3VRL C;  2WLV B;  3DS1 A;  2X82 A;  3DS4 A;  1M9E C;  5HGL A;  2X2D D;  2XGY A;  5JPA A;  2Y4Z A;  2EIA A;  3H47 A;  4COC A;  2JYL A;  4XRO A;  2L6E A;  3DS3 A;  1A8O A;  3H4E A;  2KGF A;  4LQW C;  1AUM A;  3G28 A;  1EOQ A;  3G26 A;  2X83 A;  4WYM A;  2PWO A;  1QRJ A;  4QNB A;  1P7N A;  1G03 A;  1M9F C;  4U0A A;  2XGU A;  4M0I A;  4PH2 A;  4XFY A;  2M8L A;  2V4X A;  1EM9 A;  2KOD A;  4U0C A;  1AK4 C;  3NTE A;  4HTW A;  4DGE C;  4IPY A;  3BP9 A;  4U0E A;  4XFX A;  4PH3 A;  2XXM A;  1E6J P;  3G21 A;  3G1G A;  4E92 A;  4U0D A;  3P05 A;  2XDE A; 
#chains in the Genus database with same CATH topology
 1AFV A;  2N5H A;  2L4B A;  1KD1 Q;  2N98 A;  3LMO A;  1D1D A;  1BAJ A;  2GZF A;  2JYG A;  5KP6 B;  4J93 A;  1N8R Q;  1M9C C;  5HGK A;  1M90 Q;  1VQO P;  1FR2 A;  5DCK A;  1M9D C;  1Q7Y Q;  5HGN A;  1MZ8 A;  2AFE A;  2XZ1 C;  1U7K A;  2M5R A;  4IZ6 A;  2JU1 A;  1NJI Q;  2KWL A;  2MF4 A;  1YJW P;  1M9X C;  1AF8 A;  3LRY A;  3DPH A;  4NX4 C;  2QA4 P;  2CNR A;  1QVG O;  1S72 P;  3VRL C;  1IUQ A;  3GZM A;  5EJD A;  2EG5 A;  2OTL P;  2L9F A;  1VQ9 P;  2FVE A;  2K5X A;  2DNW A;  5JPA A;  2Z45 A;  2LL8 A;  2PEN A;  2JYL A;  2VLN A;  3B5I A;  3G28 A;  2PEM A;  2FAC A;  4QNB A;  3CE7 A;  3E2D A;  2KOP A;  3G6E P;  1VQ5 P;  2CQ8 A;  1K8A Q;  2CWO A;  2XGU A;  2M8L A;  2MVU A;  2KOD A;  1M6N A;  4DGE C;  2VSQ A;  4IPY A;  3BP9 A;  1L0I A;  2PNG A;  2XXM A;  1E6J P;  1JJ2 O;  2N50 A;  5I4T G;  3CMA P;  2GDW A;  4B4N A;  3Q20 A;  1GXH A;  2LML A;  2OTJ P;  4UHP B;  1X3O A;  2GZE A;  3WBH A;  3I55 P;  2JO0 A;  5F2O A;  1L0H A;  4PXH B;  1M74 A;  3GKL C;  4PWV B;  2KR5 A;  2FQ0 A;  2GYK A;  1K30 A;  2KG9 A;  3MGE A;  2FQ1 A;  2PXR C;  2FAE A;  5KP7 B;  2KG6 A;  2AVA A;  2XV6 A;  5HGO A;  2FQ2 A;  3RG6 C;  4COP A;  2M8P A;  3G1I A;  1YHQ P;  2FHS C;  2LTE A;  4BPG A;  1VQ4 P;  1DV5 A;  3G71 P;  4R0M A;  1BXI A;  2E1M A;  2GDY A;  2LIU A;  2PEJ A;  2KOR A;  4QKO A;  2WLV B;  2MD9 A;  1GPJ A;  1YJN P;  2X82 A;  3CCJ P;  2Y4Z A;  2EIA A;  2ERH A;  1VQP P;  3GJN A;  2L6E A;  4H2W C;  1A8O A;  1AUM A;  3M1M A;  2JAZ A;  2JQ4 A;  2LIW A;  2Z44 A;  3HZQ A;  3CC2 P;  5F2K A;  1QVF O;  3CXC O;  1M6E X;  1P7N A;  5EW5 E;  2N6Y A;  2KGA A;  2JGP A;  2CGQ A;  1OR5 A;  2AFD A;  4HTW A;  1ZNV A;  1K73 Q;  2PEI A;  4PH3 A;  5HV8 A;  2KG8 A;  1RNI A;  2XDE A;  2KGD A;  4PH0 A;  2GOL B;  3CCV P;  1YJ9 P;  1EIA A;  4NEO A;  4XRQ A;  2XGV A;  5CZD B;  1HY8 A;  4GR2 A;  2LF4 A;  5BS2 A;  3G29 A;  2BUO A;  1L6N A;  1K9M Q;  1A43 A;  4XFZ A;  1F80 D;  3DTJ A;  2PEO A;  1E0H A;  2FVA A;  3G0V A;  3DS5 A;  2DGY A;  2FVF A;  1CEI A;  2OAR A;  2KOQ A;  4INB A;  1IMQ A;  2GON A;  2QNW A;  1EMV A;  3G4S P;  1NQ4 A;  2JU2 A;  2GDX A;  1ZMB A;  3B4Q A;  2ONT A;  3CCS P;  4U0B A;  4F37 A;  5F2N A;  5HGM A;  2MR8 A;  3CCQ P;  2K0Y A;  3I56 P;  3DS1 A;  4H2Y C;  1W2B O;  1M9E C;  2VLO A;  5HGL A;  2X2D D;  2BHV A;  2XGY A;  2MVV A;  1AYI A;  3DS3 A;  1DNY A;  2KGF A;  3CME P;  1GXG A;  1YIJ P;  1EOQ A;  3G26 A;  3CC7 P;  1HQB A;  2KOO A;  2K0D X;  2LOL A;  1Z6M A;  2MY5 A;  2Z46 A;  3HYB A;  1G03 A;  1T8K A;  3CCU P;  1M9F C;  2LKI A;  1VQ6 P;  2QEX P;  4DG9 A;  4PH2 A;  4XFY A;  2WPT A;  1VHN A;  4U0C A;  3CCE P;  2XZ0 D;  4BPF A;  3CD6 P;  1RO0 A;  2X2B A;  2K0X A;  4GR6 A;  3G21 A;  1IMP A;  2XT1 A;  2KOS A;  2K93 A;  1GWP A;  1M1K Q;  4E91 A;  2GZJ A;  2K94 A;  3GZL A;  3NY7 B;  2GZI A;  2CG5 B;  2K2Q A;  2PWM A;  3CPW O;  3CCR P;  4DGA C;  3U43 A;  2P9X A;  1KQS O;  2JPR A;  4HKG A;  4U0F A;  1VQ7 P;  2L22 A;  1M9Y C;  2MR7 A;  1KC8 Q;  1RO2 A;  2K92 A;  3EJD A;  3CCL P;  2JBG A;  2L0Q A;  2EHS A;  4PH1 A;  4BPH A;  2M8N A;  2EHT A;  1VQM P;  2WLV A;  2KW2 A;  2KGC A;  5BS1 A;  3DS0 A;  3OW2 O;  2LPK A;  3EJB A;  2PY8 A;  4CA3 A;  1YIT P;  3DS2 A;  3H0D A;  3DS4 A;  1VQ8 P;  2AF8 A;  1Q81 Q;  1VQK P;  2GZG A;  3H47 A;  2KGE A;  4COC A;  4XRO A;  2N5I A;  3CCM P;  2EFJ A;  3H4E A;  2FAD A;  4MRT C;  5HVC A;  4LQW C;  3EJE A;  2NO8 A;  2X83 A;  2ROQ A;  3RG2 A;  4WYM A;  1YI2 P;  2PWO A;  1KLP A;  7CEI A;  2VLQ A;  1QRJ A;  1Q82 Q;  2N6Z A;  2VLP A;  1VQL P;  4U0A A;  1UNK A;  4M0I A;  2JB0 A;  4H2X C;  2V4X A;  1Q86 Q;  1EM9 A;  1AK4 C;  3NTE A;  1UJZ A;  1VQN P;  4U0E A;  2PEK A;  4XFX A;  5KP8 B;  3G1G A;  4E92 A;  3CC4 P;  4U0D A;  3P05 A;  2PEQ A;  1VKU A;  1ACP A; 
#chains in the Genus database with same CATH homology
 2XT1 A;  3CMA P;  1AFV A;  4PH0 A;  1GWP A;  2GOL B;  1M1K Q;  4B4N A;  4E91 A;  3CCV P;  3Q20 A;  1YJ9 P;  1EIA A;  4XRQ A;  2XGV A;  2OTJ P;  2PWM A;  3CPW O;  3CCR P;  1KD1 Q;  4DGA C;  4GR2 A;  2LF4 A;  2P9X A;  3WBH A;  5BS2 A;  3G29 A;  1KQS O;  2BUO A;  1L6N A;  2JPR A;  3I55 P;  1D1D A;  1K9M Q;  4U0F A;  1BAJ A;  2JYG A;  2JO0 A;  1VQ7 P;  5F2O A;  1A43 A;  4XFZ A;  4J93 A;  1M74 A;  3DTJ A;  1M9Y C;  1N8R Q;  2PEO A;  1M9C C;  5HGK A;  1KC8 Q;  3G0V A;  1RO2 A;  3DS5 A;  2DGY A;  1VQO P;  1M90 Q;  3CCL P;  5DCK A;  1M9D C;  1K30 A;  2OAR A;  4INB A;  1Q7Y Q;  3MGE A;  2GON A;  5HGN A;  4PH1 A;  2PXR C;  1U7K A;  2M8N A;  3G4S P;  1VQM P;  2XV6 A;  2WLV A;  5BS1 A;  5HGO A;  5I4T G;  1ZMB A;  1NJI Q;  3RG6 C;  2ONT A;  3CCS P;  3DS0 A;  4U0B A;  2M8P A;  3G1I A;  4COP A;  1YHQ P;  3OW2 O;  1YJW P;  1M9X C;  2PY8 A;  3LRY A;  1VQ4 P;  3G71 P;  3DPH A;  4NX4 C;  5F2N A;  1YIT P;  2QA4 P;  5HGM A;  3CCQ P;  1QVG O;  2E1M A;  1S72 P;  3DS2 A;  3VRL C;  3I56 P;  2PEJ A;  1IUQ A;  2WLV B;  3DS1 A;  3H0D A;  1YJN P;  2X82 A;  2EG5 A;  3DS4 A;  1M9E C;  3CCJ P;  5HGL A;  1W2B O;  2X2D D;  1VQ8 P;  2BHV A;  2OTL P;  2XGY A;  1VQ9 P;  1Q81 Q;  1VQK P;  2Z45 A;  5JPA A;  2Y4Z A;  2EIA A;  2PEN A;  1VQP P;  3H47 A;  4COC A;  2JYL A;  4XRO A;  3CCM P;  2L6E A;  3DS3 A;  2EFJ A;  1A8O A;  3H4E A;  3B5I A;  2KGF A;  4LQW C;  1AUM A;  3CME P;  3M1M A;  3G28 A;  1YIJ P;  1EOQ A;  3G26 A;  2X83 A;  2Z44 A;  3HZQ A;  4WYM A;  2PEM A;  1YI2 P;  3CC7 P;  2PWO A;  3CC2 P;  1QRJ A;  5F2K A;  4QNB A;  1QVF O;  1Q82 Q;  3E2D A;  3CXC O;  3G6E P;  2Z46 A;  1M6E X;  1P7N A;  3HYB A;  1G03 A;  3CCU P;  1VQ5 P;  1M9F C;  1K8A Q;  2CWO A;  1VQL P;  4U0A A;  1VQ6 P;  2QEX P;  2XGU A;  4M0I A;  4PH2 A;  4XFY A;  2M8L A;  2V4X A;  1Q86 Q;  1EM9 A;  2KOD A;  4U0C A;  1M6N A;  1AK4 C;  3NTE A;  4HTW A;  4DGE C;  4IPY A;  3CCE P;  3CD6 P;  1RO0 A;  1VQN P;  3BP9 A;  4U0E A;  2PEK A;  1K73 Q;  2PEI A;  4XFX A;  4PH3 A;  2XXM A;  4GR6 A;  1E6J P;  3G21 A;  3G1G A;  1JJ2 O;  4E92 A;  3CC4 P;  4U0D A;  3P05 A;  1RNI A;  2PEQ A;  2XDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...