2XGYA

Complex of rabbit endogenous lentivirus (relik)capsid with cyclophilin a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
129
Chain Sequence
PIMEYEPVGPGLIAAWLKQVQEHGLTHPATITYFGVISINFTSVDINMLLNVTPGAEKQLVIDKIKEKAIAWDEMHPPPPADAAGPVPLTSDQIRGIGLSPEEAAGPRFADARTLYRTWVLEALQECQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RELIK CAPSID N-TERMINAL DOMAIN
publication title Structural and Functional Analysis of Prehistoric Lentiviruses Uncovers an Ancient Molecular Interface.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Viral protein/isomerase
total genus 49
structure length 129
sequence length 137
ec nomenclature
pdb deposition date 2010-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2xgyA00
2WLVB 2XGYA 4B4NA 4QNBA 4J93A 4WYMA 1E6JP 2X82A 3BP9A 3NTEA 2JPRA 1G03A 1EIAA 1U7KA 3H47A 4U0AA 4DGEC 1AK4C 4XFZA 4PH2A 2KGFA 2M8NA 4DGAC 2LF4A 4PH0A 5HGKA 5HGOA 4E91A 2XDEA 4U0EA 4PH3A 5JPAA 4E92A 4LQWC 4XRQA 5HGMA 4U0BA 2V4XA 2PXRC 4XFYA 2XGUA 3H4EA 4U0DA 4U0CA 4U0FA 4INBA 5HGNA 1M9DC 5HGLA 1D1DA 4XROA 1M9CC 2PWOA 4HTWA 1P7NA 1M9XC 2X83A 2XGVA 2Y4ZA 3MGEA 2X2DD 2M8PA 2WLVA 2M8LA 1M9YC 1M9EC 1L6NA 2EIAA 1AFVA 1QRJA 4NX4C 2PWMA 2GONA 2GOLB 1EM9A 3P05A 1GWPA 1M9FC 4XFXA
chains in the Genus database with same CATH superfamily
2WLVB 2XGYA 4B4NA 4QNBA 4J93A 4WYMA 1E6JP 2X82A 3BP9A 3NTEA 2JPRA 1G03A 1EIAA 1U7KA 3H47A 4U0AA 4DGEC 1AK4C 4XFZA 4PH2A 2KGFA 2M8NA 4DGAC 2LF4A 4PH0A 5HGKA 5HGOA 4E91A 2XDEA 4U0EA 4PH3A 5JPAA 4E92A 4LQWC 4XRQA 5HGMA 4U0BA 2V4XA 2PXRC 4XFYA 2XGUA 3H4EA 4U0DA 4U0CA 4U0FA 4INBA 5HGNA 1M9DC 5HGLA 1D1DA 4XROA 1M9CC 2PWOA 4HTWA 1P7NA 1M9XC 2X83A 2XGVA 2Y4ZA 3MGEA 2X2DD 2M8PA 2WLVA 2M8LA 1M9YC 1M9EC 1L6NA 2EIAA 1AFVA 1QRJA 4NX4C 2PWMA 2GONA 2GOLB 1EM9A 3P05A 1GWPA 1M9FC 4XFXA
chains in the Genus database with same CATH topology
2WLVB 2XGYA 4B4NA 4QNBA 4J93A 4WYMA 1E6JP 2X82A 3BP9A 3NTEA 2JPRA 1G03A 1EIAA 1U7KA 3H47A 4U0AA 4DGEC 1AK4C 4XFZA 4PH2A 2KGFA 2M8NA 4DGAC 2LF4A 4PH0A 5HGKA 5HGOA 4E91A 2XDEA 4U0EA 4PH3A 5JPAA 4E92A 4LQWC 4XRQA 5HGMA 4U0BA 2V4XA 2PXRC 4XFYA 2XGUA 3H4EA 4U0DA 4U0CA 4U0FA 4INBA 5HGNA 1M9DC 5HGLA 1D1DA 4XROA 1M9CC 2PWOA 4HTWA 1P7NA 1M9XC 2X83A 2XGVA 2Y4ZA 3MGEA 2X2DD 2M8PA 2WLVA 2M8LA 1M9YC 1M9EC 1L6NA 2EIAA 1AFVA 1QRJA 4NX4C 2PWMA 2GONA 2GOLB 1EM9A 3P05A 1GWPA 1M9FC 4XFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WLV B;  2XGY A;  4B4N A;  4QNB A;  4J93 A;  4WYM A;  1E6J P;  2X82 A;  3BP9 A;  3NTE A;  2JPR A;  1G03 A;  1EIA A;  1U7K A;  3H47 A;  4U0A A;  4DGE C;  1AK4 C;  4XFZ A;  4PH2 A;  2KGF A;  2M8N A;  4DGA C;  2LF4 A;  4PH0 A;  5HGK A;  5HGO A;  4E91 A;  2XDE A;  4U0E A;  4PH3 A;  5JPA A;  4E92 A;  4LQW C;  4XRQ A;  5HGM A;  4U0B A;  2V4X A;  2PXR C;  4XFY A;  2XGU A;  3H4E A;  4U0D A;  4U0C A;  4U0F A;  4INB A;  5HGN A;  1M9D C;  5HGL A;  1D1D A;  4XRO A;  1M9C C;  2PWO A;  4HTW A;  1P7N A;  1M9X C;  2X83 A;  2XGV A;  2Y4Z A;  3MGE A;  2X2D D;  2M8P A;  2WLV A;  2M8L A;  1M9Y C;  1M9E C;  1L6N A;  2EIA A;  1AFV A;  1QRJ A;  4NX4 C;  2PWM A;  2GON A;  2GOL B;  1EM9 A;  3P05 A;  1GWP A;  1M9F C;  4XFX A; 
#chains in the Genus database with same CATH topology
 2WLV B;  2XGY A;  4B4N A;  4QNB A;  4J93 A;  4WYM A;  1E6J P;  2X82 A;  3BP9 A;  3NTE A;  2JPR A;  1G03 A;  1EIA A;  1U7K A;  3H47 A;  4U0A A;  4DGE C;  1AK4 C;  4XFZ A;  4PH2 A;  2KGF A;  2M8N A;  4DGA C;  2LF4 A;  4PH0 A;  5HGK A;  5HGO A;  4E91 A;  2XDE A;  4U0E A;  4PH3 A;  5JPA A;  4E92 A;  4LQW C;  4XRQ A;  5HGM A;  4U0B A;  2V4X A;  2PXR C;  4XFY A;  2XGU A;  3H4E A;  4U0D A;  4U0C A;  4U0F A;  4INB A;  5HGN A;  1M9D C;  5HGL A;  1D1D A;  4XRO A;  1M9C C;  2PWO A;  4HTW A;  1P7N A;  1M9X C;  2X83 A;  2XGV A;  2Y4Z A;  3MGE A;  2X2D D;  2M8P A;  2WLV A;  2M8L A;  1M9Y C;  1M9E C;  1L6N A;  2EIA A;  1AFV A;  1QRJ A;  4NX4 C;  2PWM A;  2GON A;  2GOL B;  1EM9 A;  3P05 A;  1GWP A;  1M9F C;  4XFX A; 
#chains in the Genus database with same CATH homology
 2WLV B;  2XGY A;  4B4N A;  4QNB A;  4J93 A;  4WYM A;  1E6J P;  2X82 A;  3BP9 A;  3NTE A;  2JPR A;  1G03 A;  1EIA A;  1U7K A;  3H47 A;  4U0A A;  4DGE C;  1AK4 C;  4XFZ A;  4PH2 A;  2KGF A;  2M8N A;  4DGA C;  2LF4 A;  4PH0 A;  5HGK A;  5HGO A;  4E91 A;  2XDE A;  4U0E A;  4PH3 A;  5JPA A;  4E92 A;  4LQW C;  4XRQ A;  5HGM A;  4U0B A;  2V4X A;  2PXR C;  4XFY A;  2XGU A;  3H4E A;  4U0D A;  4U0C A;  4U0F A;  4INB A;  5HGN A;  1M9D C;  5HGL A;  1D1D A;  4XRO A;  1M9C C;  2PWO A;  4HTW A;  1P7N A;  1M9X C;  2X83 A;  2XGV A;  2Y4Z A;  3MGE A;  2X2D D;  2M8P A;  2WLV A;  2M8L A;  1M9Y C;  1M9E C;  1L6N A;  2EIA A;  1AFV A;  1QRJ A;  4NX4 C;  2PWM A;  2GON A;  2GOL B;  1EM9 A;  3P05 A;  1GWP A;  1M9F C;  4XFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...