1EIAA

X-ray crystal structure of equine infectious anemia virus (eiav) capsid protein p26
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
207
structure length
207
Chain Sequence
TPRGYTTWVNTIQTNGLLNEASQNLFGILSVDCTSEEMNAFLDVVPGQAGQKQILLDAIDKIADDWDNRHPLPNAPLVAPPQGPIPMTARFIRGLGVPRERQMEPAFDQFRQTYRQWIIEAMSEGIKVMIGKPKAQNIRQGAKEPYPEFVDRLLSQIKSEGHPQEISKFLTDTLTIQNANEECRNAMRHLRPEDTLEEKMYACRDIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EIAV CAPSID PROTEIN P26
publication title Model for lentivirus capsid core assembly based on crystal dimers of EIAV p26.
pubmed doi rcsb
source organism Equine infectious anemia virus
molecule tags Viral protein
total genus 77
structure length 207
sequence length 207
ec nomenclature
pdb deposition date 1998-07-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 1eiaA01
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 1eiaA02
2Y4ZA 3BP9A 3G21A 2M8PA 3LRYA 1M9XC 2M8NA 4U0CA 3DS4A 1U7KA 3H4EA 4DGAC 4J93A 1M9EC 4U0AA 1D1DA 4B4NA 1AK4C 4INBA 4U0FA 5DCKA 1E6JP 2M8LA 2GOLB 2JYLA 4XFYA 3G28A 1EOQA 1EIAA 1M9YC 1BAJA 2WLVB 4HTWA 3G1IA 3MGEA 1M9FC 4PH1A 1AFVA 2JYGA 4DGEC 2XV6A 2WLVA 4U0BA 2XDEA 3DTJA 4IPYA 5HGMA 1A8OA 2X83A 4XFXA 1M9DC 3DS5A 1A43A 4PH2A 5JPAA 4COPA 4COCA 5I4TG 2LF4A 2PWOA 1QRJA 5HGNA 2JO0A 2XGVA 1L6NA 2X2DD 3DPHA 2XT1A 5HGOA 2BUOA 4E91A 2XGYA 4U0DA 3G1GA 4M0IA 2X82A 4XFZA 2XGUA 4QNBA 5HGKA 4PH3A 3DS0A 2KODA 4LQWC 2KGFA 4U0EA 4XROA 4E92A 3H47A 3DS2A 1G03A 2PXRC 3NTEA 4XRQA 3G26A 4PH0A 2PWMA 4WYMA 1M9CC 3VRLC 1EM9A 1GWPA 2L6EA 3G29A 2EIAA 4NX4C 2JPRA 3P05A 2ONTA 1AUMA 2XXMA 3DS1A 3DS3A 1P7NA 3G0VA 2GONA 2V4XA 5HGLA
chains in the Genus database with same CATH superfamily
5HVCA 2M8PA 3LRYA 1M9XC 2EG5A 2MVVA 1U7KA 3GZMA 3CCMP 4B4NA 4U0FA 1JJ2O 2L22A 5DCKA 4HKGA 3CCQP 2JU2A 1ZMBA 3GKLC 2PEQA 1GPJA 2GDWA 2JYLA 1EIAA 1N8RQ 1M9YC 2MY5A 2K0YA 3CPWO 2KGDA 4HTWA 2CG5B 2PEOA 2KOPA 2K2QA 1AFVA 3CC2P 2JU1A 4DGEC 1IMPA 4MRTC 2XDEA 4IPYA 2GZGA 2JB0A 3CC7P 1A43A 4COPA 5I4TG 2ROQA 2NO8A 1Q82Q 2KGEA 2PEMA 2XGYA 4U0DA 2GDXA 4IZ6A 2LMLA 1KD1Q 2GZFA 4XFZA 3NY7B 2JAZA 2FACA 2GZIA 1DNYA 4QNBA 5HGKA 1QVFO 3CE7A 2XZ1C 5EW5E 1FR2A 1KC8Q 1IUQA 3B5IA 1M9CC 4F37A 1DV5A 2ERHA 1GWPA 3G29A 4NX4C 3P05A 2LIUA 2ONTA 1OR5A 2XXMA 3DS1A 2KORA 2KOQA 1L0IA 2PEIA 1K8AQ 1M1KQ 1P7NA 2PEKA 3CMAP 2JBGA 2VLNA 2KG6A 2FAEA 3WBHA 2KG9A 2K5XA 3HYBA 1AYIA 1D1DA 2AFDA 2K0DX 4INBA 1YITP 2N98A 1E6JP 2M8LA 1YJWP 2LL8A 2Z45A 4R0MA 4XFYA 2EHSA 2MVUA 3G4SP 2Z44A 1VQNP 2K92A 1NJIQ 2FADA 3HZQA 2XV6A 2FVEA 2Z46A 2X2BA 5KP7B 1VQLP 2N5HA 3OW2O 3DS5A 3CD6P 5JPAA 4COCA 2K93A 3B4QA 2LF4A 5HV8A 2PEJA 1QVGO 5HGNA 2DGYA 3RG6C 1VQ5P 2XGVA 1L6NA 3DPHA 3CCRP 3H0DA 4E91A 3GJNA 4M0IA 2VLQA 2XGUA 4PH3A 2KGFA 4XROA 3H47A 2WPTA 2MR8A 2PXRC 2AFEA 2PY8A 3I55P 2FHSC 2K0XA 4XRQA 2L9FA 3G26A 3U43A 5F2KA 1GXHA 1IMQA 4NEOA 1RNIA 2OTLP 4BPFA 3DS3A 3CCEP 1VQ9P 3CCVP 3M1MA 1Q7YQ 2Y4ZA 2EFJA 3BP9A 4PWVB 1E0HA 3I56P 4U0CA 1YI2P 4PXHB 2KWLA 1AK4C 3EJDA 2AVAA 1S72P 1VQMP 2GOLB 1M6NA 5CZDB 3E2DA 1KQSO 3CCLP 2CNRA 4GR6A 1EOQA 1BAJA 1RO2A 1VQPP 1EMVA 1M9FC 4PH1A 1W2BO 2JGPA 2VSQA 3EJEA 4U0BA 2KOOA 4QKOA 1NQ4A 5HGMA 3CCJP 1A8OA 2KG8A 2QEXP 2VLOA 2MD9A 3GZLA 4UHPB 1F80D 2N6YA 1QRJA 3CCUP 2X2DD 2OTJP 5HGOA 2BUOA 1AF8A 1VQOP 2AF8A 1HY8A 1VQ8P 3G1GA 2P9XA 1HQBA 2FQ2A 4H2YC 1K9MQ 2MR7A 5BS1A 2KODA 4E92A 5KP8B 3EJBA 3LMOA 2BHVA 2MF4A 2GZJA 4PH0A 2PWMA 4WYMA 2LPKA 4H2XC 2KGCA 2L6EA 2GYKA 2OARA 2KR5A 1M90Q 2FQ0A 5KP6B 2N50A 3RG2A 1YJ9P 2M5RA 3G0VA 1CEIA 2GONA 2V4XA 5HGLA 1RO0A 3G21A 2DNWA 2N6ZA 3CXCO 2LKIA 2M8NA 2CQ8A 3DS4A 3H4EA 7CEIA 1VQ7P 4DGAC 2GDYA 1YJNP 1BXIA 4J93A 1M9EC 4U0AA 1YHQP 2FVFA 2KOSA 2JQ4A 3Q20A 1VQKP 1K73Q 1Q81Q 1Q86Q 5EJDA 1GXGA 4GR2A 3G28A 3CMEP 2WLVB 3G1IA 3MGEA 1KLPA 1UJZA 2GZEA 2JYGA 1L0HA 5F2OA 2LIWA 3CC4P 2WLVA 2K94A 2LOLA 3DTJA 1VQ6P 2FVAA 3CCSP 2X83A 1ACPA 4H2WC 4XFXA 2FQ1A 1M9DC 2L4BA 4PH2A 1VQ4P 2PWOA 4CA3A 2JO0A 1X3OA 2XT1A 4BPHA 1Z6MA 1MZ8A 2N5IA 1UNKA 2X82A 2CWOA 3G71P 3DS0A 5F2NA 4LQWC 4U0EA 1M74A 2LTEA 2PNGA 3DS2A 1G03A 2VLPA 2KW2A 2E1MA 2QNWA 1K30A 3NTEA 4BPGA 5BS2A 2QA4P 2XZ0D 3VRLC 4DG9A 1VHNA 1ZNVA 2PENA 1EM9A 1VKUA 2EIAA 2CGQA 2JPRA 1T8KA 3G6EP 1YIJP 1AUMA 1M6EX 2L0QA 2KGAA 2EHTA
chains in the Genus database with same CATH topology
2Y4ZA 1RO0A 2EFJA 3BP9A 3G21A 2M8PA 3LRYA 1M9XC 3CXCO 3I56P 2M8NA 4U0CA 2EG5A 3DS4A 1YI2P 3WBHA 1U7KA 3H4EA 1VQ7P 4DGAC 3HYBA 1YJNP 4J93A 1M9EC 4U0AA 3CCMP 1YHQP 1D1DA 1VQ9P 4B4NA 1AK4C 4INBA 1YITP 4U0FA 3CMAP 5DCKA 1JJ2O 1E6JP 2M8LA 3Q20A 1VQMP 3CCQP 1YJWP 1ZMBA 1S72P 1K73Q 1VQKP 2GOLB 1Q81Q 2PEQA 1Q86Q 1M6NA 2Z45A 2JYLA 3E2DA 1KQSO 3CCLP 4GR2A 4XFYA 3G28A 4GR6A 1EOQA 1EIAA 1N8RQ 1M9YC 1BAJA 1RO2A 3CMEP 2WLVB 3CPWO 1VQPP 3G4SP 4HTWA 2Z44A 3MGEA 3G1IA 1VQNP 1M9FC 2PEOA 4PH1A 1NJIQ 1AFVA 3HZQA 3CC2P 1W2BO 2JYGA 5F2OA 4DGEC 3CC4P 2XV6A 2WLVA 2Z46A 1VQLP 4U0BA 2XDEA 3DTJA 4IPYA 1VQ6P 5HGMA 3CCJP 1A8OA 3CCSP 2X83A 2QEXP 4XFXA 3CC7P 3OW2O 1M9DC 3DS5A 3CD6P 1A43A 4PH2A 5JPAA 4COPA 1VQ4P 4COCA 5I4TG 2LF4A 2PWOA 1QRJA 2PEJA 1QVGO 3CCUP 5HGNA 2DGYA 2JO0A 3RG6C 1VQ5P 2XGVA 1L6NA 2X2DD 3DPHA 3CCRP 2OTJP 2XT1A 3H0DA 5HGOA 2BUOA 4E91A 1Q82Q 2PEMA 1VQOP 2XGYA 4U0DA 1VQ8P 3G1GA 4M0IA 2X82A 1KD1Q 4XFZA 2XGUA 2P9XA 1K9MQ 2CWOA 3G71P 4QNBA 5HGKA 4PH3A 3DS0A 5BS1A 5F2NA 2KODA 4LQWC 2KGFA 4U0EA 4XROA 1M74A 4E92A 3H47A 1QVFO 3DS2A 1G03A 2PXRC 2PY8A 3I55P 2BHVA 2E1MA 1K30A 3NTEA 4XRQA 3G26A 1IUQA 5BS2A 4PH0A 2PWMA 2QA4P 3B5IA 1KC8Q 5F2KA 4WYMA 1M9CC 3VRLC 2PENA 1EM9A 1GWPA 2L6EA 2OARA 3G29A 1M90Q 2EIAA 4NX4C 2JPRA 3P05A 2ONTA 3G6EP 1RNIA 1AUMA 1YIJP 1M6EX 2XXMA 2OTLP 3DS1A 1YJ9P 3DS3A 2PEIA 1K8AQ 1M1KQ 3CCEP 1P7NA 3G0VA 2PEKA 2GONA 2V4XA 5HGLA 3CCVP 3M1MA 1Q7YQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y4Z A;  3BP9 A;  3G21 A;  2M8P A;  3LRY A;  1M9X C;  2M8N A;  4U0C A;  3DS4 A;  1U7K A;  3H4E A;  4DGA C;  4J93 A;  1M9E C;  4U0A A;  1D1D A;  4B4N A;  1AK4 C;  4INB A;  4U0F A;  5DCK A;  1E6J P;  2M8L A;  2GOL B;  2JYL A;  4XFY A;  3G28 A;  1EOQ A;  1EIA A;  1M9Y C;  1BAJ A;  2WLV B;  4HTW A;  3G1I A;  3MGE A;  1M9F C;  4PH1 A;  1AFV A;  2JYG A;  4DGE C;  2XV6 A;  2WLV A;  4U0B A;  2XDE A;  3DTJ A;  4IPY A;  5HGM A;  1A8O A;  2X83 A;  4XFX A;  1M9D C;  3DS5 A;  1A43 A;  4PH2 A;  5JPA A;  4COP A;  4COC A;  5I4T G;  2LF4 A;  2PWO A;  1QRJ A;  5HGN A;  2JO0 A;  2XGV A;  1L6N A;  2X2D D;  3DPH A;  2XT1 A;  5HGO A;  2BUO A;  4E91 A;  2XGY A;  4U0D A;  3G1G A;  4M0I A;  2X82 A;  4XFZ A;  2XGU A;  4QNB A;  5HGK A;  4PH3 A;  3DS0 A;  2KOD A;  4LQW C;  2KGF A;  4U0E A;  4XRO A;  4E92 A;  3H47 A;  3DS2 A;  1G03 A;  2PXR C;  3NTE A;  4XRQ A;  3G26 A;  4PH0 A;  2PWM A;  4WYM A;  1M9C C;  3VRL C;  1EM9 A;  1GWP A;  2L6E A;  3G29 A;  2EIA A;  4NX4 C;  2JPR A;  3P05 A;  2ONT A;  1AUM A;  2XXM A;  3DS1 A;  3DS3 A;  1P7N A;  3G0V A;  2GON A;  2V4X A;  5HGL A; 
#chains in the Genus database with same CATH topology
 5HVC A;  2M8P A;  3LRY A;  1M9X C;  2EG5 A;  2MVV A;  1U7K A;  3GZM A;  3CCM P;  4B4N A;  4U0F A;  1JJ2 O;  2L22 A;  5DCK A;  4HKG A;  3CCQ P;  2JU2 A;  1ZMB A;  3GKL C;  2PEQ A;  1GPJ A;  2GDW A;  2JYL A;  1EIA A;  1N8R Q;  1M9Y C;  2MY5 A;  2K0Y A;  3CPW O;  2KGD A;  4HTW A;  2CG5 B;  2PEO A;  2KOP A;  2K2Q A;  1AFV A;  3CC2 P;  2JU1 A;  4DGE C;  1IMP A;  4MRT C;  2XDE A;  4IPY A;  2GZG A;  2JB0 A;  3CC7 P;  1A43 A;  4COP A;  5I4T G;  2ROQ A;  2NO8 A;  1Q82 Q;  2KGE A;  2PEM A;  2XGY A;  4U0D A;  2GDX A;  4IZ6 A;  2LML A;  1KD1 Q;  2GZF A;  4XFZ A;  3NY7 B;  2JAZ A;  2FAC A;  2GZI A;  1DNY A;  4QNB A;  5HGK A;  1QVF O;  3CE7 A;  2XZ1 C;  5EW5 E;  1FR2 A;  1KC8 Q;  1IUQ A;  3B5I A;  1M9C C;  4F37 A;  1DV5 A;  2ERH A;  1GWP A;  3G29 A;  4NX4 C;  3P05 A;  2LIU A;  2ONT A;  1OR5 A;  2XXM A;  3DS1 A;  2KOR A;  2KOQ A;  1L0I A;  2PEI A;  1K8A Q;  1M1K Q;  1P7N A;  2PEK A;  3CMA P;  2JBG A;  2VLN A;  2KG6 A;  2FAE A;  3WBH A;  2KG9 A;  2K5X A;  3HYB A;  1AYI A;  1D1D A;  2AFD A;  2K0D X;  4INB A;  1YIT P;  2N98 A;  1E6J P;  2M8L A;  1YJW P;  2LL8 A;  2Z45 A;  4R0M A;  4XFY A;  2EHS A;  2MVU A;  3G4S P;  2Z44 A;  1VQN P;  2K92 A;  1NJI Q;  2FAD A;  3HZQ A;  2XV6 A;  2FVE A;  2Z46 A;  2X2B A;  5KP7 B;  1VQL P;  2N5H A;  3OW2 O;  3DS5 A;  3CD6 P;  5JPA A;  4COC A;  2K93 A;  3B4Q A;  2LF4 A;  5HV8 A;  2PEJ A;  1QVG O;  5HGN A;  2DGY A;  3RG6 C;  1VQ5 P;  2XGV A;  1L6N A;  3DPH A;  3CCR P;  3H0D A;  4E91 A;  3GJN A;  4M0I A;  2VLQ A;  2XGU A;  4PH3 A;  2KGF A;  4XRO A;  3H47 A;  2WPT A;  2MR8 A;  2PXR C;  2AFE A;  2PY8 A;  3I55 P;  2FHS C;  2K0X A;  4XRQ A;  2L9F A;  3G26 A;  3U43 A;  5F2K A;  1GXH A;  1IMQ A;  4NEO A;  1RNI A;  2OTL P;  4BPF A;  3DS3 A;  3CCE P;  1VQ9 P;  3CCV P;  3M1M A;  1Q7Y Q;  2Y4Z A;  2EFJ A;  3BP9 A;  4PWV B;  1E0H A;  3I56 P;  4U0C A;  1YI2 P;  4PXH B;  2KWL A;  1AK4 C;  3EJD A;  2AVA A;  1S72 P;  1VQM P;  2GOL B;  1M6N A;  5CZD B;  3E2D A;  1KQS O;  3CCL P;  2CNR A;  4GR6 A;  1EOQ A;  1BAJ A;  1RO2 A;  1VQP P;  1EMV A;  1M9F C;  4PH1 A;  1W2B O;  2JGP A;  2VSQ A;  3EJE A;  4U0B A;  2KOO A;  4QKO A;  1NQ4 A;  5HGM A;  3CCJ P;  1A8O A;  2KG8 A;  2QEX P;  2VLO A;  2MD9 A;  3GZL A;  4UHP B;  1F80 D;  2N6Y A;  1QRJ A;  3CCU P;  2X2D D;  2OTJ P;  5HGO A;  2BUO A;  1AF8 A;  1VQO P;  2AF8 A;  1HY8 A;  1VQ8 P;  3G1G A;  2P9X A;  1HQB A;  2FQ2 A;  4H2Y C;  1K9M Q;  2MR7 A;  5BS1 A;  2KOD A;  4E92 A;  5KP8 B;  3EJB A;  3LMO A;  2BHV A;  2MF4 A;  2GZJ A;  4PH0 A;  2PWM A;  4WYM A;  2LPK A;  4H2X C;  2KGC A;  2L6E A;  2GYK A;  2OAR A;  2KR5 A;  1M90 Q;  2FQ0 A;  5KP6 B;  2N50 A;  3RG2 A;  1YJ9 P;  2M5R A;  3G0V A;  1CEI A;  2GON A;  2V4X A;  5HGL A;  1RO0 A;  3G21 A;  2DNW A;  2N6Z A;  3CXC O;  2LKI A;  2M8N A;  2CQ8 A;  3DS4 A;  3H4E A;  7CEI A;  1VQ7 P;  4DGA C;  2GDY A;  1YJN P;  1BXI A;  4J93 A;  1M9E C;  4U0A A;  1YHQ P;  2FVF A;  2KOS A;  2JQ4 A;  3Q20 A;  1VQK P;  1K73 Q;  1Q81 Q;  1Q86 Q;  5EJD A;  1GXG A;  4GR2 A;  3G28 A;  3CME P;  2WLV B;  3G1I A;  3MGE A;  1KLP A;  1UJZ A;  2GZE A;  2JYG A;  1L0H A;  5F2O A;  2LIW A;  3CC4 P;  2WLV A;  2K94 A;  2LOL A;  3DTJ A;  1VQ6 P;  2FVA A;  3CCS P;  2X83 A;  1ACP A;  4H2W C;  4XFX A;  2FQ1 A;  1M9D C;  2L4B A;  4PH2 A;  1VQ4 P;  2PWO A;  4CA3 A;  2JO0 A;  1X3O A;  2XT1 A;  4BPH A;  1Z6M A;  1MZ8 A;  2N5I A;  1UNK A;  2X82 A;  2CWO A;  3G71 P;  3DS0 A;  5F2N A;  4LQW C;  4U0E A;  1M74 A;  2LTE A;  2PNG A;  3DS2 A;  1G03 A;  2VLP A;  2KW2 A;  2E1M A;  2QNW A;  1K30 A;  3NTE A;  4BPG A;  5BS2 A;  2QA4 P;  2XZ0 D;  3VRL C;  4DG9 A;  1VHN A;  1ZNV A;  2PEN A;  1EM9 A;  1VKU A;  2EIA A;  2CGQ A;  2JPR A;  1T8K A;  3G6E P;  1YIJ P;  1AUM A;  1M6E X;  2L0Q A;  2KGA A;  2EHT A; 
#chains in the Genus database with same CATH homology
 2Y4Z A;  1RO0 A;  2EFJ A;  3BP9 A;  3G21 A;  2M8P A;  3LRY A;  1M9X C;  3CXC O;  3I56 P;  2M8N A;  4U0C A;  2EG5 A;  3DS4 A;  1YI2 P;  3WBH A;  1U7K A;  3H4E A;  1VQ7 P;  4DGA C;  3HYB A;  1YJN P;  4J93 A;  1M9E C;  4U0A A;  3CCM P;  1YHQ P;  1D1D A;  1VQ9 P;  4B4N A;  1AK4 C;  4INB A;  1YIT P;  4U0F A;  3CMA P;  5DCK A;  1JJ2 O;  1E6J P;  2M8L A;  3Q20 A;  1VQM P;  3CCQ P;  1YJW P;  1ZMB A;  1S72 P;  1K73 Q;  1VQK P;  2GOL B;  1Q81 Q;  2PEQ A;  1Q86 Q;  1M6N A;  2Z45 A;  2JYL A;  3E2D A;  1KQS O;  3CCL P;  4GR2 A;  4XFY A;  3G28 A;  4GR6 A;  1EOQ A;  1EIA A;  1N8R Q;  1M9Y C;  1BAJ A;  1RO2 A;  3CME P;  2WLV B;  3CPW O;  1VQP P;  3G4S P;  4HTW A;  2Z44 A;  3MGE A;  3G1I A;  1VQN P;  1M9F C;  2PEO A;  4PH1 A;  1NJI Q;  1AFV A;  3HZQ A;  3CC2 P;  1W2B O;  2JYG A;  5F2O A;  4DGE C;  3CC4 P;  2XV6 A;  2WLV A;  2Z46 A;  1VQL P;  4U0B A;  2XDE A;  3DTJ A;  4IPY A;  1VQ6 P;  5HGM A;  3CCJ P;  1A8O A;  3CCS P;  2X83 A;  2QEX P;  4XFX A;  3CC7 P;  3OW2 O;  1M9D C;  3DS5 A;  3CD6 P;  1A43 A;  4PH2 A;  5JPA A;  4COP A;  1VQ4 P;  4COC A;  5I4T G;  2LF4 A;  2PWO A;  1QRJ A;  2PEJ A;  1QVG O;  3CCU P;  5HGN A;  2DGY A;  2JO0 A;  3RG6 C;  1VQ5 P;  2XGV A;  1L6N A;  2X2D D;  3DPH A;  3CCR P;  2OTJ P;  2XT1 A;  3H0D A;  5HGO A;  2BUO A;  4E91 A;  1Q82 Q;  2PEM A;  1VQO P;  2XGY A;  4U0D A;  1VQ8 P;  3G1G A;  4M0I A;  2X82 A;  1KD1 Q;  4XFZ A;  2XGU A;  2P9X A;  1K9M Q;  2CWO A;  3G71 P;  4QNB A;  5HGK A;  4PH3 A;  3DS0 A;  5BS1 A;  5F2N A;  2KOD A;  4LQW C;  2KGF A;  4U0E A;  4XRO A;  1M74 A;  4E92 A;  3H47 A;  1QVF O;  3DS2 A;  1G03 A;  2PXR C;  2PY8 A;  3I55 P;  2BHV A;  2E1M A;  1K30 A;  3NTE A;  4XRQ A;  3G26 A;  1IUQ A;  5BS2 A;  4PH0 A;  2PWM A;  2QA4 P;  3B5I A;  1KC8 Q;  5F2K A;  4WYM A;  1M9C C;  3VRL C;  2PEN A;  1EM9 A;  1GWP A;  2L6E A;  2OAR A;  3G29 A;  1M90 Q;  2EIA A;  4NX4 C;  2JPR A;  3P05 A;  2ONT A;  3G6E P;  1RNI A;  1AUM A;  1YIJ P;  1M6E X;  2XXM A;  2OTL P;  3DS1 A;  1YJ9 P;  3DS3 A;  2PEI A;  1K8A Q;  1M1K Q;  3CCE P;  1P7N A;  3G0V A;  2PEK A;  2GON A;  2V4X A;  5HGL A;  3CCV P;  3M1M A;  1Q7Y Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...