2XGYA

Complex of rabbit endogenous lentivirus (relik)capsid with cyclophilin a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
129
Chain Sequence
PIMEYEPVGPGLIAAWLKQVQEHGLTHPATITYFGVISINFTSVDINMLLNVTPGAEKQLVIDKIKEKAIAWDEMHPPPPADAAGPVPLTSDQIRGIGLSPEEAAGPRFADARTLYRTWVLEALQECQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/isomerase
molecule keywords RELIK CAPSID N-TERMINAL DOMAIN
publication title Structural and Functional Analysis of Prehistoric Lentiviruses Uncovers an Ancient Molecular Interface.
pubmed doi rcsb
source organism Oryctolagus cuniculus
total genus 49
structure length 129
sequence length 137
ec nomenclature
pdb deposition date 2010-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2xgyA00
1E6JP 2PXRC 1D1DA 2XGUA 2JPRA 4PH0A 2KGFA 4DGEC 1M9EC 5HGKA 4PH3A 3NTEA 4INBA 2X82A 4XFZA 4U0EA 4XROA 5HGOA 1L6NA 2XDEA 4U0CA 5HGLA 3H47A 3BP9A 1AFVA 4NX4C 2M8PA 1GWPA 4XFYA 4XFXA 5HGMA 2LF4A 4WYMA 1QRJA 2X83A 1P7NA 1M9CC 1U7KA 2WLVA 3H4EA 2GOLB 1EIAA 2X2DD 4B4NA 1EM9A 2Y4ZA 2WLVB 2PWOA 1M9FC 4HTWA 2PWMA 4E91A 4LQWC 1AK4C 1G03A 5HGNA 4U0AA 1M9YC 2M8LA 2EIAA 2XGVA 4PH2A 4XRQA 4U0DA 3P05A 4QNBA 5JPAA 4DGAC 4U0BA 2XGYA 3MGEA 2M8NA 2V4XA 4E92A 1M9DC 1M9XC 4U0FA 4J93A 2GONA
chains in the Genus database with same CATH superfamily
1E6JP 2PXRC 1D1DA 2XGUA 2JPRA 4PH0A 2KGFA 4DGEC 1M9EC 5HGKA 4PH3A 3NTEA 4INBA 2X82A 4XFZA 4U0EA 4XROA 5HGOA 1L6NA 2XDEA 4U0CA 5HGLA 3H47A 3BP9A 1AFVA 4NX4C 2M8PA 1GWPA 4XFYA 4XFXA 5HGMA 2LF4A 4WYMA 1QRJA 2X83A 1P7NA 1M9CC 1U7KA 2WLVA 3H4EA 2GOLB 1EIAA 2X2DD 4B4NA 1EM9A 2Y4ZA 2WLVB 2PWOA 1M9FC 4HTWA 2PWMA 4E91A 4LQWC 1AK4C 1G03A 5HGNA 4U0AA 1M9YC 2M8LA 2EIAA 2XGVA 4PH2A 4XRQA 4U0DA 3P05A 4QNBA 5JPAA 4DGAC 4U0BA 2XGYA 3MGEA 2M8NA 2V4XA 4E92A 1M9DC 1M9XC 4U0FA 4J93A 2GONA
chains in the Genus database with same CATH topology
1E6JP 2PXRC 1D1DA 2XGUA 2JPRA 4PH0A 2KGFA 4DGEC 1M9EC 5HGKA 4PH3A 3NTEA 4INBA 2X82A 4XFZA 4U0EA 4XROA 5HGOA 1L6NA 2XDEA 4U0CA 5HGLA 3H47A 3BP9A 1AFVA 4NX4C 2M8PA 1GWPA 4XFYA 4XFXA 5HGMA 2LF4A 4WYMA 1QRJA 2X83A 1P7NA 1M9CC 1U7KA 2WLVA 3H4EA 2GOLB 1EIAA 2X2DD 4B4NA 1EM9A 2Y4ZA 2WLVB 2PWOA 1M9FC 4HTWA 2PWMA 4E91A 4LQWC 1AK4C 1G03A 5HGNA 4U0AA 1M9YC 2M8LA 2EIAA 2XGVA 4PH2A 4XRQA 4U0DA 3P05A 4QNBA 5JPAA 4DGAC 4U0BA 2XGYA 3MGEA 2M8NA 2V4XA 4E92A 1M9DC 1M9XC 4U0FA 4J93A 2GONA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E6J P;  2PXR C;  1D1D A;  2XGU A;  2JPR A;  4PH0 A;  2KGF A;  4DGE C;  1M9E C;  5HGK A;  4PH3 A;  3NTE A;  4INB A;  2X82 A;  4XFZ A;  4U0E A;  4XRO A;  5HGO A;  1L6N A;  2XDE A;  4U0C A;  5HGL A;  3H47 A;  3BP9 A;  1AFV A;  4NX4 C;  2M8P A;  1GWP A;  4XFY A;  4XFX A;  5HGM A;  2LF4 A;  4WYM A;  1QRJ A;  2X83 A;  1P7N A;  1M9C C;  1U7K A;  2WLV A;  3H4E A;  2GOL B;  1EIA A;  2X2D D;  4B4N A;  1EM9 A;  2Y4Z A;  2WLV B;  2PWO A;  1M9F C;  4HTW A;  2PWM A;  4E91 A;  4LQW C;  1AK4 C;  1G03 A;  5HGN A;  4U0A A;  1M9Y C;  2M8L A;  2EIA A;  2XGV A;  4PH2 A;  4XRQ A;  4U0D A;  3P05 A;  4QNB A;  5JPA A;  4DGA C;  4U0B A;  2XGY A;  3MGE A;  2M8N A;  2V4X A;  4E92 A;  1M9D C;  1M9X C;  4U0F A;  4J93 A;  2GON A; 
#chains in the Genus database with same CATH topology
 1E6J P;  2PXR C;  1D1D A;  2XGU A;  2JPR A;  4PH0 A;  2KGF A;  4DGE C;  1M9E C;  5HGK A;  4PH3 A;  3NTE A;  4INB A;  2X82 A;  4XFZ A;  4U0E A;  4XRO A;  5HGO A;  1L6N A;  2XDE A;  4U0C A;  5HGL A;  3H47 A;  3BP9 A;  1AFV A;  4NX4 C;  2M8P A;  1GWP A;  4XFY A;  4XFX A;  5HGM A;  2LF4 A;  4WYM A;  1QRJ A;  2X83 A;  1P7N A;  1M9C C;  1U7K A;  2WLV A;  3H4E A;  2GOL B;  1EIA A;  2X2D D;  4B4N A;  1EM9 A;  2Y4Z A;  2WLV B;  2PWO A;  1M9F C;  4HTW A;  2PWM A;  4E91 A;  4LQW C;  1AK4 C;  1G03 A;  5HGN A;  4U0A A;  1M9Y C;  2M8L A;  2EIA A;  2XGV A;  4PH2 A;  4XRQ A;  4U0D A;  3P05 A;  4QNB A;  5JPA A;  4DGA C;  4U0B A;  2XGY A;  3MGE A;  2M8N A;  2V4X A;  4E92 A;  1M9D C;  1M9X C;  4U0F A;  4J93 A;  2GON A; 
#chains in the Genus database with same CATH homology
 1E6J P;  2PXR C;  1D1D A;  2XGU A;  2JPR A;  4PH0 A;  2KGF A;  4DGE C;  1M9E C;  5HGK A;  4PH3 A;  3NTE A;  4INB A;  2X82 A;  4XFZ A;  4U0E A;  4XRO A;  5HGO A;  1L6N A;  2XDE A;  4U0C A;  5HGL A;  3H47 A;  3BP9 A;  1AFV A;  4NX4 C;  2M8P A;  1GWP A;  4XFY A;  4XFX A;  5HGM A;  2LF4 A;  4WYM A;  1QRJ A;  2X83 A;  1P7N A;  1M9C C;  1U7K A;  2WLV A;  3H4E A;  2GOL B;  1EIA A;  2X2D D;  4B4N A;  1EM9 A;  2Y4Z A;  2WLV B;  2PWO A;  1M9F C;  4HTW A;  2PWM A;  4E91 A;  4LQW C;  1AK4 C;  1G03 A;  5HGN A;  4U0A A;  1M9Y C;  2M8L A;  2EIA A;  2XGV A;  4PH2 A;  4XRQ A;  4U0D A;  3P05 A;  4QNB A;  5JPA A;  4DGA C;  4U0B A;  2XGY A;  3MGE A;  2M8N A;  2V4X A;  4E92 A;  1M9D C;  1M9X C;  4U0F A;  4J93 A;  2GON A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...