2XGYA

Complex of rabbit endogenous lentivirus (relik)capsid with cyclophilin a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
129
Chain Sequence
b'PIMEYEPVGPGLIAAWLKQVQEHGLTHPATITYFGVISINFTSVDINMLLNVTPGAEKQLVIDKIKEKAIAWDEMHPPPPADAAGPVPLTSDQIRGIGLSPEEAAGPRFADARTLYRTWVLEALQECQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RELIK CAPSID N-TERMINAL DOMAIN
publication title Structural and Functional Analysis of Prehistoric Lentiviruses Uncovers an Ancient Molecular Interface.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Viral protein/isomerase
total genus 49
structure length 129
sequence length 137
ec nomenclature
pdb deposition date 2010-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2xgyA00
2XGUA 2M8PA 4HTWA 3MGEA 1GWPA 4B4NA 4XFZA 4NX4C 5HGMA 2KGFA 1QRJA 2WLVB 3BP9A 1M9DC 4PH2A 5JPAA 1M9EC 4DGAC 4U0DA 2GOLB 4XFXA 2PXRC 2EIAA 1L6NA 1E6JP 2XDEA 4PH3A 2JPRA 4XROA 4XFYA 3H4EA 2X82A 3P05A 1M9CC 1AFVA 1EM9A 2PWOA 4DGEC 2V4XA 4LQWC 2WLVA 5HGKA 1M9FC 4INBA 2M8NA 4U0FA 2XGYA 4E91A 1G03A 2PWMA 4WYMA 2LF4A 1M9XC 2X83A 4XRQA 4U0EA 5HGLA 4PH0A 2Y4ZA 1U7KA 4U0AA 2GONA 5HGNA 1M9YC 5HGOA 2X2DD 3NTEA 4E92A 4U0BA 1P7NA 2M8LA 1EIAA 4U0CA 3H47A 4QNBA 1D1DA 4J93A 2XGVA 1AK4C
chains in the Genus database with same CATH superfamily
2XGUA 2M8PA 4HTWA 3MGEA 1GWPA 4B4NA 4XFZA 4NX4C 5HGMA 2KGFA 1QRJA 2WLVB 3BP9A 1M9DC 4PH2A 5JPAA 1M9EC 4DGAC 4U0DA 2GOLB 4XFXA 2PXRC 2EIAA 1L6NA 1E6JP 2XDEA 4PH3A 2JPRA 4XROA 4XFYA 3H4EA 2X82A 3P05A 1M9CC 1AFVA 1EM9A 2PWOA 4DGEC 2V4XA 4LQWC 2WLVA 5HGKA 1M9FC 4INBA 2M8NA 4U0FA 2XGYA 4E91A 1G03A 2PWMA 4WYMA 2LF4A 1M9XC 2X83A 4XRQA 4U0EA 5HGLA 4PH0A 2Y4ZA 1U7KA 4U0AA 2GONA 5HGNA 1M9YC 5HGOA 2X2DD 3NTEA 4E92A 4U0BA 1P7NA 2M8LA 1EIAA 4U0CA 3H47A 4QNBA 1D1DA 4J93A 2XGVA 1AK4C
chains in the Genus database with same CATH topology
2XGUA 2M8PA 4HTWA 3MGEA 1GWPA 4B4NA 4XFZA 4NX4C 5HGMA 2KGFA 1QRJA 2WLVB 3BP9A 1M9DC 4PH2A 5JPAA 1M9EC 4DGAC 4U0DA 2GOLB 4XFXA 2PXRC 2EIAA 1L6NA 1E6JP 2XDEA 4PH3A 2JPRA 4XROA 4XFYA 3H4EA 2X82A 3P05A 1M9CC 1AFVA 1EM9A 2PWOA 4DGEC 2V4XA 4LQWC 2WLVA 5HGKA 1M9FC 4INBA 2M8NA 4U0FA 2XGYA 4E91A 1G03A 2PWMA 4WYMA 2LF4A 1M9XC 2X83A 4XRQA 4U0EA 5HGLA 4PH0A 2Y4ZA 1U7KA 4U0AA 2GONA 5HGNA 1M9YC 5HGOA 2X2DD 3NTEA 4E92A 4U0BA 1P7NA 2M8LA 1EIAA 4U0CA 3H47A 4QNBA 1D1DA 4J93A 2XGVA 1AK4C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGU A;  2M8P A;  4HTW A;  3MGE A;  1GWP A;  4B4N A;  4XFZ A;  4NX4 C;  5HGM A;  2KGF A;  1QRJ A;  2WLV B;  3BP9 A;  1M9D C;  4PH2 A;  5JPA A;  1M9E C;  4DGA C;  4U0D A;  2GOL B;  4XFX A;  2PXR C;  2EIA A;  1L6N A;  1E6J P;  2XDE A;  4PH3 A;  2JPR A;  4XRO A;  4XFY A;  3H4E A;  2X82 A;  3P05 A;  1M9C C;  1AFV A;  1EM9 A;  2PWO A;  4DGE C;  2V4X A;  4LQW C;  2WLV A;  5HGK A;  1M9F C;  4INB A;  2M8N A;  4U0F A;  2XGY A;  4E91 A;  1G03 A;  2PWM A;  4WYM A;  2LF4 A;  1M9X C;  2X83 A;  4XRQ A;  4U0E A;  5HGL A;  4PH0 A;  2Y4Z A;  1U7K A;  4U0A A;  2GON A;  5HGN A;  1M9Y C;  5HGO A;  2X2D D;  3NTE A;  4E92 A;  4U0B A;  1P7N A;  2M8L A;  1EIA A;  4U0C A;  3H47 A;  4QNB A;  1D1D A;  4J93 A;  2XGV A;  1AK4 C; 
#chains in the Genus database with same CATH topology
 2XGU A;  2M8P A;  4HTW A;  3MGE A;  1GWP A;  4B4N A;  4XFZ A;  4NX4 C;  5HGM A;  2KGF A;  1QRJ A;  2WLV B;  3BP9 A;  1M9D C;  4PH2 A;  5JPA A;  1M9E C;  4DGA C;  4U0D A;  2GOL B;  4XFX A;  2PXR C;  2EIA A;  1L6N A;  1E6J P;  2XDE A;  4PH3 A;  2JPR A;  4XRO A;  4XFY A;  3H4E A;  2X82 A;  3P05 A;  1M9C C;  1AFV A;  1EM9 A;  2PWO A;  4DGE C;  2V4X A;  4LQW C;  2WLV A;  5HGK A;  1M9F C;  4INB A;  2M8N A;  4U0F A;  2XGY A;  4E91 A;  1G03 A;  2PWM A;  4WYM A;  2LF4 A;  1M9X C;  2X83 A;  4XRQ A;  4U0E A;  5HGL A;  4PH0 A;  2Y4Z A;  1U7K A;  4U0A A;  2GON A;  5HGN A;  1M9Y C;  5HGO A;  2X2D D;  3NTE A;  4E92 A;  4U0B A;  1P7N A;  2M8L A;  1EIA A;  4U0C A;  3H47 A;  4QNB A;  1D1D A;  4J93 A;  2XGV A;  1AK4 C; 
#chains in the Genus database with same CATH homology
 2XGU A;  2M8P A;  4HTW A;  3MGE A;  1GWP A;  4B4N A;  4XFZ A;  4NX4 C;  5HGM A;  2KGF A;  1QRJ A;  2WLV B;  3BP9 A;  1M9D C;  4PH2 A;  5JPA A;  1M9E C;  4DGA C;  4U0D A;  2GOL B;  4XFX A;  2PXR C;  2EIA A;  1L6N A;  1E6J P;  2XDE A;  4PH3 A;  2JPR A;  4XRO A;  4XFY A;  3H4E A;  2X82 A;  3P05 A;  1M9C C;  1AFV A;  1EM9 A;  2PWO A;  4DGE C;  2V4X A;  4LQW C;  2WLV A;  5HGK A;  1M9F C;  4INB A;  2M8N A;  4U0F A;  2XGY A;  4E91 A;  1G03 A;  2PWM A;  4WYM A;  2LF4 A;  1M9X C;  2X83 A;  4XRQ A;  4U0E A;  5HGL A;  4PH0 A;  2Y4Z A;  1U7K A;  4U0A A;  2GON A;  5HGN A;  1M9Y C;  5HGO A;  2X2D D;  3NTE A;  4E92 A;  4U0B A;  1P7N A;  2M8L A;  1EIA A;  4U0C A;  3H47 A;  4QNB A;  1D1D A;  4J93 A;  2XGV A;  1AK4 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...