2GONA

Xray structure of gag133-278
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
135
structure length
127
Chain Sequence
HQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords Capsid protein p24 (CA)
publication title Implications for Viral Capsid Assembly from Crystal Structures of HIV-1 Gag 1-278 and CAN 133-278.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 41
structure length 127
sequence length 135
chains with identical sequence B, C, D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2006-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 2gonA00
1P7NA 1M9YC 2PXRC 4PH0A 4DGEC 1AK4C 2GOLB 1U7KA 2V4XA 2XDEA 1EIAA 4U0AA 2XGYA 1G03A 1QRJA 2X2DD 1L6NA 3NTEA 2M8NA 4U0BA 4U0CA 1M9CC 2PWMA 3BP9A 2X83A 1E6JP 1M9XC 4U0DA 3H47A 2JPRA 2Y4ZA 4E92A 4U0EA 4U0FA 4WYMA 1M9DC 4E91A 2WLVB 4INBA 2M8PA 4XFZA 4XROA 5HGKA 2GONA 1D1DA 5JPAA 4LQWC 3H4EA 2PWOA 4J93A 4PH3A 2KGFA 2LF4A 2WLVA 5HGOA 5HGLA 1M9EC 4XRQA 4B4NA 4XFYA 4NX4C 3MGEA 1EM9A 5HGMA 5HGNA 4PH2A 2M8LA 4HTWA 4QNBA 1AFVA 2EIAA 4DGAC 2XGVA 4XFXA 2X82A 1M9FC 2XGUA 1GWPA 3P05A
chains in the Genus database with same CATH superfamily
1P7NA 1M9YC 2PXRC 4PH0A 4DGEC 1AK4C 2GOLB 1U7KA 2V4XA 2XDEA 1EIAA 4U0AA 2XGYA 1G03A 1QRJA 2X2DD 1L6NA 3NTEA 2M8NA 4U0BA 4U0CA 1M9CC 2PWMA 3BP9A 2X83A 1E6JP 1M9XC 4U0DA 3H47A 2JPRA 2Y4ZA 4E92A 4U0EA 4U0FA 4WYMA 1M9DC 4E91A 2WLVB 4INBA 2M8PA 4XFZA 4XROA 5HGKA 2GONA 1D1DA 5JPAA 4LQWC 3H4EA 2PWOA 4J93A 4PH3A 2KGFA 2LF4A 2WLVA 5HGOA 5HGLA 1M9EC 4XRQA 4B4NA 4XFYA 4NX4C 3MGEA 1EM9A 5HGMA 5HGNA 4PH2A 2M8LA 4HTWA 4QNBA 1AFVA 2EIAA 4DGAC 2XGVA 4XFXA 2X82A 1M9FC 2XGUA 1GWPA 3P05A
chains in the Genus database with same CATH topology
1P7NA 1M9YC 2PXRC 4PH0A 4DGEC 1AK4C 2GOLB 1U7KA 2V4XA 2XDEA 1EIAA 4U0AA 2XGYA 1G03A 1QRJA 2X2DD 1L6NA 3NTEA 2M8NA 4U0BA 4U0CA 1M9CC 2PWMA 3BP9A 2X83A 1E6JP 1M9XC 4U0DA 3H47A 2JPRA 2Y4ZA 4E92A 4U0EA 4U0FA 4WYMA 1M9DC 4E91A 2WLVB 4INBA 2M8PA 4XFZA 4XROA 5HGKA 2GONA 1D1DA 5JPAA 4LQWC 3H4EA 2PWOA 4J93A 4PH3A 2KGFA 2LF4A 2WLVA 5HGOA 5HGLA 1M9EC 4XRQA 4B4NA 4XFYA 4NX4C 3MGEA 1EM9A 5HGMA 5HGNA 4PH2A 2M8LA 4HTWA 4QNBA 1AFVA 2EIAA 4DGAC 2XGVA 4XFXA 2X82A 1M9FC 2XGUA 1GWPA 3P05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P7N A;  1M9Y C;  2PXR C;  4PH0 A;  4DGE C;  1AK4 C;  2GOL B;  1U7K A;  2V4X A;  2XDE A;  1EIA A;  4U0A A;  2XGY A;  1G03 A;  1QRJ A;  2X2D D;  1L6N A;  3NTE A;  2M8N A;  4U0B A;  4U0C A;  1M9C C;  2PWM A;  3BP9 A;  2X83 A;  1E6J P;  1M9X C;  4U0D A;  3H47 A;  2JPR A;  2Y4Z A;  4E92 A;  4U0E A;  4U0F A;  4WYM A;  1M9D C;  4E91 A;  2WLV B;  4INB A;  2M8P A;  4XFZ A;  4XRO A;  5HGK A;  2GON A;  1D1D A;  5JPA A;  4LQW C;  3H4E A;  2PWO A;  4J93 A;  4PH3 A;  2KGF A;  2LF4 A;  2WLV A;  5HGO A;  5HGL A;  1M9E C;  4XRQ A;  4B4N A;  4XFY A;  4NX4 C;  3MGE A;  1EM9 A;  5HGM A;  5HGN A;  4PH2 A;  2M8L A;  4HTW A;  4QNB A;  1AFV A;  2EIA A;  4DGA C;  2XGV A;  4XFX A;  2X82 A;  1M9F C;  2XGU A;  1GWP A;  3P05 A; 
#chains in the Genus database with same CATH topology
 1P7N A;  1M9Y C;  2PXR C;  4PH0 A;  4DGE C;  1AK4 C;  2GOL B;  1U7K A;  2V4X A;  2XDE A;  1EIA A;  4U0A A;  2XGY A;  1G03 A;  1QRJ A;  2X2D D;  1L6N A;  3NTE A;  2M8N A;  4U0B A;  4U0C A;  1M9C C;  2PWM A;  3BP9 A;  2X83 A;  1E6J P;  1M9X C;  4U0D A;  3H47 A;  2JPR A;  2Y4Z A;  4E92 A;  4U0E A;  4U0F A;  4WYM A;  1M9D C;  4E91 A;  2WLV B;  4INB A;  2M8P A;  4XFZ A;  4XRO A;  5HGK A;  2GON A;  1D1D A;  5JPA A;  4LQW C;  3H4E A;  2PWO A;  4J93 A;  4PH3 A;  2KGF A;  2LF4 A;  2WLV A;  5HGO A;  5HGL A;  1M9E C;  4XRQ A;  4B4N A;  4XFY A;  4NX4 C;  3MGE A;  1EM9 A;  5HGM A;  5HGN A;  4PH2 A;  2M8L A;  4HTW A;  4QNB A;  1AFV A;  2EIA A;  4DGA C;  2XGV A;  4XFX A;  2X82 A;  1M9F C;  2XGU A;  1GWP A;  3P05 A; 
#chains in the Genus database with same CATH homology
 1P7N A;  1M9Y C;  2PXR C;  4PH0 A;  4DGE C;  1AK4 C;  2GOL B;  1U7K A;  2V4X A;  2XDE A;  1EIA A;  4U0A A;  2XGY A;  1G03 A;  1QRJ A;  2X2D D;  1L6N A;  3NTE A;  2M8N A;  4U0B A;  4U0C A;  1M9C C;  2PWM A;  3BP9 A;  2X83 A;  1E6J P;  1M9X C;  4U0D A;  3H47 A;  2JPR A;  2Y4Z A;  4E92 A;  4U0E A;  4U0F A;  4WYM A;  1M9D C;  4E91 A;  2WLV B;  4INB A;  2M8P A;  4XFZ A;  4XRO A;  5HGK A;  2GON A;  1D1D A;  5JPA A;  4LQW C;  3H4E A;  2PWO A;  4J93 A;  4PH3 A;  2KGF A;  2LF4 A;  2WLV A;  5HGO A;  5HGL A;  1M9E C;  4XRQ A;  4B4N A;  4XFY A;  4NX4 C;  3MGE A;  1EM9 A;  5HGM A;  5HGN A;  4PH2 A;  2M8L A;  4HTW A;  4QNB A;  1AFV A;  2EIA A;  4DGA C;  2XGV A;  4XFX A;  2X82 A;  1M9F C;  2XGU A;  1GWP A;  3P05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...