1P7NA

Dimeric rous sarcoma virus capsid protein structure with an upstream 25-amino acid residue extension of c-terminal of gag p10 protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
176
Chain Sequence
GPTSPGPALTDWARVREELASTGPPVVAMPVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimeric rous sarcoma virus capsid protein structure relevant to immature gag assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN CAPSID PROTEIN P27
total genus 56
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2003-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1p7nA00
2X2DD 2GONA 2Y4ZA 4INBA 2M8LA 2V4XA 5JPAA 5HGNA 4J93A 5HGLA 4B4NA 2PWMA 4DGEC 1U7KA 2M8PA 1E6JP 2EIAA 2XDEA 3H47A 2JPRA 3MGEA 4U0EA 4U0CA 2PWOA 2WLVB 1P7NA 3NTEA 1G03A 1M9CC 4U0AA 4XFYA 2XGVA 4QNBA 2M8NA 4PH0A 4HTWA 2X82A 1EM9A 1D1DA 2LF4A 4DGAC 1QRJA 4U0FA 2KGFA 4PH3A 1EIAA 1M9FC 4NX4C 1AFVA 1AK4C 5HGOA 5HGMA 4LQWC 4U0DA 5HGKA 4E91A 1M9DC 3H4EA 3P05A 1M9YC 2XGYA 1L6NA 1M9EC 4E92A 2XGUA 1M9XC 2WLVA 2GOLB 2PXRC 2X83A 3BP9A 4PH2A 4U0BA 4WYMA 4XFXA 4XRQA 4XROA 4XFZA 1GWPA
chains in the Genus database with same CATH superfamily
2X2DD 2GONA 2Y4ZA 4INBA 2M8LA 2V4XA 5JPAA 5HGNA 4J93A 5HGLA 4B4NA 2PWMA 4DGEC 1U7KA 2M8PA 1E6JP 2EIAA 2XDEA 3H47A 2JPRA 3MGEA 4U0EA 4U0CA 2PWOA 2WLVB 1P7NA 3NTEA 1G03A 1M9CC 4U0AA 4XFYA 2XGVA 4QNBA 2M8NA 4PH0A 4HTWA 2X82A 1EM9A 1D1DA 2LF4A 4DGAC 1QRJA 4U0FA 2KGFA 4PH3A 1EIAA 1M9FC 4NX4C 1AFVA 1AK4C 5HGOA 5HGMA 4LQWC 4U0DA 5HGKA 4E91A 1M9DC 3H4EA 3P05A 1M9YC 2XGYA 1L6NA 1M9EC 4E92A 2XGUA 1M9XC 2WLVA 2GOLB 2PXRC 2X83A 3BP9A 4PH2A 4U0BA 4WYMA 4XFXA 4XRQA 4XROA 4XFZA 1GWPA
chains in the Genus database with same CATH topology
2X2DD 2GONA 2Y4ZA 4INBA 2M8LA 2V4XA 5JPAA 5HGNA 4J93A 5HGLA 4B4NA 2PWMA 4DGEC 1U7KA 2M8PA 1E6JP 2EIAA 2XDEA 3H47A 2JPRA 3MGEA 4U0EA 4U0CA 2PWOA 2WLVB 1P7NA 3NTEA 1G03A 1M9CC 4U0AA 4XFYA 2XGVA 4QNBA 2M8NA 4PH0A 4HTWA 2X82A 1EM9A 1D1DA 2LF4A 4DGAC 1QRJA 4U0FA 2KGFA 4PH3A 1EIAA 1M9FC 4NX4C 1AFVA 1AK4C 5HGOA 5HGMA 4LQWC 4U0DA 5HGKA 4E91A 1M9DC 3H4EA 3P05A 1M9YC 2XGYA 1L6NA 1M9EC 4E92A 2XGUA 1M9XC 2WLVA 2GOLB 2PXRC 2X83A 3BP9A 4PH2A 4U0BA 4WYMA 4XFXA 4XRQA 4XROA 4XFZA 1GWPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X2D D;  2GON A;  2Y4Z A;  4INB A;  2M8L A;  2V4X A;  5JPA A;  5HGN A;  4J93 A;  5HGL A;  4B4N A;  2PWM A;  4DGE C;  1U7K A;  2M8P A;  1E6J P;  2EIA A;  2XDE A;  3H47 A;  2JPR A;  3MGE A;  4U0E A;  4U0C A;  2PWO A;  2WLV B;  1P7N A;  3NTE A;  1G03 A;  1M9C C;  4U0A A;  4XFY A;  2XGV A;  4QNB A;  2M8N A;  4PH0 A;  4HTW A;  2X82 A;  1EM9 A;  1D1D A;  2LF4 A;  4DGA C;  1QRJ A;  4U0F A;  2KGF A;  4PH3 A;  1EIA A;  1M9F C;  4NX4 C;  1AFV A;  1AK4 C;  5HGO A;  5HGM A;  4LQW C;  4U0D A;  5HGK A;  4E91 A;  1M9D C;  3H4E A;  3P05 A;  1M9Y C;  2XGY A;  1L6N A;  1M9E C;  4E92 A;  2XGU A;  1M9X C;  2WLV A;  2GOL B;  2PXR C;  2X83 A;  3BP9 A;  4PH2 A;  4U0B A;  4WYM A;  4XFX A;  4XRQ A;  4XRO A;  4XFZ A;  1GWP A; 
#chains in the Genus database with same CATH topology
 2X2D D;  2GON A;  2Y4Z A;  4INB A;  2M8L A;  2V4X A;  5JPA A;  5HGN A;  4J93 A;  5HGL A;  4B4N A;  2PWM A;  4DGE C;  1U7K A;  2M8P A;  1E6J P;  2EIA A;  2XDE A;  3H47 A;  2JPR A;  3MGE A;  4U0E A;  4U0C A;  2PWO A;  2WLV B;  1P7N A;  3NTE A;  1G03 A;  1M9C C;  4U0A A;  4XFY A;  2XGV A;  4QNB A;  2M8N A;  4PH0 A;  4HTW A;  2X82 A;  1EM9 A;  1D1D A;  2LF4 A;  4DGA C;  1QRJ A;  4U0F A;  2KGF A;  4PH3 A;  1EIA A;  1M9F C;  4NX4 C;  1AFV A;  1AK4 C;  5HGO A;  5HGM A;  4LQW C;  4U0D A;  5HGK A;  4E91 A;  1M9D C;  3H4E A;  3P05 A;  1M9Y C;  2XGY A;  1L6N A;  1M9E C;  4E92 A;  2XGU A;  1M9X C;  2WLV A;  2GOL B;  2PXR C;  2X83 A;  3BP9 A;  4PH2 A;  4U0B A;  4WYM A;  4XFX A;  4XRQ A;  4XRO A;  4XFZ A;  1GWP A; 
#chains in the Genus database with same CATH homology
 2X2D D;  2GON A;  2Y4Z A;  4INB A;  2M8L A;  2V4X A;  5JPA A;  5HGN A;  4J93 A;  5HGL A;  4B4N A;  2PWM A;  4DGE C;  1U7K A;  2M8P A;  1E6J P;  2EIA A;  2XDE A;  3H47 A;  2JPR A;  3MGE A;  4U0E A;  4U0C A;  2PWO A;  2WLV B;  1P7N A;  3NTE A;  1G03 A;  1M9C C;  4U0A A;  4XFY A;  2XGV A;  4QNB A;  2M8N A;  4PH0 A;  4HTW A;  2X82 A;  1EM9 A;  1D1D A;  2LF4 A;  4DGA C;  1QRJ A;  4U0F A;  2KGF A;  4PH3 A;  1EIA A;  1M9F C;  4NX4 C;  1AFV A;  1AK4 C;  5HGO A;  5HGM A;  4LQW C;  4U0D A;  5HGK A;  4E91 A;  1M9D C;  3H4E A;  3P05 A;  1M9Y C;  2XGY A;  1L6N A;  1M9E C;  4E92 A;  2XGU A;  1M9X C;  2WLV A;  2GOL B;  2PXR C;  2X83 A;  3BP9 A;  4PH2 A;  4U0B A;  4WYM A;  4XFX A;  4XRQ A;  4XRO A;  4XFZ A;  1GWP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...