2PWMA

Crystal structure of hiv-1 ca146 a92e real cell
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
145
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIEPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Structure of the Antiviral Assembly Inhibitor CAP-1 Complex with the HIV-1 CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 48
structure length 145
sequence length 145
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2pwmA00
2GONA 5HGLA 2X83A 2LF4A 1M9DC 2M8NA 2M8PA 3MGEA 1P7NA 4WYMA 4PH0A 2PWOA 1QRJA 4DGEC 3H4EA 4U0AA 1D1DA 1AK4C 1EIAA 2WLVA 4U0DA 1GWPA 2JPRA 4U0EA 2M8LA 1M9XC 2PXRC 3NTEA 4XRQA 4B4NA 4XFYA 4INBA 4LQWC 1M9YC 3BP9A 4XFZA 2V4XA 1L6NA 2X82A 5HGNA 2XDEA 2EIAA 4J93A 1M9EC 4XROA 4QNBA 3H47A 4DGAC 5HGOA 2X2DD 1EM9A 2XGYA 4U0CA 5HGMA 1G03A 4PH3A 2XGVA 4U0FA 2XGUA 2WLVB 1E6JP 4E92A 5JPAA 1AFVA 4NX4C 1M9FC 5HGKA 1M9CC 1U7KA 2KGFA 2Y4ZA 4PH2A 4U0BA 2PWMA 2GOLB 4HTWA 4E91A 4XFXA 3P05A
chains in the Genus database with same CATH superfamily
2GONA 5HGLA 2X83A 2LF4A 1M9DC 2M8NA 2M8PA 3MGEA 1P7NA 4WYMA 4PH0A 2PWOA 1QRJA 4DGEC 3H4EA 4U0AA 1D1DA 1AK4C 1EIAA 2WLVA 4U0DA 1GWPA 2JPRA 4U0EA 2M8LA 1M9XC 2PXRC 3NTEA 4XRQA 4B4NA 4XFYA 4INBA 4LQWC 1M9YC 3BP9A 4XFZA 2V4XA 1L6NA 2X82A 5HGNA 2XDEA 2EIAA 4J93A 1M9EC 4XROA 4QNBA 3H47A 4DGAC 5HGOA 2X2DD 1EM9A 2XGYA 4U0CA 5HGMA 1G03A 4PH3A 2XGVA 4U0FA 2XGUA 2WLVB 1E6JP 4E92A 5JPAA 1AFVA 4NX4C 1M9FC 5HGKA 1M9CC 1U7KA 2KGFA 2Y4ZA 4PH2A 4U0BA 2PWMA 2GOLB 4HTWA 4E91A 4XFXA 3P05A
chains in the Genus database with same CATH topology
2GONA 5HGLA 2X83A 2LF4A 1M9DC 2M8NA 2M8PA 3MGEA 1P7NA 4WYMA 4PH0A 2PWOA 1QRJA 4DGEC 3H4EA 4U0AA 1D1DA 1AK4C 1EIAA 2WLVA 4U0DA 1GWPA 2JPRA 4U0EA 2M8LA 1M9XC 2PXRC 3NTEA 4XRQA 4B4NA 4XFYA 4INBA 4LQWC 1M9YC 3BP9A 4XFZA 2V4XA 1L6NA 2X82A 5HGNA 2XDEA 2EIAA 4J93A 1M9EC 4XROA 4QNBA 3H47A 4DGAC 5HGOA 2X2DD 1EM9A 2XGYA 4U0CA 5HGMA 1G03A 4PH3A 2XGVA 4U0FA 2XGUA 2WLVB 1E6JP 4E92A 5JPAA 1AFVA 4NX4C 1M9FC 5HGKA 1M9CC 1U7KA 2KGFA 2Y4ZA 4PH2A 4U0BA 2PWMA 2GOLB 4HTWA 4E91A 4XFXA 3P05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GON A;  5HGL A;  2X83 A;  2LF4 A;  1M9D C;  2M8N A;  2M8P A;  3MGE A;  1P7N A;  4WYM A;  4PH0 A;  2PWO A;  1QRJ A;  4DGE C;  3H4E A;  4U0A A;  1D1D A;  1AK4 C;  1EIA A;  2WLV A;  4U0D A;  1GWP A;  2JPR A;  4U0E A;  2M8L A;  1M9X C;  2PXR C;  3NTE A;  4XRQ A;  4B4N A;  4XFY A;  4INB A;  4LQW C;  1M9Y C;  3BP9 A;  4XFZ A;  2V4X A;  1L6N A;  2X82 A;  5HGN A;  2XDE A;  2EIA A;  4J93 A;  1M9E C;  4XRO A;  4QNB A;  3H47 A;  4DGA C;  5HGO A;  2X2D D;  1EM9 A;  2XGY A;  4U0C A;  5HGM A;  1G03 A;  4PH3 A;  2XGV A;  4U0F A;  2XGU A;  2WLV B;  1E6J P;  4E92 A;  5JPA A;  1AFV A;  4NX4 C;  1M9F C;  5HGK A;  1M9C C;  1U7K A;  2KGF A;  2Y4Z A;  4PH2 A;  4U0B A;  2PWM A;  2GOL B;  4HTW A;  4E91 A;  4XFX A;  3P05 A; 
#chains in the Genus database with same CATH topology
 2GON A;  5HGL A;  2X83 A;  2LF4 A;  1M9D C;  2M8N A;  2M8P A;  3MGE A;  1P7N A;  4WYM A;  4PH0 A;  2PWO A;  1QRJ A;  4DGE C;  3H4E A;  4U0A A;  1D1D A;  1AK4 C;  1EIA A;  2WLV A;  4U0D A;  1GWP A;  2JPR A;  4U0E A;  2M8L A;  1M9X C;  2PXR C;  3NTE A;  4XRQ A;  4B4N A;  4XFY A;  4INB A;  4LQW C;  1M9Y C;  3BP9 A;  4XFZ A;  2V4X A;  1L6N A;  2X82 A;  5HGN A;  2XDE A;  2EIA A;  4J93 A;  1M9E C;  4XRO A;  4QNB A;  3H47 A;  4DGA C;  5HGO A;  2X2D D;  1EM9 A;  2XGY A;  4U0C A;  5HGM A;  1G03 A;  4PH3 A;  2XGV A;  4U0F A;  2XGU A;  2WLV B;  1E6J P;  4E92 A;  5JPA A;  1AFV A;  4NX4 C;  1M9F C;  5HGK A;  1M9C C;  1U7K A;  2KGF A;  2Y4Z A;  4PH2 A;  4U0B A;  2PWM A;  2GOL B;  4HTW A;  4E91 A;  4XFX A;  3P05 A; 
#chains in the Genus database with same CATH homology
 2GON A;  5HGL A;  2X83 A;  2LF4 A;  1M9D C;  2M8N A;  2M8P A;  3MGE A;  1P7N A;  4WYM A;  4PH0 A;  2PWO A;  1QRJ A;  4DGE C;  3H4E A;  4U0A A;  1D1D A;  1AK4 C;  1EIA A;  2WLV A;  4U0D A;  1GWP A;  2JPR A;  4U0E A;  2M8L A;  1M9X C;  2PXR C;  3NTE A;  4XRQ A;  4B4N A;  4XFY A;  4INB A;  4LQW C;  1M9Y C;  3BP9 A;  4XFZ A;  2V4X A;  1L6N A;  2X82 A;  5HGN A;  2XDE A;  2EIA A;  4J93 A;  1M9E C;  4XRO A;  4QNB A;  3H47 A;  4DGA C;  5HGO A;  2X2D D;  1EM9 A;  2XGY A;  4U0C A;  5HGM A;  1G03 A;  4PH3 A;  2XGV A;  4U0F A;  2XGU A;  2WLV B;  1E6J P;  4E92 A;  5JPA A;  1AFV A;  4NX4 C;  1M9F C;  5HGK A;  1M9C C;  1U7K A;  2KGF A;  2Y4Z A;  4PH2 A;  4U0B A;  2PWM A;  2GOL B;  4HTW A;  4E91 A;  4XFX A;  3P05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...