4XRQA

Disulfide stabilized hiv-1 ca hexamer 4mut (s41a, q67h, v165i, l172i) in complex with pf-3450074
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
219
structure length
215
Chain Sequence
PIVQNLQGQMVHQCISPRTLNAWVKVVEEKAFSPEVIPMFAALSCGATPQDLNTMLNTVGGHQAAMHMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTSILDIRQGPKEPFRDYIDRFYKTIRAEQASQEATETLLVQNANPDCKTILKALGPGATLEEMMTACQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 Resistance to the Capsid-Targeting Inhibitor PF74 Results in Altered Dependence on Host Factors Required for Virus Nuclear Entry.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Capsid protein p24
total genus 76
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00607 Gag_p24 gag gene protein p24 (core nucleocapsid protein)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4xrqA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 4xrqA02
2X82A 4COPA 2PXRC 2LF4A 2M8PA 1GWPA 3NTEA 3LRYA 3G26A 3H4EA 3DS2A 5I4TG 4B4NA 2X2DD 2JYLA 3DTJA 5HGLA 4DGEC 3H47A 3DS0A 2KGFA 2X83A 2V4XA 2M8LA 2JO0A 4U0FA 5HGKA 1A43A 4E92A 4XRQA 5DCKA 4XFYA 1EOQA 4U0DA 3VRLC 2XGYA 2JPRA 4XROA 2XDEA 3DS5A 3G1GA 3G28A 4PH2A 2XV6A 3P05A 4PH0A 4U0CA 3DS3A 1EM9A 1M9DC 2WLVB 2XXMA 1AUMA 2ONTA 2WLVA 1U7KA 2EIAA 4U0AA 1M9YC 4IPYA 2JYGA 2XGVA 3G21A 1D1DA 1M9FC 2KODA 1M9XC 3DS4A 1P7NA 5JPAA 3MGEA 2XT1A 4HTWA 1G03A 4WYMA 4U0EA 1BAJA 5HGMA 2GOLB 4COCA 4XFXA 3G0VA 4LQWC 4M0IA 4PH1A 4NX4C 3DPHA 1AFVA 3DS1A 2XGUA 1QRJA 2GONA 2BUOA 3G29A 4J93A 1L6NA 1M9CC 1E6JP 4PH3A 1A8OA 1M9EC 1AK4C 4QNBA 4INBA 4U0BA 5HGOA 4E91A 2L6EA 2M8NA 4XFZA 4DGAC 3G1IA 3BP9A 2Y4ZA 2PWOA 2PWMA 5HGNA 1EIAA
chains in the Genus database with same CATH superfamily
2XZ1C 1S72P 3EJBA 4COPA 2M8PA 1KD1Q 2CNRA 3CPWO 1AYIA 1IMQA 1W2BO 3DS2A 2JYLA 2KGCA 3M1MA 3CCRP 5HGLA 3H47A 4CA3A 1M90Q 2M8LA 4BPGA 3GJNA 4BPFA 4XRQA 1VQ5P 1VHNA 5HVCA 2XGYA 2JPRA 1Q81Q 2K0XA 4XROA 1L0HA 2PY8A 2FVFA 2KOQA 2XDEA 3CC7P 3DS5A 4H2YC 5F2KA 2PEMA 2EG5A 3LMOA 4PH2A 2K0YA 2VLNA 1RO2A 3RG2A 1UNKA 3DS3A 3CXCO 1M9DC 2N6ZA 2XXMA 5EJDA 1VQ9P 1M9YC 4IPYA 3G21A 3WBHA 3G71P 2JB0A 2Z45A 2KODA 2PNGA 1IUQA 2KGAA 1VQPP 2LTEA 2XT1A 3CCSP 2KG6A 3I56P 3CCQP 1VQ7P 3U43A 4MRTC 1HY8A 4GR6A 2KG9A 4LQWC 2QA4P 1VQNP 1K30A 3I55P 2GONA 3E2DA 2BUOA 3HYBA 3G29A 4J93A 2PENA 3EJEA 3G6EP 2FQ0A 1N8RQ 2N5IA 3B5IA 1GXHA 2GDYA 1K8AQ 4E91A 5KP6B 2M5RA 2P9XA 3CCMP 2MR7A 2MF4A 1VQMP 3CMEP 2KWLA 1YJ9P 1YJNP 1UJZA 1EIAA 2X82A 2DNWA 2AFEA 4PXHB 3CC4P 2LF4A 2GZJA 5CZDB 3NTEA 2K94A 3CD6P 2FQ1A 2KGFA 2E1MA 2EHTA 5HGKA 1A43A 5KP7B 4E92A 2CQ8A 2GZIA 2K5XA 2CGQA 1KQSO 1NQ4A 1NJIQ 2XZ0D 2KGDA 1EOQA 4U0DA 7CEIA 5EW5E 1ACPA 2MY5A 2KGEA 1YJWP 1DNYA 3G28A 2L4BA 5BS1A 2AVAA 1DV5A 2XV6A 1ZMBA 1M6NA 2QEXP 1VQLP 2N6YA 2WLVB 1AUMA 2QNWA 2ONTA 2WLVA 3GZLA 1U7KA 2ROQA 1AF8A 4U0AA 2L9FA 2N5HA 2Z44A 2JYGA 1D1DA 1T8KA 2WPTA 4H2XC 5F2OA 1GXGA 1P7NA 1JJ2O 2MVUA 2X2BA 4WYMA 1BAJA 1OR5A 4COCA 1VQKP 2JU2A 4M0IA 4QKOA 2N98A 1Z6MA 2JAZA 4IZ6A 1E6JP 4PH3A 1A8OA 2KORA 1FR2A 1AK4C 1Q82Q 1YIJP 2KOSA 5HGOA 1RNIA 3GZMA 2FHSC 3EJDA 3BP9A 2CWOA 2PWOA 2FADA 4H2WC 3CCUP 4GR2A 2PEQA 2MR8A 1Q7YQ 2VSQA 1F80D 3LRYA 3H4EA 2N50A 5I4TG 4B4NA 4DGEC 2KW2A 4NEOA 2X83A 1ZNVA 2AFDA 2OARA 2FACA 2JO0A 2LL8A 1QVFO 5HV8A 2KOPA 2LKIA 2FVEA 1KC8Q 2LIUA 2K92A 2K2QA 5DCKA 5KP8B 3VRLC 1YI2P 3NY7B 2BHVA 1X3OA 1RO0A 1BXIA 4PWVB 3P05A 4PH0A 4U0CA 1EM9A 2LIWA 1M6EX 4BPHA 2CG5B 2EIAA 2GZEA 2XGVA 4F37A 1CEIA 1M9FC 1M9XC 3DS4A 5JPAA 4HTWA 1G03A 2L22A 2JQ4A 3H0DA 2VLPA 4DG9A 3DPHA 2MD9A 2XGUA 2Z46A 1M1KQ 2GDXA 3CC2P 2VLQA 3CMAP 2NO8A 4QNBA 4INBA 1EMVA 2GZFA 1VQ6P 1VKUA 2L6EA 1Q86Q 4DGAC 3G1IA 2PEJA 1VQ8P 1YHQP 1M74A 2FVAA 5HGNA 3HZQA 1K9MQ 2KR5A 2PXRC 1GWPA 1GPJA 3G26A 2X2DD 1HQBA 3DTJA 3GKLC 1YITP 2DGYA 3DS0A 2V4XA 4U0FA 2VLOA 3B4QA 2FAEA 2LOLA 3RG6C 4XFYA 2OTJP 2PEOA 2K93A 3G1GA 2GYKA 2PEIA 2JBGA 1IMPA 1VQOP 2GZGA 2MVVA 2L0QA 5BS2A 2GDWA 2OTLP 1VQ4P 2K0DX 3CE7A 4R0MA 3MGEA 4HKGA 4U0EA 3G4SP 5HGMA 2LMLA 2GOLB 3Q20A 1QVGO 4XFXA 1E0HA 3G0VA 4PH1A 2LPKA 4NX4C 2KOOA 1AFVA 3DS1A 1QRJA 1K73Q 1L0IA 2FQ2A 2KG8A 5F2NA 1L6NA 1M9CC 2JU1A 2EFJA 3CCEP 1M9EC 2JGPA 4UHPB 2PEKA 3CCVP 4U0BA 3OW2O 2ERHA 2EHSA 3CCJP 3CCLP 2AF8A 1MZ8A 2M8NA 4XFZA 2Y4ZA 1KLPA 2PWMA
chains in the Genus database with same CATH topology
2X82A 2PEQA 1S72P 1K9MQ 1Q7YQ 3CC4P 4COPA 2PXRC 2LF4A 2M8PA 1GWPA 1KD1Q 3NTEA 3CPWO 3LRYA 1W2BO 4GR2A 3G26A 3H4EA 3DS2A 3CD6P 5I4TG 4B4NA 2X2DD 2JYLA 3DTJA 3M1MA 3CCRP 5HGLA 4DGEC 1YITP 3H47A 2DGYA 1M90Q 3DS0A 2KGFA 2X83A 2E1MA 2OARA 2V4XA 2M8LA 2JO0A 4U0FA 5HGKA 1QVFO 1A43A 4E92A 1KQSO 4XRQA 1VQ5P 1KC8Q 1NJIQ 5DCKA 3RG6C 4XFYA 1EOQA 4U0DA 3VRLC 2OTJP 2XGYA 2JPRA 1Q81Q 1YI2P 4XROA 2PY8A 2BHVA 1YJWP 2XDEA 3CC7P 1RO0A 3DS5A 2PEMA 2PEOA 3G1GA 3G28A 5F2KA 2EG5A 5BS1A 4PH2A 2PEIA 2XV6A 1ZMBA 1M6NA 3P05A 2QEXP 4PH0A 1RO2A 4U0CA 1VQLP 3DS3A 3CXCO 1EM9A 1M9DC 2WLVB 1VQOP 1M6EX 2XXMA 1AUMA 2ONTA 2WLVA 1U7KA 5BS2A 2OTLP 2EIAA 4U0AA 1VQ9P 1M9YC 1VQ4P 2Z44A 2JYGA 2XGVA 3G21A 4IPYA 3WBHA 1D1DA 3G71P 2Z45A 1M9FC 2KODA 1IUQA 1VQPP 1M9XC 5F2OA 3DS4A 1P7NA 5JPAA 3MGEA 2XT1A 3CCSP 4HTWA 1G03A 1JJ2O 3I56P 4WYMA 4U0EA 3H0DA 3G4SP 3CCQP 1VQ7P 1BAJA 5HGMA 2GOLB 4COCA 1VQKP 3Q20A 1QVGO 4GR6A 4XFXA 3G0VA 4LQWC 4M0IA 4PH1A 4NX4C 3DPHA 2QA4P 1AFVA 1K30A 1VQNP 3I55P 3DS1A 2XGUA 1QRJA 2GONA 2Z46A 3E2DA 1K73Q 2BUOA 1M1KQ 3HYBA 3G29A 5F2NA 3CC2P 3CMAP 4J93A 1L6NA 1M9CC 1E6JP 4PH3A 1A8OA 2EFJA 2PENA 1M9EC 3CCEP 2PEKA 1AK4C 4QNBA 3G6EP 4INBA 3CCVP 1Q82Q 4U0BA 3OW2O 1YIJP 1N8RQ 3CCJP 3B5IA 5HGOA 1K8AQ 1RNIA 4E91A 3CCLP 1VQ6P 2L6EA 2M8NA 4XFZA 2P9XA 1Q86Q 4DGAC 3G1IA 2PEJA 1VQ8P 3CCMP 3BP9A 2Y4ZA 2CWOA 1VQMP 2PWOA 3CMEP 1YHQP 1YJ9P 1M74A 2PWMA 3CCUP 1YJNP 5HGNA 3HZQA 1EIAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X82 A;  4COP A;  2PXR C;  2LF4 A;  2M8P A;  1GWP A;  3NTE A;  3LRY A;  3G26 A;  3H4E A;  3DS2 A;  5I4T G;  4B4N A;  2X2D D;  2JYL A;  3DTJ A;  5HGL A;  4DGE C;  3H47 A;  3DS0 A;  2KGF A;  2X83 A;  2V4X A;  2M8L A;  2JO0 A;  4U0F A;  5HGK A;  1A43 A;  4E92 A;  4XRQ A;  5DCK A;  4XFY A;  1EOQ A;  4U0D A;  3VRL C;  2XGY A;  2JPR A;  4XRO A;  2XDE A;  3DS5 A;  3G1G A;  3G28 A;  4PH2 A;  2XV6 A;  3P05 A;  4PH0 A;  4U0C A;  3DS3 A;  1EM9 A;  1M9D C;  2WLV B;  2XXM A;  1AUM A;  2ONT A;  2WLV A;  1U7K A;  2EIA A;  4U0A A;  1M9Y C;  4IPY A;  2JYG A;  2XGV A;  3G21 A;  1D1D A;  1M9F C;  2KOD A;  1M9X C;  3DS4 A;  1P7N A;  5JPA A;  3MGE A;  2XT1 A;  4HTW A;  1G03 A;  4WYM A;  4U0E A;  1BAJ A;  5HGM A;  2GOL B;  4COC A;  4XFX A;  3G0V A;  4LQW C;  4M0I A;  4PH1 A;  4NX4 C;  3DPH A;  1AFV A;  3DS1 A;  2XGU A;  1QRJ A;  2GON A;  2BUO A;  3G29 A;  4J93 A;  1L6N A;  1M9C C;  1E6J P;  4PH3 A;  1A8O A;  1M9E C;  1AK4 C;  4QNB A;  4INB A;  4U0B A;  5HGO A;  4E91 A;  2L6E A;  2M8N A;  4XFZ A;  4DGA C;  3G1I A;  3BP9 A;  2Y4Z A;  2PWO A;  2PWM A;  5HGN A;  1EIA A; 
#chains in the Genus database with same CATH topology
 2XZ1 C;  1S72 P;  3EJB A;  4COP A;  2M8P A;  1KD1 Q;  2CNR A;  3CPW O;  1AYI A;  1IMQ A;  1W2B O;  3DS2 A;  2JYL A;  2KGC A;  3M1M A;  3CCR P;  5HGL A;  3H47 A;  4CA3 A;  1M90 Q;  2M8L A;  4BPG A;  3GJN A;  4BPF A;  4XRQ A;  1VQ5 P;  1VHN A;  5HVC A;  2XGY A;  2JPR A;  1Q81 Q;  2K0X A;  4XRO A;  1L0H A;  2PY8 A;  2FVF A;  2KOQ A;  2XDE A;  3CC7 P;  3DS5 A;  4H2Y C;  5F2K A;  2PEM A;  2EG5 A;  3LMO A;  4PH2 A;  2K0Y A;  2VLN A;  1RO2 A;  3RG2 A;  1UNK A;  3DS3 A;  3CXC O;  1M9D C;  2N6Z A;  2XXM A;  5EJD A;  1VQ9 P;  1M9Y C;  4IPY A;  3G21 A;  3WBH A;  3G71 P;  2JB0 A;  2Z45 A;  2KOD A;  2PNG A;  1IUQ A;  2KGA A;  1VQP P;  2LTE A;  2XT1 A;  3CCS P;  2KG6 A;  3I56 P;  3CCQ P;  1VQ7 P;  3U43 A;  4MRT C;  1HY8 A;  4GR6 A;  2KG9 A;  4LQW C;  2QA4 P;  1VQN P;  1K30 A;  3I55 P;  2GON A;  3E2D A;  2BUO A;  3HYB A;  3G29 A;  4J93 A;  2PEN A;  3EJE A;  3G6E P;  2FQ0 A;  1N8R Q;  2N5I A;  3B5I A;  1GXH A;  2GDY A;  1K8A Q;  4E91 A;  5KP6 B;  2M5R A;  2P9X A;  3CCM P;  2MR7 A;  2MF4 A;  1VQM P;  3CME P;  2KWL A;  1YJ9 P;  1YJN P;  1UJZ A;  1EIA A;  2X82 A;  2DNW A;  2AFE A;  4PXH B;  3CC4 P;  2LF4 A;  2GZJ A;  5CZD B;  3NTE A;  2K94 A;  3CD6 P;  2FQ1 A;  2KGF A;  2E1M A;  2EHT A;  5HGK A;  1A43 A;  5KP7 B;  4E92 A;  2CQ8 A;  2GZI A;  2K5X A;  2CGQ A;  1KQS O;  1NQ4 A;  1NJI Q;  2XZ0 D;  2KGD A;  1EOQ A;  4U0D A;  7CEI A;  5EW5 E;  1ACP A;  2MY5 A;  2KGE A;  1YJW P;  1DNY A;  3G28 A;  2L4B A;  5BS1 A;  2AVA A;  1DV5 A;  2XV6 A;  1ZMB A;  1M6N A;  2QEX P;  1VQL P;  2N6Y A;  2WLV B;  1AUM A;  2QNW A;  2ONT A;  2WLV A;  3GZL A;  1U7K A;  2ROQ A;  1AF8 A;  4U0A A;  2L9F A;  2N5H A;  2Z44 A;  2JYG A;  1D1D A;  1T8K A;  2WPT A;  4H2X C;  5F2O A;  1GXG A;  1P7N A;  1JJ2 O;  2MVU A;  2X2B A;  4WYM A;  1BAJ A;  1OR5 A;  4COC A;  1VQK P;  2JU2 A;  4M0I A;  4QKO A;  2N98 A;  1Z6M A;  2JAZ A;  4IZ6 A;  1E6J P;  4PH3 A;  1A8O A;  2KOR A;  1FR2 A;  1AK4 C;  1Q82 Q;  1YIJ P;  2KOS A;  5HGO A;  1RNI A;  3GZM A;  2FHS C;  3EJD A;  3BP9 A;  2CWO A;  2PWO A;  2FAD A;  4H2W C;  3CCU P;  4GR2 A;  2PEQ A;  2MR8 A;  1Q7Y Q;  2VSQ A;  1F80 D;  3LRY A;  3H4E A;  2N50 A;  5I4T G;  4B4N A;  4DGE C;  2KW2 A;  4NEO A;  2X83 A;  1ZNV A;  2AFD A;  2OAR A;  2FAC A;  2JO0 A;  2LL8 A;  1QVF O;  5HV8 A;  2KOP A;  2LKI A;  2FVE A;  1KC8 Q;  2LIU A;  2K92 A;  2K2Q A;  5DCK A;  5KP8 B;  3VRL C;  1YI2 P;  3NY7 B;  2BHV A;  1X3O A;  1RO0 A;  1BXI A;  4PWV B;  3P05 A;  4PH0 A;  4U0C A;  1EM9 A;  2LIW A;  1M6E X;  4BPH A;  2CG5 B;  2EIA A;  2GZE A;  2XGV A;  4F37 A;  1CEI A;  1M9F C;  1M9X C;  3DS4 A;  5JPA A;  4HTW A;  1G03 A;  2L22 A;  2JQ4 A;  3H0D A;  2VLP A;  4DG9 A;  3DPH A;  2MD9 A;  2XGU A;  2Z46 A;  1M1K Q;  2GDX A;  3CC2 P;  2VLQ A;  3CMA P;  2NO8 A;  4QNB A;  4INB A;  1EMV A;  2GZF A;  1VQ6 P;  1VKU A;  2L6E A;  1Q86 Q;  4DGA C;  3G1I A;  2PEJ A;  1VQ8 P;  1YHQ P;  1M74 A;  2FVA A;  5HGN A;  3HZQ A;  1K9M Q;  2KR5 A;  2PXR C;  1GWP A;  1GPJ A;  3G26 A;  2X2D D;  1HQB A;  3DTJ A;  3GKL C;  1YIT P;  2DGY A;  3DS0 A;  2V4X A;  4U0F A;  2VLO A;  3B4Q A;  2FAE A;  2LOL A;  3RG6 C;  4XFY A;  2OTJ P;  2PEO A;  2K93 A;  3G1G A;  2GYK A;  2PEI A;  2JBG A;  1IMP A;  1VQO P;  2GZG A;  2MVV A;  2L0Q A;  5BS2 A;  2GDW A;  2OTL P;  1VQ4 P;  2K0D X;  3CE7 A;  4R0M A;  3MGE A;  4HKG A;  4U0E A;  3G4S P;  5HGM A;  2LML A;  2GOL B;  3Q20 A;  1QVG O;  4XFX A;  1E0H A;  3G0V A;  4PH1 A;  2LPK A;  4NX4 C;  2KOO A;  1AFV A;  3DS1 A;  1QRJ A;  1K73 Q;  1L0I A;  2FQ2 A;  2KG8 A;  5F2N A;  1L6N A;  1M9C C;  2JU1 A;  2EFJ A;  3CCE P;  1M9E C;  2JGP A;  4UHP B;  2PEK A;  3CCV P;  4U0B A;  3OW2 O;  2ERH A;  2EHS A;  3CCJ P;  3CCL P;  2AF8 A;  1MZ8 A;  2M8N A;  4XFZ A;  2Y4Z A;  1KLP A;  2PWM A; 
#chains in the Genus database with same CATH homology
 2X82 A;  2PEQ A;  1S72 P;  1K9M Q;  1Q7Y Q;  3CC4 P;  4COP A;  2PXR C;  2LF4 A;  2M8P A;  1GWP A;  1KD1 Q;  3NTE A;  3CPW O;  3LRY A;  1W2B O;  4GR2 A;  3G26 A;  3H4E A;  3DS2 A;  3CD6 P;  5I4T G;  4B4N A;  2X2D D;  2JYL A;  3DTJ A;  3M1M A;  3CCR P;  5HGL A;  4DGE C;  1YIT P;  3H47 A;  2DGY A;  1M90 Q;  3DS0 A;  2KGF A;  2X83 A;  2E1M A;  2OAR A;  2V4X A;  2M8L A;  2JO0 A;  4U0F A;  5HGK A;  1QVF O;  1A43 A;  4E92 A;  1KQS O;  4XRQ A;  1VQ5 P;  1KC8 Q;  1NJI Q;  5DCK A;  3RG6 C;  4XFY A;  1EOQ A;  4U0D A;  3VRL C;  2OTJ P;  2XGY A;  2JPR A;  1Q81 Q;  1YI2 P;  4XRO A;  2PY8 A;  2BHV A;  1YJW P;  2XDE A;  3CC7 P;  1RO0 A;  3DS5 A;  2PEM A;  2PEO A;  3G1G A;  3G28 A;  5F2K A;  2EG5 A;  5BS1 A;  4PH2 A;  2PEI A;  2XV6 A;  1ZMB A;  1M6N A;  3P05 A;  2QEX P;  4PH0 A;  1RO2 A;  4U0C A;  1VQL P;  3DS3 A;  3CXC O;  1EM9 A;  1M9D C;  2WLV B;  1VQO P;  1M6E X;  2XXM A;  1AUM A;  2ONT A;  2WLV A;  1U7K A;  5BS2 A;  2OTL P;  2EIA A;  4U0A A;  1VQ9 P;  1M9Y C;  1VQ4 P;  2Z44 A;  2JYG A;  2XGV A;  3G21 A;  4IPY A;  3WBH A;  1D1D A;  3G71 P;  2Z45 A;  1M9F C;  2KOD A;  1IUQ A;  1VQP P;  1M9X C;  5F2O A;  3DS4 A;  1P7N A;  5JPA A;  3MGE A;  2XT1 A;  3CCS P;  4HTW A;  1G03 A;  1JJ2 O;  3I56 P;  4WYM A;  4U0E A;  3H0D A;  3G4S P;  3CCQ P;  1VQ7 P;  1BAJ A;  5HGM A;  2GOL B;  4COC A;  1VQK P;  3Q20 A;  1QVG O;  4GR6 A;  4XFX A;  3G0V A;  4LQW C;  4M0I A;  4PH1 A;  4NX4 C;  3DPH A;  2QA4 P;  1AFV A;  1K30 A;  1VQN P;  3I55 P;  3DS1 A;  2XGU A;  1QRJ A;  2GON A;  2Z46 A;  3E2D A;  1K73 Q;  2BUO A;  1M1K Q;  3HYB A;  3G29 A;  5F2N A;  3CC2 P;  3CMA P;  4J93 A;  1L6N A;  1M9C C;  1E6J P;  4PH3 A;  1A8O A;  2EFJ A;  2PEN A;  1M9E C;  3CCE P;  2PEK A;  1AK4 C;  4QNB A;  3G6E P;  4INB A;  3CCV P;  1Q82 Q;  4U0B A;  3OW2 O;  1YIJ P;  1N8R Q;  3CCJ P;  3B5I A;  5HGO A;  1K8A Q;  1RNI A;  4E91 A;  3CCL P;  1VQ6 P;  2L6E A;  2M8N A;  4XFZ A;  2P9X A;  1Q86 Q;  4DGA C;  3G1I A;  2PEJ A;  1VQ8 P;  3CCM P;  3BP9 A;  2Y4Z A;  2CWO A;  1VQM P;  2PWO A;  3CME P;  1YHQ P;  1YJ9 P;  1M74 A;  2PWM A;  3CCU P;  1YJN P;  5HGN A;  3HZQ A;  1EIA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...