2PWMA

Crystal structure of hiv-1 ca146 a92e real cell
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
145
structure length
145
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIEPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Antiviral Assembly Inhibitor CAP-1 Complex with the HIV-1 CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Gag-Pol polyprotein
total genus 48
structure length 145
sequence length 145
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2007-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2pwmA00
2X83A 4PH0A 1EM9A 1EIAA 4PH3A 1QRJA 5HGNA 1AK4C 1M9YC 4DGAC 4XROA 2PXRC 2KGFA 4XRQA 2JPRA 4XFYA 4U0FA 2LF4A 5JPAA 4WYMA 4E91A 2M8NA 2X2DD 5HGMA 3H47A 4PH2A 2PWOA 2GOLB 4U0EA 4U0AA 4U0DA 5HGLA 1M9CC 3P05A 1D1DA 2GONA 4J93A 4NX4C 2WLVB 4XFZA 4B4NA 1E6JP 2PWMA 3NTEA 4DGEC 2XGUA 5HGOA 2WLVA 2V4XA 4U0CA 1U7KA 2M8LA 1G03A 2Y4ZA 4HTWA 2X82A 2M8PA 1AFVA 4U0BA 4INBA 1GWPA 5HGKA 3BP9A 3MGEA 4E92A 4XFXA 1M9FC 2XGYA 1M9EC 4LQWC 4QNBA 1L6NA 1M9XC 2EIAA 2XGVA 3H4EA 2XDEA 1P7NA 1M9DC
chains in the Genus database with same CATH superfamily
2X83A 4PH0A 1EM9A 1EIAA 4PH3A 1QRJA 5HGNA 1AK4C 1M9YC 4DGAC 4XROA 2PXRC 2KGFA 4XRQA 2JPRA 4XFYA 4U0FA 2LF4A 5JPAA 4WYMA 4E91A 2M8NA 2X2DD 5HGMA 3H47A 4PH2A 2PWOA 2GOLB 4U0EA 4U0AA 4U0DA 5HGLA 1M9CC 3P05A 1D1DA 2GONA 4J93A 4NX4C 2WLVB 4XFZA 4B4NA 1E6JP 2PWMA 3NTEA 4DGEC 2XGUA 5HGOA 2WLVA 2V4XA 4U0CA 1U7KA 2M8LA 1G03A 2Y4ZA 4HTWA 2X82A 2M8PA 1AFVA 4U0BA 4INBA 1GWPA 5HGKA 3BP9A 3MGEA 4E92A 4XFXA 1M9FC 2XGYA 1M9EC 4LQWC 4QNBA 1L6NA 1M9XC 2EIAA 2XGVA 3H4EA 2XDEA 1P7NA 1M9DC
chains in the Genus database with same CATH topology
2X83A 4PH0A 1EM9A 1EIAA 4PH3A 1QRJA 5HGNA 1AK4C 1M9YC 4DGAC 4XROA 2PXRC 2KGFA 4XRQA 2JPRA 4XFYA 4U0FA 2LF4A 5JPAA 4WYMA 4E91A 2M8NA 2X2DD 5HGMA 3H47A 4PH2A 2PWOA 2GOLB 4U0EA 4U0AA 4U0DA 5HGLA 1M9CC 3P05A 1D1DA 2GONA 4J93A 4NX4C 2WLVB 4XFZA 4B4NA 1E6JP 2PWMA 3NTEA 4DGEC 2XGUA 5HGOA 2WLVA 2V4XA 4U0CA 1U7KA 2M8LA 1G03A 2Y4ZA 4HTWA 2X82A 2M8PA 1AFVA 4U0BA 4INBA 1GWPA 5HGKA 3BP9A 3MGEA 4E92A 4XFXA 1M9FC 2XGYA 1M9EC 4LQWC 4QNBA 1L6NA 1M9XC 2EIAA 2XGVA 3H4EA 2XDEA 1P7NA 1M9DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X83 A;  4PH0 A;  1EM9 A;  1EIA A;  4PH3 A;  1QRJ A;  5HGN A;  1AK4 C;  1M9Y C;  4DGA C;  4XRO A;  2PXR C;  2KGF A;  4XRQ A;  2JPR A;  4XFY A;  4U0F A;  2LF4 A;  5JPA A;  4WYM A;  4E91 A;  2M8N A;  2X2D D;  5HGM A;  3H47 A;  4PH2 A;  2PWO A;  2GOL B;  4U0E A;  4U0A A;  4U0D A;  5HGL A;  1M9C C;  3P05 A;  1D1D A;  2GON A;  4J93 A;  4NX4 C;  2WLV B;  4XFZ A;  4B4N A;  1E6J P;  2PWM A;  3NTE A;  4DGE C;  2XGU A;  5HGO A;  2WLV A;  2V4X A;  4U0C A;  1U7K A;  2M8L A;  1G03 A;  2Y4Z A;  4HTW A;  2X82 A;  2M8P A;  1AFV A;  4U0B A;  4INB A;  1GWP A;  5HGK A;  3BP9 A;  3MGE A;  4E92 A;  4XFX A;  1M9F C;  2XGY A;  1M9E C;  4LQW C;  4QNB A;  1L6N A;  1M9X C;  2EIA A;  2XGV A;  3H4E A;  2XDE A;  1P7N A;  1M9D C; 
#chains in the Genus database with same CATH topology
 2X83 A;  4PH0 A;  1EM9 A;  1EIA A;  4PH3 A;  1QRJ A;  5HGN A;  1AK4 C;  1M9Y C;  4DGA C;  4XRO A;  2PXR C;  2KGF A;  4XRQ A;  2JPR A;  4XFY A;  4U0F A;  2LF4 A;  5JPA A;  4WYM A;  4E91 A;  2M8N A;  2X2D D;  5HGM A;  3H47 A;  4PH2 A;  2PWO A;  2GOL B;  4U0E A;  4U0A A;  4U0D A;  5HGL A;  1M9C C;  3P05 A;  1D1D A;  2GON A;  4J93 A;  4NX4 C;  2WLV B;  4XFZ A;  4B4N A;  1E6J P;  2PWM A;  3NTE A;  4DGE C;  2XGU A;  5HGO A;  2WLV A;  2V4X A;  4U0C A;  1U7K A;  2M8L A;  1G03 A;  2Y4Z A;  4HTW A;  2X82 A;  2M8P A;  1AFV A;  4U0B A;  4INB A;  1GWP A;  5HGK A;  3BP9 A;  3MGE A;  4E92 A;  4XFX A;  1M9F C;  2XGY A;  1M9E C;  4LQW C;  4QNB A;  1L6N A;  1M9X C;  2EIA A;  2XGV A;  3H4E A;  2XDE A;  1P7N A;  1M9D C; 
#chains in the Genus database with same CATH homology
 2X83 A;  4PH0 A;  1EM9 A;  1EIA A;  4PH3 A;  1QRJ A;  5HGN A;  1AK4 C;  1M9Y C;  4DGA C;  4XRO A;  2PXR C;  2KGF A;  4XRQ A;  2JPR A;  4XFY A;  4U0F A;  2LF4 A;  5JPA A;  4WYM A;  4E91 A;  2M8N A;  2X2D D;  5HGM A;  3H47 A;  4PH2 A;  2PWO A;  2GOL B;  4U0E A;  4U0A A;  4U0D A;  5HGL A;  1M9C C;  3P05 A;  1D1D A;  2GON A;  4J93 A;  4NX4 C;  2WLV B;  4XFZ A;  4B4N A;  1E6J P;  2PWM A;  3NTE A;  4DGE C;  2XGU A;  5HGO A;  2WLV A;  2V4X A;  4U0C A;  1U7K A;  2M8L A;  1G03 A;  2Y4Z A;  4HTW A;  2X82 A;  2M8P A;  1AFV A;  4U0B A;  4INB A;  1GWP A;  5HGK A;  3BP9 A;  3MGE A;  4E92 A;  4XFX A;  1M9F C;  2XGY A;  1M9E C;  4LQW C;  4QNB A;  1L6N A;  1M9X C;  2EIA A;  2XGV A;  3H4E A;  2XDE A;  1P7N A;  1M9D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...