2XGYA

Complex of rabbit endogenous lentivirus (relik)capsid with cyclophilin a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
129
Chain Sequence
PIMEYEPVGPGLIAAWLKQVQEHGLTHPATITYFGVISINFTSVDINMLLNVTPGAEKQLVIDKIKEKAIAWDEMHPPPPADAAGPVPLTSDQIRGIGLSPEEAAGPRFADARTLYRTWVLEALQECQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Analysis of Prehistoric Lentiviruses Uncovers an Ancient Molecular Interface.
pubmed doi rcsb
source organism Oryctolagus cuniculus
molecule tags Viral protein/isomerase
molecule keywords RELIK CAPSID N-TERMINAL DOMAIN
total genus 49
structure length 129
sequence length 137
ec nomenclature
pdb deposition date 2010-06-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2xgyA00
3P05A 2PWOA 2XGVA 2KGFA 4DGEC 4XFXA 3MGEA 1U7KA 1E6JP 1M9DC 1QRJA 2WLVA 1AK4C 4DGAC 1G03A 4INBA 3NTEA 4XFYA 2M8LA 4E91A 4XRQA 4B4NA 2XGYA 1P7NA 4NX4C 4HTWA 2EIAA 4QNBA 4XFZA 4XROA 1AFVA 2X82A 4LQWC 1EIAA 4U0AA 5HGOA 1M9FC 5JPAA 4U0EA 4PH2A 2GONA 5HGNA 2LF4A 4U0DA 2PWMA 4WYMA 4U0BA 1M9CC 5HGLA 1EM9A 2XDEA 2V4XA 1D1DA 4PH3A 2X83A 4U0FA 2JPRA 2M8NA 3H47A 2GOLB 2M8PA 2Y4ZA 3BP9A 4PH0A 1M9YC 1M9EC 1M9XC 2X2DD 5HGKA 1L6NA 4E92A 2WLVB 2PXRC 2XGUA 4J93A 4U0CA 5HGMA 3H4EA 1GWPA
chains in the Genus database with same CATH superfamily
3P05A 2PWOA 2XGVA 2KGFA 4DGEC 4XFXA 3MGEA 1U7KA 1E6JP 1M9DC 1QRJA 2WLVA 1AK4C 4DGAC 1G03A 4INBA 3NTEA 4XFYA 2M8LA 4E91A 4XRQA 4B4NA 2XGYA 1P7NA 4NX4C 4HTWA 2EIAA 4QNBA 4XFZA 4XROA 1AFVA 2X82A 4LQWC 1EIAA 4U0AA 5HGOA 1M9FC 5JPAA 4U0EA 4PH2A 2GONA 5HGNA 2LF4A 4U0DA 2PWMA 4WYMA 4U0BA 1M9CC 5HGLA 1EM9A 2XDEA 2V4XA 1D1DA 4PH3A 2X83A 4U0FA 2JPRA 2M8NA 3H47A 2GOLB 2M8PA 2Y4ZA 3BP9A 4PH0A 1M9YC 1M9EC 1M9XC 2X2DD 5HGKA 1L6NA 4E92A 2WLVB 2PXRC 2XGUA 4J93A 4U0CA 5HGMA 3H4EA 1GWPA
chains in the Genus database with same CATH topology
3P05A 2PWOA 2XGVA 2KGFA 4DGEC 4XFXA 3MGEA 1U7KA 1E6JP 1M9DC 1QRJA 2WLVA 1AK4C 4DGAC 1G03A 4INBA 3NTEA 4XFYA 2M8LA 4E91A 4XRQA 4B4NA 2XGYA 1P7NA 4NX4C 4HTWA 2EIAA 4QNBA 4XFZA 4XROA 1AFVA 2X82A 4LQWC 1EIAA 4U0AA 5HGOA 1M9FC 5JPAA 4U0EA 4PH2A 2GONA 5HGNA 2LF4A 4U0DA 2PWMA 4WYMA 4U0BA 1M9CC 5HGLA 1EM9A 2XDEA 2V4XA 1D1DA 4PH3A 2X83A 4U0FA 2JPRA 2M8NA 3H47A 2GOLB 2M8PA 2Y4ZA 3BP9A 4PH0A 1M9YC 1M9EC 1M9XC 2X2DD 5HGKA 1L6NA 4E92A 2WLVB 2PXRC 2XGUA 4J93A 4U0CA 5HGMA 3H4EA 1GWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P05 A;  2PWO A;  2XGV A;  2KGF A;  4DGE C;  4XFX A;  3MGE A;  1U7K A;  1E6J P;  1M9D C;  1QRJ A;  2WLV A;  1AK4 C;  4DGA C;  1G03 A;  4INB A;  3NTE A;  4XFY A;  2M8L A;  4E91 A;  4XRQ A;  4B4N A;  2XGY A;  1P7N A;  4NX4 C;  4HTW A;  2EIA A;  4QNB A;  4XFZ A;  4XRO A;  1AFV A;  2X82 A;  4LQW C;  1EIA A;  4U0A A;  5HGO A;  1M9F C;  5JPA A;  4U0E A;  4PH2 A;  2GON A;  5HGN A;  2LF4 A;  4U0D A;  2PWM A;  4WYM A;  4U0B A;  1M9C C;  5HGL A;  1EM9 A;  2XDE A;  2V4X A;  1D1D A;  4PH3 A;  2X83 A;  4U0F A;  2JPR A;  2M8N A;  3H47 A;  2GOL B;  2M8P A;  2Y4Z A;  3BP9 A;  4PH0 A;  1M9Y C;  1M9E C;  1M9X C;  2X2D D;  5HGK A;  1L6N A;  4E92 A;  2WLV B;  2PXR C;  2XGU A;  4J93 A;  4U0C A;  5HGM A;  3H4E A;  1GWP A; 
#chains in the Genus database with same CATH topology
 3P05 A;  2PWO A;  2XGV A;  2KGF A;  4DGE C;  4XFX A;  3MGE A;  1U7K A;  1E6J P;  1M9D C;  1QRJ A;  2WLV A;  1AK4 C;  4DGA C;  1G03 A;  4INB A;  3NTE A;  4XFY A;  2M8L A;  4E91 A;  4XRQ A;  4B4N A;  2XGY A;  1P7N A;  4NX4 C;  4HTW A;  2EIA A;  4QNB A;  4XFZ A;  4XRO A;  1AFV A;  2X82 A;  4LQW C;  1EIA A;  4U0A A;  5HGO A;  1M9F C;  5JPA A;  4U0E A;  4PH2 A;  2GON A;  5HGN A;  2LF4 A;  4U0D A;  2PWM A;  4WYM A;  4U0B A;  1M9C C;  5HGL A;  1EM9 A;  2XDE A;  2V4X A;  1D1D A;  4PH3 A;  2X83 A;  4U0F A;  2JPR A;  2M8N A;  3H47 A;  2GOL B;  2M8P A;  2Y4Z A;  3BP9 A;  4PH0 A;  1M9Y C;  1M9E C;  1M9X C;  2X2D D;  5HGK A;  1L6N A;  4E92 A;  2WLV B;  2PXR C;  2XGU A;  4J93 A;  4U0C A;  5HGM A;  3H4E A;  1GWP A; 
#chains in the Genus database with same CATH homology
 3P05 A;  2PWO A;  2XGV A;  2KGF A;  4DGE C;  4XFX A;  3MGE A;  1U7K A;  1E6J P;  1M9D C;  1QRJ A;  2WLV A;  1AK4 C;  4DGA C;  1G03 A;  4INB A;  3NTE A;  4XFY A;  2M8L A;  4E91 A;  4XRQ A;  4B4N A;  2XGY A;  1P7N A;  4NX4 C;  4HTW A;  2EIA A;  4QNB A;  4XFZ A;  4XRO A;  1AFV A;  2X82 A;  4LQW C;  1EIA A;  4U0A A;  5HGO A;  1M9F C;  5JPA A;  4U0E A;  4PH2 A;  2GON A;  5HGN A;  2LF4 A;  4U0D A;  2PWM A;  4WYM A;  4U0B A;  1M9C C;  5HGL A;  1EM9 A;  2XDE A;  2V4X A;  1D1D A;  4PH3 A;  2X83 A;  4U0F A;  2JPR A;  2M8N A;  3H47 A;  2GOL B;  2M8P A;  2Y4Z A;  3BP9 A;  4PH0 A;  1M9Y C;  1M9E C;  1M9X C;  2X2D D;  5HGK A;  1L6N A;  4E92 A;  2WLV B;  2PXR C;  2XGU A;  4J93 A;  4U0C A;  5HGM A;  3H4E A;  1GWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...