1P7NA

Dimeric rous sarcoma virus capsid protein structure with an upstream 25-amino acid residue extension of c-terminal of gag p10 protein
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
176
structure length
176
Chain Sequence
b'GPTSPGPALTDWARVREELASTGPPVVAMPVVIKTEGPAWTPLEPKLITRLADTVRTKGLRSPITMAEVEALMSSPLLPHDVTNLMRVILGPAPYALWMDAWGVQLQTVIAAATRDPRHPANGQGRGERTNLNRLKGLADGMVGNPQGQAALLRPGELVAITASALQAFREVARLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN CAPSID PROTEIN P27
publication title Dimeric rous sarcoma virus capsid protein structure relevant to immature gag assembly
pubmed doi rcsb
source organism Rous sarcoma virus
molecule tags Viral protein
total genus 56
structure length 176
sequence length 176
ec nomenclature
pdb deposition date 2003-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1p7nA00
4U0AA 1U7KA 4U0BA 4PH2A 3NTEA 4HTWA 4U0CA 4LQWC 1M9DC 2WLVB 3MGEA 2XDEA 4XFZA 3P05A 4PH3A 5HGMA 4PH0A 1AK4C 1AFVA 4DGAC 2XGUA 2PXRC 4XROA 5HGLA 2GOLB 4E92A 5JPAA 1M9YC 1D1DA 4NX4C 2PWMA 2M8LA 4XFYA 1P7NA 5HGNA 4QNBA 1M9EC 2X2DD 4E91A 3H4EA 1M9CC 1M9XC 2KGFA 2XGYA 1L6NA 4DGEC 5HGOA 4U0FA 2M8NA 1M9FC 2X82A 2X83A 5HGKA 2Y4ZA 4U0EA 4U0DA 1E6JP 4INBA 1G03A 1EIAA 4XRQA 1QRJA 2WLVA 4WYMA 2JPRA 1EM9A 4J93A 2V4XA 2LF4A 3BP9A 4B4NA 2M8PA 2XGVA 2EIAA 3H47A 2GONA 1GWPA 2PWOA 4XFXA
chains in the Genus database with same CATH superfamily
4U0AA 1U7KA 4U0BA 4PH2A 3NTEA 4HTWA 4U0CA 4LQWC 1M9DC 2WLVB 3MGEA 2XDEA 4XFZA 3P05A 4PH3A 5HGMA 4PH0A 1AK4C 1AFVA 4DGAC 2XGUA 2PXRC 4XROA 5HGLA 2GOLB 4E92A 5JPAA 1M9YC 1D1DA 4NX4C 2PWMA 2M8LA 4XFYA 1P7NA 5HGNA 4QNBA 1M9EC 2X2DD 4E91A 3H4EA 1M9CC 1M9XC 2KGFA 2XGYA 1L6NA 4DGEC 5HGOA 4U0FA 2M8NA 1M9FC 2X82A 2X83A 5HGKA 2Y4ZA 4U0EA 4U0DA 1E6JP 4INBA 1G03A 1EIAA 4XRQA 1QRJA 2WLVA 4WYMA 2JPRA 1EM9A 4J93A 2V4XA 2LF4A 3BP9A 4B4NA 2M8PA 2XGVA 2EIAA 3H47A 2GONA 1GWPA 2PWOA 4XFXA
chains in the Genus database with same CATH topology
4U0AA 1U7KA 4U0BA 4PH2A 3NTEA 4HTWA 4U0CA 4LQWC 1M9DC 2WLVB 3MGEA 2XDEA 4XFZA 3P05A 4PH3A 5HGMA 4PH0A 1AK4C 1AFVA 4DGAC 2XGUA 2PXRC 4XROA 5HGLA 2GOLB 4E92A 5JPAA 1M9YC 1D1DA 4NX4C 2PWMA 2M8LA 4XFYA 1P7NA 5HGNA 4QNBA 1M9EC 2X2DD 4E91A 3H4EA 1M9CC 1M9XC 2KGFA 2XGYA 1L6NA 4DGEC 5HGOA 4U0FA 2M8NA 1M9FC 2X82A 2X83A 5HGKA 2Y4ZA 4U0EA 4U0DA 1E6JP 4INBA 1G03A 1EIAA 4XRQA 1QRJA 2WLVA 4WYMA 2JPRA 1EM9A 4J93A 2V4XA 2LF4A 3BP9A 4B4NA 2M8PA 2XGVA 2EIAA 3H47A 2GONA 1GWPA 2PWOA 4XFXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0A A;  1U7K A;  4U0B A;  4PH2 A;  3NTE A;  4HTW A;  4U0C A;  4LQW C;  1M9D C;  2WLV B;  3MGE A;  2XDE A;  4XFZ A;  3P05 A;  4PH3 A;  5HGM A;  4PH0 A;  1AK4 C;  1AFV A;  4DGA C;  2XGU A;  2PXR C;  4XRO A;  5HGL A;  2GOL B;  4E92 A;  5JPA A;  1M9Y C;  1D1D A;  4NX4 C;  2PWM A;  2M8L A;  4XFY A;  1P7N A;  5HGN A;  4QNB A;  1M9E C;  2X2D D;  4E91 A;  3H4E A;  1M9C C;  1M9X C;  2KGF A;  2XGY A;  1L6N A;  4DGE C;  5HGO A;  4U0F A;  2M8N A;  1M9F C;  2X82 A;  2X83 A;  5HGK A;  2Y4Z A;  4U0E A;  4U0D A;  1E6J P;  4INB A;  1G03 A;  1EIA A;  4XRQ A;  1QRJ A;  2WLV A;  4WYM A;  2JPR A;  1EM9 A;  4J93 A;  2V4X A;  2LF4 A;  3BP9 A;  4B4N A;  2M8P A;  2XGV A;  2EIA A;  3H47 A;  2GON A;  1GWP A;  2PWO A;  4XFX A; 
#chains in the Genus database with same CATH topology
 4U0A A;  1U7K A;  4U0B A;  4PH2 A;  3NTE A;  4HTW A;  4U0C A;  4LQW C;  1M9D C;  2WLV B;  3MGE A;  2XDE A;  4XFZ A;  3P05 A;  4PH3 A;  5HGM A;  4PH0 A;  1AK4 C;  1AFV A;  4DGA C;  2XGU A;  2PXR C;  4XRO A;  5HGL A;  2GOL B;  4E92 A;  5JPA A;  1M9Y C;  1D1D A;  4NX4 C;  2PWM A;  2M8L A;  4XFY A;  1P7N A;  5HGN A;  4QNB A;  1M9E C;  2X2D D;  4E91 A;  3H4E A;  1M9C C;  1M9X C;  2KGF A;  2XGY A;  1L6N A;  4DGE C;  5HGO A;  4U0F A;  2M8N A;  1M9F C;  2X82 A;  2X83 A;  5HGK A;  2Y4Z A;  4U0E A;  4U0D A;  1E6J P;  4INB A;  1G03 A;  1EIA A;  4XRQ A;  1QRJ A;  2WLV A;  4WYM A;  2JPR A;  1EM9 A;  4J93 A;  2V4X A;  2LF4 A;  3BP9 A;  4B4N A;  2M8P A;  2XGV A;  2EIA A;  3H47 A;  2GON A;  1GWP A;  2PWO A;  4XFX A; 
#chains in the Genus database with same CATH homology
 4U0A A;  1U7K A;  4U0B A;  4PH2 A;  3NTE A;  4HTW A;  4U0C A;  4LQW C;  1M9D C;  2WLV B;  3MGE A;  2XDE A;  4XFZ A;  3P05 A;  4PH3 A;  5HGM A;  4PH0 A;  1AK4 C;  1AFV A;  4DGA C;  2XGU A;  2PXR C;  4XRO A;  5HGL A;  2GOL B;  4E92 A;  5JPA A;  1M9Y C;  1D1D A;  4NX4 C;  2PWM A;  2M8L A;  4XFY A;  1P7N A;  5HGN A;  4QNB A;  1M9E C;  2X2D D;  4E91 A;  3H4E A;  1M9C C;  1M9X C;  2KGF A;  2XGY A;  1L6N A;  4DGE C;  5HGO A;  4U0F A;  2M8N A;  1M9F C;  2X82 A;  2X83 A;  5HGK A;  2Y4Z A;  4U0E A;  4U0D A;  1E6J P;  4INB A;  1G03 A;  1EIA A;  4XRQ A;  1QRJ A;  2WLV A;  4WYM A;  2JPR A;  1EM9 A;  4J93 A;  2V4X A;  2LF4 A;  3BP9 A;  4B4N A;  2M8P A;  2XGV A;  2EIA A;  3H47 A;  2GON A;  1GWP A;  2PWO A;  4XFX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...