4LQWC

Crystal structure of hiv-1 capsid n-terminal domain in complex with nup358 cyclophilin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords E3 SUMO-protein ligase RanBP2
publication title HIV-1 capsid undergoes coupled binding and isomerization by the nuclear pore protein NUP358.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4lqwC00
4PH3A 4DGAC 5HGOA 1AFVA 1P7NA 4E91A 2LF4A 4LQWC 5HGLA 2XGUA 3MGEA 2XGVA 1E6JP 2GOLB 2M8PA 1M9CC 4E92A 1GWPA 4XRQA 2PWMA 2V4XA 4J93A 2PWOA 1M9EC 5HGNA 1QRJA 4WYMA 2XDEA 4XFXA 4U0BA 1M9DC 4PH2A 1EM9A 1M9YC 2X82A 2X2DD 4NX4C 2X83A 4U0FA 4DGEC 2GONA 4XFYA 4U0AA 1U7KA 2M8LA 1AK4C 3H4EA 2EIAA 2KGFA 1G03A 2WLVB 1L6NA 2PXRC 4U0EA 3P05A 1EIAA 2Y4ZA 4HTWA 4INBA 4U0DA 5HGMA 4B4NA 1M9XC 4U0CA 2XGYA 2M8NA 3BP9A 1M9FC 4PH0A 4QNBA 4XFZA 3NTEA 1D1DA 4XROA 5JPAA 5HGKA 2JPRA 3H47A 2WLVA
chains in the Genus database with same CATH superfamily
4PH3A 4DGAC 5HGOA 1AFVA 1P7NA 4E91A 2LF4A 4LQWC 5HGLA 2XGUA 3MGEA 2XGVA 1E6JP 2GOLB 2M8PA 1M9CC 4E92A 1GWPA 4XRQA 2PWMA 2V4XA 4J93A 2PWOA 1M9EC 5HGNA 1QRJA 4WYMA 2XDEA 4XFXA 4U0BA 1M9DC 4PH2A 1EM9A 1M9YC 2X82A 2X2DD 4NX4C 2X83A 4U0FA 4DGEC 2GONA 4XFYA 4U0AA 1U7KA 2M8LA 1AK4C 3H4EA 2EIAA 2KGFA 1G03A 2WLVB 1L6NA 2PXRC 4U0EA 3P05A 1EIAA 2Y4ZA 4HTWA 4INBA 4U0DA 5HGMA 4B4NA 1M9XC 4U0CA 2XGYA 2M8NA 3BP9A 1M9FC 4PH0A 4QNBA 4XFZA 3NTEA 1D1DA 4XROA 5JPAA 5HGKA 2JPRA 3H47A 2WLVA
chains in the Genus database with same CATH topology
4PH3A 4DGAC 5HGOA 1AFVA 1P7NA 4E91A 2LF4A 4LQWC 5HGLA 2XGUA 3MGEA 2XGVA 1E6JP 2GOLB 2M8PA 1M9CC 4E92A 1GWPA 4XRQA 2PWMA 2V4XA 4J93A 2PWOA 1M9EC 5HGNA 1QRJA 4WYMA 2XDEA 4XFXA 4U0BA 1M9DC 4PH2A 1EM9A 1M9YC 2X82A 2X2DD 4NX4C 2X83A 4U0FA 4DGEC 2GONA 4XFYA 4U0AA 1U7KA 2M8LA 1AK4C 3H4EA 2EIAA 2KGFA 1G03A 2WLVB 1L6NA 2PXRC 4U0EA 3P05A 1EIAA 2Y4ZA 4HTWA 4INBA 4U0DA 5HGMA 4B4NA 1M9XC 4U0CA 2XGYA 2M8NA 3BP9A 1M9FC 4PH0A 4QNBA 4XFZA 3NTEA 1D1DA 4XROA 5JPAA 5HGKA 2JPRA 3H47A 2WLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PH3 A;  4DGA C;  5HGO A;  1AFV A;  1P7N A;  4E91 A;  2LF4 A;  4LQW C;  5HGL A;  2XGU A;  3MGE A;  2XGV A;  1E6J P;  2GOL B;  2M8P A;  1M9C C;  4E92 A;  1GWP A;  4XRQ A;  2PWM A;  2V4X A;  4J93 A;  2PWO A;  1M9E C;  5HGN A;  1QRJ A;  4WYM A;  2XDE A;  4XFX A;  4U0B A;  1M9D C;  4PH2 A;  1EM9 A;  1M9Y C;  2X82 A;  2X2D D;  4NX4 C;  2X83 A;  4U0F A;  4DGE C;  2GON A;  4XFY A;  4U0A A;  1U7K A;  2M8L A;  1AK4 C;  3H4E A;  2EIA A;  2KGF A;  1G03 A;  2WLV B;  1L6N A;  2PXR C;  4U0E A;  3P05 A;  1EIA A;  2Y4Z A;  4HTW A;  4INB A;  4U0D A;  5HGM A;  4B4N A;  1M9X C;  4U0C A;  2XGY A;  2M8N A;  3BP9 A;  1M9F C;  4PH0 A;  4QNB A;  4XFZ A;  3NTE A;  1D1D A;  4XRO A;  5JPA A;  5HGK A;  2JPR A;  3H47 A;  2WLV A; 
#chains in the Genus database with same CATH topology
 4PH3 A;  4DGA C;  5HGO A;  1AFV A;  1P7N A;  4E91 A;  2LF4 A;  4LQW C;  5HGL A;  2XGU A;  3MGE A;  2XGV A;  1E6J P;  2GOL B;  2M8P A;  1M9C C;  4E92 A;  1GWP A;  4XRQ A;  2PWM A;  2V4X A;  4J93 A;  2PWO A;  1M9E C;  5HGN A;  1QRJ A;  4WYM A;  2XDE A;  4XFX A;  4U0B A;  1M9D C;  4PH2 A;  1EM9 A;  1M9Y C;  2X82 A;  2X2D D;  4NX4 C;  2X83 A;  4U0F A;  4DGE C;  2GON A;  4XFY A;  4U0A A;  1U7K A;  2M8L A;  1AK4 C;  3H4E A;  2EIA A;  2KGF A;  1G03 A;  2WLV B;  1L6N A;  2PXR C;  4U0E A;  3P05 A;  1EIA A;  2Y4Z A;  4HTW A;  4INB A;  4U0D A;  5HGM A;  4B4N A;  1M9X C;  4U0C A;  2XGY A;  2M8N A;  3BP9 A;  1M9F C;  4PH0 A;  4QNB A;  4XFZ A;  3NTE A;  1D1D A;  4XRO A;  5JPA A;  5HGK A;  2JPR A;  3H47 A;  2WLV A; 
#chains in the Genus database with same CATH homology
 4PH3 A;  4DGA C;  5HGO A;  1AFV A;  1P7N A;  4E91 A;  2LF4 A;  4LQW C;  5HGL A;  2XGU A;  3MGE A;  2XGV A;  1E6J P;  2GOL B;  2M8P A;  1M9C C;  4E92 A;  1GWP A;  4XRQ A;  2PWM A;  2V4X A;  4J93 A;  2PWO A;  1M9E C;  5HGN A;  1QRJ A;  4WYM A;  2XDE A;  4XFX A;  4U0B A;  1M9D C;  4PH2 A;  1EM9 A;  1M9Y C;  2X82 A;  2X2D D;  4NX4 C;  2X83 A;  4U0F A;  4DGE C;  2GON A;  4XFY A;  4U0A A;  1U7K A;  2M8L A;  1AK4 C;  3H4E A;  2EIA A;  2KGF A;  1G03 A;  2WLV B;  1L6N A;  2PXR C;  4U0E A;  3P05 A;  1EIA A;  2Y4Z A;  4HTW A;  4INB A;  4U0D A;  5HGM A;  4B4N A;  1M9X C;  4U0C A;  2XGY A;  2M8N A;  3BP9 A;  1M9F C;  4PH0 A;  4QNB A;  4XFZ A;  3NTE A;  1D1D A;  4XRO A;  5JPA A;  5HGK A;  2JPR A;  3H47 A;  2WLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...