1EIAA

X-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
207
structure length
207
Chain Sequence
TPRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAPPQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKPKAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords EIAV CAPSID PROTEIN P26
publication title Model for lentivirus capsid core assembly based on crystal dimers of EIAV p26.
pubmed doi rcsb
source organism Equine infectious anemia virus
total genus 77
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 1998-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1eiaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1eiaA02
4QNBA 4XROA 2XGVA 1A43A 4J93A 3G0VA 3G26A 2X2DD 1AFVA 3DS1A 4U0EA 2JO0A 1AUMA 3G29A 2XV6A 1EM9A 1G03A 5HGMA 4E92A 4U0CA 3MGEA 2KODA 1GWPA 3DS3A 3G1GA 2EIAA 4PH1A 4B4NA 2ONTA 2XT1A 1AK4C 2M8NA 3DS2A 5I4TG 3DPHA 2V4XA 4NX4C 4PH3A 5HGOA 3H4EA 4DGEC 2XGUA 5HGKA 2JYGA 4U0BA 3G1IA 1P7NA 2XDEA 2WLVB 2JPRA 4WYMA 4XFZA 4XFXA 1M9XC 4LQWC 2L6EA 2X82A 2GOLB 4IPYA 1M9DC 2PWMA 4PH2A 2WLVA 5HGLA 2PWOA 3BP9A 4E91A 4DGAC 4HTWA 1D1DA 4U0AA 3G28A 3H47A 2XXMA 3P05A 4INBA 2X83A 1A8OA 1BAJA 2JYLA 4U0DA 2BUOA 1M9EC 2KGFA 2Y4ZA 2M8LA 2XGYA 2M8PA 1M9FC 4COPA 2LF4A 4PH0A 1EOQA 3G21A 4U0FA 2GONA 1U7KA 3DTJA 3NTEA 4M0IA 1M9YC 1M9CC 2PXRC 1QRJA 4XRQA 3DS4A 4XFYA 1L6NA 1EIAA 5HGNA 5DCKA 3DS0A 4COCA 3DS5A 3LRYA 5JPAA 1E6JP 3VRLC
chains in the Genus database with same CATH superfamily
4XROA 4J93A 2JGPA 1AFVA 3CCEP 4U0EA 2FAEA 2KGAA 3G29A 1IMPA 3GZLA 5HGMA 1Q86Q 1VKUA 5CZDB 2LIWA 3G1GA 1VQ8P 2N98A 2ONTA 2DGYA 1E0HA 2PEQA 3CC7P 2EFJA 2CWOA 2EG5A 2VLOA 3GJNA 2K0DX 1K9MQ 2CGQA 2JYGA 3CC4P 3G1IA 1P7NA 3NY7B 2PEOA 4PXHB 4WYMA 2KG8A 2ERHA 2JU2A 1KLPA 4H2XC 2KGDA 4IPYA 5F2OA 2WLVA 4PWVB 4UHPB 1D1DA 2GZEA 3H47A 2X83A 2E1MA 3CCJP 4U0DA 1GPJA 1AYIA 2KORA 2KOQA 3WBHA 4R0MA 4PH0A 4CA3A 1UNKA 5F2KA 1EOQA 3G21A 5F2NA 1W2BO 3DTJA 3NTEA 2Z46A 2L0QA 2LL8A 4GR6A 3I55P 3CCSP 1EIAA 2CQ8A 1QVFO 1HY8A 1T8KA 4COCA 3DS5A 2GZIA 2Z44A 1S72P 3VRLC 2MD9A 5HV8A 4QNBA 3CPWO 2PY8A 1VQ5P 2FVAA 2XGVA 3CMAP 3CD6P 3DS1A 2K92A 1EM9A 2JB0A 2K93A 2L4BA 2BHVA 4IZ6A 1GWPA 2M5RA 4PH1A 7CEIA 2XT1A 1AK4C 2WPTA 2K0XA 2LKIA 2K0YA 2LIUA 1YJ9P 2XGUA 1M6NA 2OTJP 4HKGA 2PEJA 2ROQA 1RNIA 1BXIA 1UJZA 1KQSO 2P9XA 2VSQA 2JPRA 4XFZA 3CCVP 2KGCA 2AF8A 2KG6A 4BPFA 4PH2A 3EJEA 1N8RQ 1MZ8A 1YITP 1CEIA 2PWOA 1VQLP 3RG2A 3G28A 1VQMP 1YJNP 2XXMA 2BUOA 2PNGA 2KGFA 2FVEA 1RO2A 3CCQP 1M74A 2M8PA 2FACA 4COPA 3CCRP 2AVAA 3U43A 1U7KA 2LMLA 4M0IA 1M9CC 1YI2P 2PXRC 2MVUA 1QRJA 3DS4A 1JJ2O 5HVCA 2X2BA 2FADA 1Z6MA 1VQ9P 4F37A 5EJDA 2K5XA 1M6EX 2KOSA 2VLNA 1A43A 1NJIQ 1VQKP 3CXCO 3Q20A 1AUMA 2JBGA 1VQ7P 1HQBA 2GDYA 2KODA 1K73Q 3DS3A 2EIAA 4B4NA 1F80D 2PENA 2XZ0D 1K8AQ 2LTEA 2GZJA 3CMEP 2GDXA 2M8NA 3DS2A 2OTLP 1ZNVA 4PH3A 5HGOA 3H4EA 4DGEC 2JQ4A 1VQOP 3B5IA 1L0IA 2N6YA 2PEMA 2WLVB 4QKOA 2K2QA 1M9DC 3M1MA 2MR8A 5HGLA 4DGAC 4U0AA 4DG9A 3E2DA 5KP8B 4INBA 2MVVA 1ZMBA 1A8OA 1BAJA 2JYLA 2LPKA 1M9EC 2Y4ZA 2N50A 2FQ0A 2LF4A 1DV5A 3LMOA 1YJWP 3G6EP 2GONA 3RG6C 1VQ4P 1GXGA 4XRQA 2NO8A 4H2WC 1ACPA 5HGNA 5DCKA 3G71P 1M1KQ 3CCLP 4NEOA 5JPAA 1L0HA 2MR7A 2CNRA 4BPHA 1Q82Q 2LOLA 3HYBA 2KG9A 1DNYA 3G0VA 3G26A 5KP6B 2X2DD 1VQNP 2N5HA 2JO0A 2VLPA 2XV6A 3OW2O 1X3OA 1G03A 2QNWA 4E92A 4U0CA 3MGEA 1Q7YQ 1YHQP 3CC2P 1KC8Q 2FVFA 1AF8A 2XZ1C 2FQ2A 2Z45A 4MRTC 5I4TG 2N6ZA 3DPHA 2V4XA 4NX4C 2VLQA 2EHTA 1M90Q 1KD1Q 5HGKA 2EHSA 2L9FA 3CCUP 4U0BA 2XDEA 2L22A 1FR2A 2OARA 4GR2A 2KR5A 3B4QA 1QVGO 4XFXA 5BS1A 1M9XC 4LQWC 2L6EA 2QA4P 2X82A 2GOLB 2PWMA 4H2YC 1EMVA 2PEIA 2FQ1A 3BP9A 4E91A 2AFEA 5KP7B 4HTWA 1IMQA 2GZFA 2KOPA 1OR5A 5BS2A 2K94A 4BPGA 3I56P 3P05A 1VHNA 2KGEA 1Q81Q 2DNWA 2PEKA 2CG5B 2AFDA 1IUQA 2M8LA 5EW5E 2XGYA 3H0DA 3G4SP 1RO0A 1VQPP 1M9FC 3GZMA 2QEXP 3HZQA 1NQ4A 2GYKA 3GKLC 2GDWA 1K30A 1GXHA 4U0FA 1VQ6P 1M9YC 2MF4A 2JAZA 2KWLA 4XFYA 1L6NA 2N5IA 3CCMP 2MY5A 2FHSC 2KOOA 3DS0A 1YIJP 2KW2A 3LRYA 3EJBA 3EJDA 2JU1A 1E6JP 2GZGA 3CE7A
chains in the Genus database with same CATH topology
4QNBA 3CPWO 2PY8A 1VQ5P 1Q82Q 4XROA 1M6EX 3HYBA 2XGVA 1A43A 3CMAP 1NJIQ 4J93A 1VQKP 3G0VA 3G26A 2X2DD 3CXCO 1AFVA 3DS1A 3CCEP 1VQNP 4U0EA 3CD6P 3Q20A 2JO0A 1AUMA 3G29A 2XV6A 3OW2O 1VQ7P 1EM9A 1G03A 5HGMA 1Q86Q 4E92A 4U0CA 3MGEA 2BHVA 2KODA 1GWPA 1Q7YQ 3DS3A 3G1GA 1K73Q 1VQ8P 2EIAA 4PH1A 4B4NA 1YHQP 3CC2P 2ONTA 1KC8Q 2DGYA 2PENA 1K8AQ 2XT1A 3CMEP 2Z45A 1AK4C 2M8NA 2PEQA 3DS2A 3DPHA 5I4TG 2OTLP 2V4XA 3CC7P 4NX4C 2EFJA 2CWOA 4PH3A 5HGOA 3H4EA 4DGEC 2EG5A 1YJ9P 2XGUA 1M6NA 1VQOP 2OTJP 1K9MQ 1M90Q 1KD1Q 5HGKA 2PEJA 2JYGA 3CCUP 3B5IA 3CC4P 4U0BA 1RNIA 2PEMA 3G1IA 1P7NA 2XDEA 2WLVB 1KQSO 2OARA 2P9XA 2PEOA 4GR2A 2JPRA 4WYMA 1QVGO 4XFZA 3CCVP 4XFXA 5BS1A 1M9XC 4LQWC 2L6EA 2QA4P 2X82A 2GOLB 4IPYA 1M9DC 2PWMA 4PH2A 5F2OA 2WLVA 1N8RQ 3M1MA 1YITP 5HGLA 2PEIA 2PWOA 3BP9A 4E91A 4DGAC 1VQLP 4HTWA 1D1DA 4U0AA 3G28A 1VQMP 3E2DA 5BS2A 1YJNP 3I56P 3H47A 2XXMA 3P05A 4INBA 2X83A 2E1MA 1ZMBA 3CCJP 1Q81Q 1A8OA 1BAJA 2JYLA 4U0DA 2BUOA 1M9EC 2PEKA 2KGFA 2Y4ZA 1IUQA 1RO2A 3CCQP 2M8LA 2XGYA 3H0DA 1M74A 3G4SP 2M8PA 1RO0A 1VQPP 1M9FC 2QEXP 4COPA 3WBHA 2LF4A 3HZQA 4PH0A 3CCRP 5F2KA 1YJWP 1EOQA 3G21A 1K30A 5F2NA 3G6EP 4U0FA 1W2BO 1VQ6P 2GONA 1U7KA 3DTJA 3NTEA 4M0IA 1M9YC 1M9CC 1YI2P 3RG6C 2PXRC 1VQ4P 2Z46A 1QRJA 4XRQA 3DS4A 1JJ2O 4XFYA 1L6NA 4GR6A 3I55P 3CCSP 1EIAA 1QVFO 5HGNA 5DCKA 3CCMP 3G71P 3DS0A 1YIJP 1M1KQ 3CCLP 4COCA 3DS5A 3LRYA 2Z44A 5JPAA 1E6JP 1S72P 1VQ9P 3VRLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QNB A;  4XRO A;  2XGV A;  1A43 A;  4J93 A;  3G0V A;  3G26 A;  2X2D D;  1AFV A;  3DS1 A;  4U0E A;  2JO0 A;  1AUM A;  3G29 A;  2XV6 A;  1EM9 A;  1G03 A;  5HGM A;  4E92 A;  4U0C A;  3MGE A;  2KOD A;  1GWP A;  3DS3 A;  3G1G A;  2EIA A;  4PH1 A;  4B4N A;  2ONT A;  2XT1 A;  1AK4 C;  2M8N A;  3DS2 A;  5I4T G;  3DPH A;  2V4X A;  4NX4 C;  4PH3 A;  5HGO A;  3H4E A;  4DGE C;  2XGU A;  5HGK A;  2JYG A;  4U0B A;  3G1I A;  1P7N A;  2XDE A;  2WLV B;  2JPR A;  4WYM A;  4XFZ A;  4XFX A;  1M9X C;  4LQW C;  2L6E A;  2X82 A;  2GOL B;  4IPY A;  1M9D C;  2PWM A;  4PH2 A;  2WLV A;  5HGL A;  2PWO A;  3BP9 A;  4E91 A;  4DGA C;  4HTW A;  1D1D A;  4U0A A;  3G28 A;  3H47 A;  2XXM A;  3P05 A;  4INB A;  2X83 A;  1A8O A;  1BAJ A;  2JYL A;  4U0D A;  2BUO A;  1M9E C;  2KGF A;  2Y4Z A;  2M8L A;  2XGY A;  2M8P A;  1M9F C;  4COP A;  2LF4 A;  4PH0 A;  1EOQ A;  3G21 A;  4U0F A;  2GON A;  1U7K A;  3DTJ A;  3NTE A;  4M0I A;  1M9Y C;  1M9C C;  2PXR C;  1QRJ A;  4XRQ A;  3DS4 A;  4XFY A;  1L6N A;  1EIA A;  5HGN A;  5DCK A;  3DS0 A;  4COC A;  3DS5 A;  3LRY A;  5JPA A;  1E6J P;  3VRL C; 
#chains in the Genus database with same CATH topology
 4XRO A;  4J93 A;  2JGP A;  1AFV A;  3CCE P;  4U0E A;  2FAE A;  2KGA A;  3G29 A;  1IMP A;  3GZL A;  5HGM A;  1Q86 Q;  1VKU A;  5CZD B;  2LIW A;  3G1G A;  1VQ8 P;  2N98 A;  2ONT A;  2DGY A;  1E0H A;  2PEQ A;  3CC7 P;  2EFJ A;  2CWO A;  2EG5 A;  2VLO A;  3GJN A;  2K0D X;  1K9M Q;  2CGQ A;  2JYG A;  3CC4 P;  3G1I A;  1P7N A;  3NY7 B;  2PEO A;  4PXH B;  4WYM A;  2KG8 A;  2ERH A;  2JU2 A;  1KLP A;  4H2X C;  2KGD A;  4IPY A;  5F2O A;  2WLV A;  4PWV B;  4UHP B;  1D1D A;  2GZE A;  3H47 A;  2X83 A;  2E1M A;  3CCJ P;  4U0D A;  1GPJ A;  1AYI A;  2KOR A;  2KOQ A;  3WBH A;  4R0M A;  4PH0 A;  4CA3 A;  1UNK A;  5F2K A;  1EOQ A;  3G21 A;  5F2N A;  1W2B O;  3DTJ A;  3NTE A;  2Z46 A;  2L0Q A;  2LL8 A;  4GR6 A;  3I55 P;  3CCS P;  1EIA A;  2CQ8 A;  1QVF O;  1HY8 A;  1T8K A;  4COC A;  3DS5 A;  2GZI A;  2Z44 A;  1S72 P;  3VRL C;  2MD9 A;  5HV8 A;  4QNB A;  3CPW O;  2PY8 A;  1VQ5 P;  2FVA A;  2XGV A;  3CMA P;  3CD6 P;  3DS1 A;  2K92 A;  1EM9 A;  2JB0 A;  2K93 A;  2L4B A;  2BHV A;  4IZ6 A;  1GWP A;  2M5R A;  4PH1 A;  7CEI A;  2XT1 A;  1AK4 C;  2WPT A;  2K0X A;  2LKI A;  2K0Y A;  2LIU A;  1YJ9 P;  2XGU A;  1M6N A;  2OTJ P;  4HKG A;  2PEJ A;  2ROQ A;  1RNI A;  1BXI A;  1UJZ A;  1KQS O;  2P9X A;  2VSQ A;  2JPR A;  4XFZ A;  3CCV P;  2KGC A;  2AF8 A;  2KG6 A;  4BPF A;  4PH2 A;  3EJE A;  1N8R Q;  1MZ8 A;  1YIT P;  1CEI A;  2PWO A;  1VQL P;  3RG2 A;  3G28 A;  1VQM P;  1YJN P;  2XXM A;  2BUO A;  2PNG A;  2KGF A;  2FVE A;  1RO2 A;  3CCQ P;  1M74 A;  2M8P A;  2FAC A;  4COP A;  3CCR P;  2AVA A;  3U43 A;  1U7K A;  2LML A;  4M0I A;  1M9C C;  1YI2 P;  2PXR C;  2MVU A;  1QRJ A;  3DS4 A;  1JJ2 O;  5HVC A;  2X2B A;  2FAD A;  1Z6M A;  1VQ9 P;  4F37 A;  5EJD A;  2K5X A;  1M6E X;  2KOS A;  2VLN A;  1A43 A;  1NJI Q;  1VQK P;  3CXC O;  3Q20 A;  1AUM A;  2JBG A;  1VQ7 P;  1HQB A;  2GDY A;  2KOD A;  1K73 Q;  3DS3 A;  2EIA A;  4B4N A;  1F80 D;  2PEN A;  2XZ0 D;  1K8A Q;  2LTE A;  2GZJ A;  3CME P;  2GDX A;  2M8N A;  3DS2 A;  2OTL P;  1ZNV A;  4PH3 A;  5HGO A;  3H4E A;  4DGE C;  2JQ4 A;  1VQO P;  3B5I A;  1L0I A;  2N6Y A;  2PEM A;  2WLV B;  4QKO A;  2K2Q A;  1M9D C;  3M1M A;  2MR8 A;  5HGL A;  4DGA C;  4U0A A;  4DG9 A;  3E2D A;  5KP8 B;  4INB A;  2MVV A;  1ZMB A;  1A8O A;  1BAJ A;  2JYL A;  2LPK A;  1M9E C;  2Y4Z A;  2N50 A;  2FQ0 A;  2LF4 A;  1DV5 A;  3LMO A;  1YJW P;  3G6E P;  2GON A;  3RG6 C;  1VQ4 P;  1GXG A;  4XRQ A;  2NO8 A;  4H2W C;  1ACP A;  5HGN A;  5DCK A;  3G71 P;  1M1K Q;  3CCL P;  4NEO A;  5JPA A;  1L0H A;  2MR7 A;  2CNR A;  4BPH A;  1Q82 Q;  2LOL A;  3HYB A;  2KG9 A;  1DNY A;  3G0V A;  3G26 A;  5KP6 B;  2X2D D;  1VQN P;  2N5H A;  2JO0 A;  2VLP A;  2XV6 A;  3OW2 O;  1X3O A;  1G03 A;  2QNW A;  4E92 A;  4U0C A;  3MGE A;  1Q7Y Q;  1YHQ P;  3CC2 P;  1KC8 Q;  2FVF A;  1AF8 A;  2XZ1 C;  2FQ2 A;  2Z45 A;  4MRT C;  5I4T G;  2N6Z A;  3DPH A;  2V4X A;  4NX4 C;  2VLQ A;  2EHT A;  1M90 Q;  1KD1 Q;  5HGK A;  2EHS A;  2L9F A;  3CCU P;  4U0B A;  2XDE A;  2L22 A;  1FR2 A;  2OAR A;  4GR2 A;  2KR5 A;  3B4Q A;  1QVG O;  4XFX A;  5BS1 A;  1M9X C;  4LQW C;  2L6E A;  2QA4 P;  2X82 A;  2GOL B;  2PWM A;  4H2Y C;  1EMV A;  2PEI A;  2FQ1 A;  3BP9 A;  4E91 A;  2AFE A;  5KP7 B;  4HTW A;  1IMQ A;  2GZF A;  2KOP A;  1OR5 A;  5BS2 A;  2K94 A;  4BPG A;  3I56 P;  3P05 A;  1VHN A;  2KGE A;  1Q81 Q;  2DNW A;  2PEK A;  2CG5 B;  2AFD A;  1IUQ A;  2M8L A;  5EW5 E;  2XGY A;  3H0D A;  3G4S P;  1RO0 A;  1VQP P;  1M9F C;  3GZM A;  2QEX P;  3HZQ A;  1NQ4 A;  2GYK A;  3GKL C;  2GDW A;  1K30 A;  1GXH A;  4U0F A;  1VQ6 P;  1M9Y C;  2MF4 A;  2JAZ A;  2KWL A;  4XFY A;  1L6N A;  2N5I A;  3CCM P;  2MY5 A;  2FHS C;  2KOO A;  3DS0 A;  1YIJ P;  2KW2 A;  3LRY A;  3EJB A;  3EJD A;  2JU1 A;  1E6J P;  2GZG A;  3CE7 A; 
#chains in the Genus database with same CATH homology
 4QNB A;  3CPW O;  2PY8 A;  1VQ5 P;  1Q82 Q;  4XRO A;  1M6E X;  3HYB A;  2XGV A;  1A43 A;  3CMA P;  1NJI Q;  4J93 A;  1VQK P;  3G0V A;  3G26 A;  2X2D D;  3CXC O;  1AFV A;  3DS1 A;  3CCE P;  1VQN P;  4U0E A;  3CD6 P;  3Q20 A;  2JO0 A;  1AUM A;  3G29 A;  2XV6 A;  3OW2 O;  1VQ7 P;  1EM9 A;  1G03 A;  5HGM A;  1Q86 Q;  4E92 A;  4U0C A;  3MGE A;  2BHV A;  2KOD A;  1GWP A;  1Q7Y Q;  3DS3 A;  3G1G A;  1K73 Q;  1VQ8 P;  2EIA A;  4PH1 A;  4B4N A;  1YHQ P;  3CC2 P;  2ONT A;  1KC8 Q;  2DGY A;  2PEN A;  1K8A Q;  2XT1 A;  3CME P;  2Z45 A;  1AK4 C;  2M8N A;  2PEQ A;  3DS2 A;  3DPH A;  5I4T G;  2OTL P;  2V4X A;  3CC7 P;  4NX4 C;  2EFJ A;  2CWO A;  4PH3 A;  5HGO A;  3H4E A;  4DGE C;  2EG5 A;  1YJ9 P;  2XGU A;  1M6N A;  1VQO P;  2OTJ P;  1K9M Q;  1M90 Q;  1KD1 Q;  5HGK A;  2PEJ A;  2JYG A;  3CCU P;  3B5I A;  3CC4 P;  4U0B A;  1RNI A;  2PEM A;  3G1I A;  1P7N A;  2XDE A;  2WLV B;  1KQS O;  2OAR A;  2P9X A;  2PEO A;  4GR2 A;  2JPR A;  4WYM A;  1QVG O;  4XFZ A;  3CCV P;  4XFX A;  5BS1 A;  1M9X C;  4LQW C;  2L6E A;  2QA4 P;  2X82 A;  2GOL B;  4IPY A;  1M9D C;  2PWM A;  4PH2 A;  5F2O A;  2WLV A;  1N8R Q;  3M1M A;  1YIT P;  5HGL A;  2PEI A;  2PWO A;  3BP9 A;  4E91 A;  4DGA C;  1VQL P;  4HTW A;  1D1D A;  4U0A A;  3G28 A;  1VQM P;  3E2D A;  5BS2 A;  1YJN P;  3I56 P;  3H47 A;  2XXM A;  3P05 A;  4INB A;  2X83 A;  2E1M A;  1ZMB A;  3CCJ P;  1Q81 Q;  1A8O A;  1BAJ A;  2JYL A;  4U0D A;  2BUO A;  1M9E C;  2PEK A;  2KGF A;  2Y4Z A;  1IUQ A;  1RO2 A;  3CCQ P;  2M8L A;  2XGY A;  3H0D A;  1M74 A;  3G4S P;  2M8P A;  1RO0 A;  1VQP P;  1M9F C;  2QEX P;  4COP A;  3WBH A;  2LF4 A;  3HZQ A;  4PH0 A;  3CCR P;  5F2K A;  1YJW P;  1EOQ A;  3G21 A;  1K30 A;  5F2N A;  3G6E P;  4U0F A;  1W2B O;  1VQ6 P;  2GON A;  1U7K A;  3DTJ A;  3NTE A;  4M0I A;  1M9Y C;  1M9C C;  1YI2 P;  3RG6 C;  2PXR C;  1VQ4 P;  2Z46 A;  1QRJ A;  4XRQ A;  3DS4 A;  1JJ2 O;  4XFY A;  1L6N A;  4GR6 A;  3I55 P;  3CCS P;  1EIA A;  1QVF O;  5HGN A;  5DCK A;  3CCM P;  3G71 P;  3DS0 A;  1YIJ P;  1M1K Q;  3CCL P;  4COC A;  3DS5 A;  3LRY A;  2Z44 A;  5JPA A;  1E6J P;  1S72 P;  1VQ9 P;  3VRL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...