4LQWC

Crystal structure of hiv-1 capsid n-terminal domain in complex with nup358 cyclophilin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HIV-1 capsid undergoes coupled binding and isomerization by the nuclear pore protein NUP358.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords E3 SUMO-protein ligase RanBP2
total genus 49
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4lqwC00
4XFXA 1GWPA 2XDEA 4PH0A 4U0FA 2X82A 2Y4ZA 4QNBA 1M9YC 4U0EA 2WLVA 4XRQA 5HGMA 1E6JP 1U7KA 4DGEC 3H4EA 4WYMA 4XFYA 1M9XC 1G03A 5HGKA 5JPAA 4PH2A 2XGVA 4XFZA 3MGEA 5HGLA 4HTWA 1M9EC 1EIAA 2V4XA 2M8LA 4INBA 1EM9A 2M8PA 2PXRC 3H47A 2GOLB 4U0DA 2X2DD 2PWOA 1M9FC 4U0CA 2XGUA 4U0BA 4LQWC 1QRJA 4DGAC 2EIAA 1M9DC 1AK4C 3P05A 4E91A 4E92A 3BP9A 2JPRA 2M8NA 3NTEA 4XROA 2X83A 2LF4A 1P7NA 4B4NA 2XGYA 1D1DA 2PWMA 2WLVB 5HGOA 1L6NA 4PH3A 4U0AA 2GONA 2KGFA 1M9CC 1AFVA 4J93A 4NX4C 5HGNA
chains in the Genus database with same CATH superfamily
4XFXA 1GWPA 2XDEA 4PH0A 4U0FA 2X82A 2Y4ZA 4QNBA 1M9YC 4U0EA 2WLVA 4XRQA 5HGMA 1E6JP 1U7KA 4DGEC 3H4EA 4WYMA 4XFYA 1M9XC 1G03A 5HGKA 5JPAA 4PH2A 2XGVA 4XFZA 3MGEA 5HGLA 4HTWA 1M9EC 1EIAA 2V4XA 2M8LA 4INBA 1EM9A 2M8PA 2PXRC 3H47A 2GOLB 4U0DA 2X2DD 2PWOA 1M9FC 4U0CA 2XGUA 4U0BA 4LQWC 1QRJA 4DGAC 2EIAA 1M9DC 1AK4C 3P05A 4E91A 4E92A 3BP9A 2JPRA 2M8NA 3NTEA 4XROA 2X83A 2LF4A 1P7NA 4B4NA 2XGYA 1D1DA 2PWMA 2WLVB 5HGOA 1L6NA 4PH3A 4U0AA 2GONA 2KGFA 1M9CC 1AFVA 4J93A 4NX4C 5HGNA
chains in the Genus database with same CATH topology
4XFXA 1GWPA 2XDEA 4PH0A 4U0FA 2X82A 2Y4ZA 4QNBA 1M9YC 4U0EA 2WLVA 4XRQA 5HGMA 1E6JP 1U7KA 4DGEC 3H4EA 4WYMA 4XFYA 1M9XC 1G03A 5HGKA 5JPAA 4PH2A 2XGVA 4XFZA 3MGEA 5HGLA 4HTWA 1M9EC 1EIAA 2V4XA 2M8LA 4INBA 1EM9A 2M8PA 2PXRC 3H47A 2GOLB 4U0DA 2X2DD 2PWOA 1M9FC 4U0CA 2XGUA 4U0BA 4LQWC 1QRJA 4DGAC 2EIAA 1M9DC 1AK4C 3P05A 4E91A 4E92A 3BP9A 2JPRA 2M8NA 3NTEA 4XROA 2X83A 2LF4A 1P7NA 4B4NA 2XGYA 1D1DA 2PWMA 2WLVB 5HGOA 1L6NA 4PH3A 4U0AA 2GONA 2KGFA 1M9CC 1AFVA 4J93A 4NX4C 5HGNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XFX A;  1GWP A;  2XDE A;  4PH0 A;  4U0F A;  2X82 A;  2Y4Z A;  4QNB A;  1M9Y C;  4U0E A;  2WLV A;  4XRQ A;  5HGM A;  1E6J P;  1U7K A;  4DGE C;  3H4E A;  4WYM A;  4XFY A;  1M9X C;  1G03 A;  5HGK A;  5JPA A;  4PH2 A;  2XGV A;  4XFZ A;  3MGE A;  5HGL A;  4HTW A;  1M9E C;  1EIA A;  2V4X A;  2M8L A;  4INB A;  1EM9 A;  2M8P A;  2PXR C;  3H47 A;  2GOL B;  4U0D A;  2X2D D;  2PWO A;  1M9F C;  4U0C A;  2XGU A;  4U0B A;  4LQW C;  1QRJ A;  4DGA C;  2EIA A;  1M9D C;  1AK4 C;  3P05 A;  4E91 A;  4E92 A;  3BP9 A;  2JPR A;  2M8N A;  3NTE A;  4XRO A;  2X83 A;  2LF4 A;  1P7N A;  4B4N A;  2XGY A;  1D1D A;  2PWM A;  2WLV B;  5HGO A;  1L6N A;  4PH3 A;  4U0A A;  2GON A;  2KGF A;  1M9C C;  1AFV A;  4J93 A;  4NX4 C;  5HGN A; 
#chains in the Genus database with same CATH topology
 4XFX A;  1GWP A;  2XDE A;  4PH0 A;  4U0F A;  2X82 A;  2Y4Z A;  4QNB A;  1M9Y C;  4U0E A;  2WLV A;  4XRQ A;  5HGM A;  1E6J P;  1U7K A;  4DGE C;  3H4E A;  4WYM A;  4XFY A;  1M9X C;  1G03 A;  5HGK A;  5JPA A;  4PH2 A;  2XGV A;  4XFZ A;  3MGE A;  5HGL A;  4HTW A;  1M9E C;  1EIA A;  2V4X A;  2M8L A;  4INB A;  1EM9 A;  2M8P A;  2PXR C;  3H47 A;  2GOL B;  4U0D A;  2X2D D;  2PWO A;  1M9F C;  4U0C A;  2XGU A;  4U0B A;  4LQW C;  1QRJ A;  4DGA C;  2EIA A;  1M9D C;  1AK4 C;  3P05 A;  4E91 A;  4E92 A;  3BP9 A;  2JPR A;  2M8N A;  3NTE A;  4XRO A;  2X83 A;  2LF4 A;  1P7N A;  4B4N A;  2XGY A;  1D1D A;  2PWM A;  2WLV B;  5HGO A;  1L6N A;  4PH3 A;  4U0A A;  2GON A;  2KGF A;  1M9C C;  1AFV A;  4J93 A;  4NX4 C;  5HGN A; 
#chains in the Genus database with same CATH homology
 4XFX A;  1GWP A;  2XDE A;  4PH0 A;  4U0F A;  2X82 A;  2Y4Z A;  4QNB A;  1M9Y C;  4U0E A;  2WLV A;  4XRQ A;  5HGM A;  1E6J P;  1U7K A;  4DGE C;  3H4E A;  4WYM A;  4XFY A;  1M9X C;  1G03 A;  5HGK A;  5JPA A;  4PH2 A;  2XGV A;  4XFZ A;  3MGE A;  5HGL A;  4HTW A;  1M9E C;  1EIA A;  2V4X A;  2M8L A;  4INB A;  1EM9 A;  2M8P A;  2PXR C;  3H47 A;  2GOL B;  4U0D A;  2X2D D;  2PWO A;  1M9F C;  4U0C A;  2XGU A;  4U0B A;  4LQW C;  1QRJ A;  4DGA C;  2EIA A;  1M9D C;  1AK4 C;  3P05 A;  4E91 A;  4E92 A;  3BP9 A;  2JPR A;  2M8N A;  3NTE A;  4XRO A;  2X83 A;  2LF4 A;  1P7N A;  4B4N A;  2XGY A;  1D1D A;  2PWM A;  2WLV B;  5HGO A;  1L6N A;  4PH3 A;  4U0A A;  2GON A;  2KGF A;  1M9C C;  1AFV A;  4J93 A;  4NX4 C;  5HGN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...