2PWMA

Crystal structure of hiv-1 ca146 a92e real cell
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
145
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIEPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag-Pol polyprotein
publication title Structure of the Antiviral Assembly Inhibitor CAP-1 Complex with the HIV-1 CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 48
structure length 145
sequence length 145
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2pwmA00
2X2DD 4U0EA 2M8LA 4QNBA 4XFYA 2PWMA 1U7KA 4XFZA 1EIAA 1G03A 1M9CC 5HGLA 1L6NA 2V4XA 1EM9A 2X83A 2JPRA 1M9XC 1E6JP 1M9DC 4XRQA 2PXRC 3MGEA 2EIAA 4J93A 2Y4ZA 2WLVB 4PH0A 2M8NA 4U0AA 4DGAC 1M9EC 4HTWA 4XFXA 2GOLB 3H4EA 2PWOA 2XDEA 1AK4C 2LF4A 1GWPA 5HGKA 4XROA 2GONA 1QRJA 3NTEA 1M9YC 3H47A 4NX4C 2XGVA 4E92A 5HGNA 2M8PA 2XGYA 3P05A 4LQWC 1M9FC 5HGMA 4U0BA 2XGUA 1AFVA 4PH2A 4INBA 5JPAA 2KGFA 1P7NA 4PH3A 4U0DA 3BP9A 4U0CA 5HGOA 2X82A 1D1DA 4WYMA 4DGEC 4B4NA 2WLVA 4E91A 4U0FA
chains in the Genus database with same CATH superfamily
2X2DD 4U0EA 2M8LA 4QNBA 4XFYA 2PWMA 1U7KA 4XFZA 1EIAA 1G03A 1M9CC 5HGLA 1L6NA 2V4XA 1EM9A 2X83A 2JPRA 1M9XC 1E6JP 1M9DC 4XRQA 2PXRC 3MGEA 2EIAA 4J93A 2Y4ZA 2WLVB 4PH0A 2M8NA 4U0AA 4DGAC 1M9EC 4HTWA 4XFXA 2GOLB 3H4EA 2PWOA 2XDEA 1AK4C 2LF4A 1GWPA 5HGKA 4XROA 2GONA 1QRJA 3NTEA 1M9YC 3H47A 4NX4C 2XGVA 4E92A 5HGNA 2M8PA 2XGYA 3P05A 4LQWC 1M9FC 5HGMA 4U0BA 2XGUA 1AFVA 4PH2A 4INBA 5JPAA 2KGFA 1P7NA 4PH3A 4U0DA 3BP9A 4U0CA 5HGOA 2X82A 1D1DA 4WYMA 4DGEC 4B4NA 2WLVA 4E91A 4U0FA
chains in the Genus database with same CATH topology
2X2DD 4U0EA 2M8LA 4QNBA 4XFYA 2PWMA 1U7KA 4XFZA 1EIAA 1G03A 1M9CC 5HGLA 1L6NA 2V4XA 1EM9A 2X83A 2JPRA 1M9XC 1E6JP 1M9DC 4XRQA 2PXRC 3MGEA 2EIAA 4J93A 2Y4ZA 2WLVB 4PH0A 2M8NA 4U0AA 4DGAC 1M9EC 4HTWA 4XFXA 2GOLB 3H4EA 2PWOA 2XDEA 1AK4C 2LF4A 1GWPA 5HGKA 4XROA 2GONA 1QRJA 3NTEA 1M9YC 3H47A 4NX4C 2XGVA 4E92A 5HGNA 2M8PA 2XGYA 3P05A 4LQWC 1M9FC 5HGMA 4U0BA 2XGUA 1AFVA 4PH2A 4INBA 5JPAA 2KGFA 1P7NA 4PH3A 4U0DA 3BP9A 4U0CA 5HGOA 2X82A 1D1DA 4WYMA 4DGEC 4B4NA 2WLVA 4E91A 4U0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2D D;  4U0E A;  2M8L A;  4QNB A;  4XFY A;  2PWM A;  1U7K A;  4XFZ A;  1EIA A;  1G03 A;  1M9C C;  5HGL A;  1L6N A;  2V4X A;  1EM9 A;  2X83 A;  2JPR A;  1M9X C;  1E6J P;  1M9D C;  4XRQ A;  2PXR C;  3MGE A;  2EIA A;  4J93 A;  2Y4Z A;  2WLV B;  4PH0 A;  2M8N A;  4U0A A;  4DGA C;  1M9E C;  4HTW A;  4XFX A;  2GOL B;  3H4E A;  2PWO A;  2XDE A;  1AK4 C;  2LF4 A;  1GWP A;  5HGK A;  4XRO A;  2GON A;  1QRJ A;  3NTE A;  1M9Y C;  3H47 A;  4NX4 C;  2XGV A;  4E92 A;  5HGN A;  2M8P A;  2XGY A;  3P05 A;  4LQW C;  1M9F C;  5HGM A;  4U0B A;  2XGU A;  1AFV A;  4PH2 A;  4INB A;  5JPA A;  2KGF A;  1P7N A;  4PH3 A;  4U0D A;  3BP9 A;  4U0C A;  5HGO A;  2X82 A;  1D1D A;  4WYM A;  4DGE C;  4B4N A;  2WLV A;  4E91 A;  4U0F A; 
#chains in the Genus database with same CATH topology
 2X2D D;  4U0E A;  2M8L A;  4QNB A;  4XFY A;  2PWM A;  1U7K A;  4XFZ A;  1EIA A;  1G03 A;  1M9C C;  5HGL A;  1L6N A;  2V4X A;  1EM9 A;  2X83 A;  2JPR A;  1M9X C;  1E6J P;  1M9D C;  4XRQ A;  2PXR C;  3MGE A;  2EIA A;  4J93 A;  2Y4Z A;  2WLV B;  4PH0 A;  2M8N A;  4U0A A;  4DGA C;  1M9E C;  4HTW A;  4XFX A;  2GOL B;  3H4E A;  2PWO A;  2XDE A;  1AK4 C;  2LF4 A;  1GWP A;  5HGK A;  4XRO A;  2GON A;  1QRJ A;  3NTE A;  1M9Y C;  3H47 A;  4NX4 C;  2XGV A;  4E92 A;  5HGN A;  2M8P A;  2XGY A;  3P05 A;  4LQW C;  1M9F C;  5HGM A;  4U0B A;  2XGU A;  1AFV A;  4PH2 A;  4INB A;  5JPA A;  2KGF A;  1P7N A;  4PH3 A;  4U0D A;  3BP9 A;  4U0C A;  5HGO A;  2X82 A;  1D1D A;  4WYM A;  4DGE C;  4B4N A;  2WLV A;  4E91 A;  4U0F A; 
#chains in the Genus database with same CATH homology
 2X2D D;  4U0E A;  2M8L A;  4QNB A;  4XFY A;  2PWM A;  1U7K A;  4XFZ A;  1EIA A;  1G03 A;  1M9C C;  5HGL A;  1L6N A;  2V4X A;  1EM9 A;  2X83 A;  2JPR A;  1M9X C;  1E6J P;  1M9D C;  4XRQ A;  2PXR C;  3MGE A;  2EIA A;  4J93 A;  2Y4Z A;  2WLV B;  4PH0 A;  2M8N A;  4U0A A;  4DGA C;  1M9E C;  4HTW A;  4XFX A;  2GOL B;  3H4E A;  2PWO A;  2XDE A;  1AK4 C;  2LF4 A;  1GWP A;  5HGK A;  4XRO A;  2GON A;  1QRJ A;  3NTE A;  1M9Y C;  3H47 A;  4NX4 C;  2XGV A;  4E92 A;  5HGN A;  2M8P A;  2XGY A;  3P05 A;  4LQW C;  1M9F C;  5HGM A;  4U0B A;  2XGU A;  1AFV A;  4PH2 A;  4INB A;  5JPA A;  2KGF A;  1P7N A;  4PH3 A;  4U0D A;  3BP9 A;  4U0C A;  5HGO A;  2X82 A;  1D1D A;  4WYM A;  4DGE C;  4B4N A;  2WLV A;  4E91 A;  4U0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...