1P7NA

Dimeric rous sarcoma virus capsid protein structure with an upstream 25-amino acid residue extension of c-terminal of gag p10 protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
176
Chain Sequence
GPTSPGPALTDWARVREELASTGPPVVAMPVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords GAG POLYPROTEIN CAPSID PROTEIN P27
publication title Dimeric rous sarcoma virus capsid protein structure relevant to immature gag assembly
pubmed doi rcsb
source organism Rous sarcoma virus
total genus 56
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2003-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1p7nA00
5HGOA 1M9XC 4XFYA 1AK4C 1D1DA 4PH2A 4DGAC 2X2DD 4PH0A 1EIAA 3MGEA 4XRQA 1GWPA 2KGFA 4U0FA 2GONA 3BP9A 1P7NA 2JPRA 2M8PA 2WLVB 2X82A 4XFXA 5HGNA 4DGEC 2WLVA 4J93A 1L6NA 4U0EA 2X83A 4XROA 1U7KA 1M9YC 2LF4A 4B4NA 2PWOA 4PH3A 3P05A 5HGLA 1M9CC 3H4EA 4U0CA 2PWMA 4NX4C 2XGUA 4QNBA 2PXRC 2M8NA 2M8LA 4E91A 4INBA 1G03A 2EIAA 1QRJA 4HTWA 1M9EC 5HGKA 1EM9A 2GOLB 1M9FC 1E6JP 4U0BA 1M9DC 5HGMA 2XGYA 3NTEA 2Y4ZA 3H47A 4LQWC 2V4XA 1AFVA 4U0AA 4WYMA 4E92A 5JPAA 2XGVA 2XDEA 4U0DA 4XFZA
chains in the Genus database with same CATH superfamily
5HGOA 1M9XC 4XFYA 1AK4C 1D1DA 4PH2A 4DGAC 2X2DD 4PH0A 1EIAA 3MGEA 4XRQA 1GWPA 2KGFA 4U0FA 2GONA 3BP9A 1P7NA 2JPRA 2M8PA 2WLVB 2X82A 4XFXA 5HGNA 4DGEC 2WLVA 4J93A 1L6NA 4U0EA 2X83A 4XROA 1U7KA 1M9YC 2LF4A 4B4NA 2PWOA 4PH3A 3P05A 5HGLA 1M9CC 3H4EA 4U0CA 2PWMA 4NX4C 2XGUA 4QNBA 2PXRC 2M8NA 2M8LA 4E91A 4INBA 1G03A 2EIAA 1QRJA 4HTWA 1M9EC 5HGKA 1EM9A 2GOLB 1M9FC 1E6JP 4U0BA 1M9DC 5HGMA 2XGYA 3NTEA 2Y4ZA 3H47A 4LQWC 2V4XA 1AFVA 4U0AA 4WYMA 4E92A 5JPAA 2XGVA 2XDEA 4U0DA 4XFZA
chains in the Genus database with same CATH topology
5HGOA 1M9XC 4XFYA 1AK4C 1D1DA 4PH2A 4DGAC 2X2DD 4PH0A 1EIAA 3MGEA 4XRQA 1GWPA 2KGFA 4U0FA 2GONA 3BP9A 1P7NA 2JPRA 2M8PA 2WLVB 2X82A 4XFXA 5HGNA 4DGEC 2WLVA 4J93A 1L6NA 4U0EA 2X83A 4XROA 1U7KA 1M9YC 2LF4A 4B4NA 2PWOA 4PH3A 3P05A 5HGLA 1M9CC 3H4EA 4U0CA 2PWMA 4NX4C 2XGUA 4QNBA 2PXRC 2M8NA 2M8LA 4E91A 4INBA 1G03A 2EIAA 1QRJA 4HTWA 1M9EC 5HGKA 1EM9A 2GOLB 1M9FC 1E6JP 4U0BA 1M9DC 5HGMA 2XGYA 3NTEA 2Y4ZA 3H47A 4LQWC 2V4XA 1AFVA 4U0AA 4WYMA 4E92A 5JPAA 2XGVA 2XDEA 4U0DA 4XFZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGO A;  1M9X C;  4XFY A;  1AK4 C;  1D1D A;  4PH2 A;  4DGA C;  2X2D D;  4PH0 A;  1EIA A;  3MGE A;  4XRQ A;  1GWP A;  2KGF A;  4U0F A;  2GON A;  3BP9 A;  1P7N A;  2JPR A;  2M8P A;  2WLV B;  2X82 A;  4XFX A;  5HGN A;  4DGE C;  2WLV A;  4J93 A;  1L6N A;  4U0E A;  2X83 A;  4XRO A;  1U7K A;  1M9Y C;  2LF4 A;  4B4N A;  2PWO A;  4PH3 A;  3P05 A;  5HGL A;  1M9C C;  3H4E A;  4U0C A;  2PWM A;  4NX4 C;  2XGU A;  4QNB A;  2PXR C;  2M8N A;  2M8L A;  4E91 A;  4INB A;  1G03 A;  2EIA A;  1QRJ A;  4HTW A;  1M9E C;  5HGK A;  1EM9 A;  2GOL B;  1M9F C;  1E6J P;  4U0B A;  1M9D C;  5HGM A;  2XGY A;  3NTE A;  2Y4Z A;  3H47 A;  4LQW C;  2V4X A;  1AFV A;  4U0A A;  4WYM A;  4E92 A;  5JPA A;  2XGV A;  2XDE A;  4U0D A;  4XFZ A; 
#chains in the Genus database with same CATH topology
 5HGO A;  1M9X C;  4XFY A;  1AK4 C;  1D1D A;  4PH2 A;  4DGA C;  2X2D D;  4PH0 A;  1EIA A;  3MGE A;  4XRQ A;  1GWP A;  2KGF A;  4U0F A;  2GON A;  3BP9 A;  1P7N A;  2JPR A;  2M8P A;  2WLV B;  2X82 A;  4XFX A;  5HGN A;  4DGE C;  2WLV A;  4J93 A;  1L6N A;  4U0E A;  2X83 A;  4XRO A;  1U7K A;  1M9Y C;  2LF4 A;  4B4N A;  2PWO A;  4PH3 A;  3P05 A;  5HGL A;  1M9C C;  3H4E A;  4U0C A;  2PWM A;  4NX4 C;  2XGU A;  4QNB A;  2PXR C;  2M8N A;  2M8L A;  4E91 A;  4INB A;  1G03 A;  2EIA A;  1QRJ A;  4HTW A;  1M9E C;  5HGK A;  1EM9 A;  2GOL B;  1M9F C;  1E6J P;  4U0B A;  1M9D C;  5HGM A;  2XGY A;  3NTE A;  2Y4Z A;  3H47 A;  4LQW C;  2V4X A;  1AFV A;  4U0A A;  4WYM A;  4E92 A;  5JPA A;  2XGV A;  2XDE A;  4U0D A;  4XFZ A; 
#chains in the Genus database with same CATH homology
 5HGO A;  1M9X C;  4XFY A;  1AK4 C;  1D1D A;  4PH2 A;  4DGA C;  2X2D D;  4PH0 A;  1EIA A;  3MGE A;  4XRQ A;  1GWP A;  2KGF A;  4U0F A;  2GON A;  3BP9 A;  1P7N A;  2JPR A;  2M8P A;  2WLV B;  2X82 A;  4XFX A;  5HGN A;  4DGE C;  2WLV A;  4J93 A;  1L6N A;  4U0E A;  2X83 A;  4XRO A;  1U7K A;  1M9Y C;  2LF4 A;  4B4N A;  2PWO A;  4PH3 A;  3P05 A;  5HGL A;  1M9C C;  3H4E A;  4U0C A;  2PWM A;  4NX4 C;  2XGU A;  4QNB A;  2PXR C;  2M8N A;  2M8L A;  4E91 A;  4INB A;  1G03 A;  2EIA A;  1QRJ A;  4HTW A;  1M9E C;  5HGK A;  1EM9 A;  2GOL B;  1M9F C;  1E6J P;  4U0B A;  1M9D C;  5HGM A;  2XGY A;  3NTE A;  2Y4Z A;  3H47 A;  4LQW C;  2V4X A;  1AFV A;  4U0A A;  4WYM A;  4E92 A;  5JPA A;  2XGV A;  2XDE A;  4U0D A;  4XFZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...