4LQWC

Crystal structure of hiv-1 capsid n-terminal domain in complex with nup358 cyclophilin
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
146
structure length
146
Chain Sequence
b'PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHAGPIAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 SUMO-protein ligase RanBP2
publication title HIV-1 capsid undergoes coupled binding and isomerization by the nuclear pore protein NUP358.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 49
structure length 146
sequence length 146
chains with identical sequence D
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2013-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4lqwC00
2GONA 4XROA 1M9DC 5JPAA 4U0AA 4INBA 2M8LA 5HGLA 4PH3A 1M9YC 4XFZA 5HGOA 1M9XC 2X83A 3MGEA 2PXRC 5HGNA 4U0FA 1U7KA 1GWPA 1QRJA 2EIAA 4XRQA 4QNBA 3H4EA 4LQWC 2V4XA 4U0DA 4PH0A 4J93A 2X2DD 2XGVA 1M9EC 2GOLB 4PH2A 1AK4C 2XDEA 4DGAC 2WLVA 4XFYA 1M9CC 4U0BA 2PWMA 4XFXA 2JPRA 1AFVA 2X82A 3BP9A 2XGYA 4NX4C 4E91A 3H47A 2XGUA 1D1DA 2LF4A 4E92A 1L6NA 2KGFA 1EIAA 2Y4ZA 4DGEC 4B4NA 1G03A 2PWOA 1E6JP 3NTEA 4U0EA 5HGMA 5HGKA 2WLVB 2M8NA 4U0CA 3P05A 1P7NA 4HTWA 4WYMA 1M9FC 2M8PA 1EM9A
chains in the Genus database with same CATH superfamily
2GONA 4XROA 1M9DC 5JPAA 4U0AA 4INBA 2M8LA 5HGLA 4PH3A 1M9YC 4XFZA 5HGOA 1M9XC 2X83A 3MGEA 2PXRC 5HGNA 4U0FA 1U7KA 1GWPA 1QRJA 2EIAA 4XRQA 4QNBA 3H4EA 4LQWC 2V4XA 4U0DA 4PH0A 4J93A 2X2DD 2XGVA 1M9EC 2GOLB 4PH2A 1AK4C 2XDEA 4DGAC 2WLVA 4XFYA 1M9CC 4U0BA 2PWMA 4XFXA 2JPRA 1AFVA 2X82A 3BP9A 2XGYA 4NX4C 4E91A 3H47A 2XGUA 1D1DA 2LF4A 4E92A 1L6NA 2KGFA 1EIAA 2Y4ZA 4DGEC 4B4NA 1G03A 2PWOA 1E6JP 3NTEA 4U0EA 5HGMA 5HGKA 2WLVB 2M8NA 4U0CA 3P05A 1P7NA 4HTWA 4WYMA 1M9FC 2M8PA 1EM9A
chains in the Genus database with same CATH topology
2GONA 4XROA 1M9DC 5JPAA 4U0AA 4INBA 2M8LA 5HGLA 4PH3A 1M9YC 4XFZA 5HGOA 1M9XC 2X83A 3MGEA 2PXRC 5HGNA 4U0FA 1U7KA 1GWPA 1QRJA 2EIAA 4XRQA 4QNBA 3H4EA 4LQWC 2V4XA 4U0DA 4PH0A 4J93A 2X2DD 2XGVA 1M9EC 2GOLB 4PH2A 1AK4C 2XDEA 4DGAC 2WLVA 4XFYA 1M9CC 4U0BA 2PWMA 4XFXA 2JPRA 1AFVA 2X82A 3BP9A 2XGYA 4NX4C 4E91A 3H47A 2XGUA 1D1DA 2LF4A 4E92A 1L6NA 2KGFA 1EIAA 2Y4ZA 4DGEC 4B4NA 1G03A 2PWOA 1E6JP 3NTEA 4U0EA 5HGMA 5HGKA 2WLVB 2M8NA 4U0CA 3P05A 1P7NA 4HTWA 4WYMA 1M9FC 2M8PA 1EM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GON A;  4XRO A;  1M9D C;  5JPA A;  4U0A A;  4INB A;  2M8L A;  5HGL A;  4PH3 A;  1M9Y C;  4XFZ A;  5HGO A;  1M9X C;  2X83 A;  3MGE A;  2PXR C;  5HGN A;  4U0F A;  1U7K A;  1GWP A;  1QRJ A;  2EIA A;  4XRQ A;  4QNB A;  3H4E A;  4LQW C;  2V4X A;  4U0D A;  4PH0 A;  4J93 A;  2X2D D;  2XGV A;  1M9E C;  2GOL B;  4PH2 A;  1AK4 C;  2XDE A;  4DGA C;  2WLV A;  4XFY A;  1M9C C;  4U0B A;  2PWM A;  4XFX A;  2JPR A;  1AFV A;  2X82 A;  3BP9 A;  2XGY A;  4NX4 C;  4E91 A;  3H47 A;  2XGU A;  1D1D A;  2LF4 A;  4E92 A;  1L6N A;  2KGF A;  1EIA A;  2Y4Z A;  4DGE C;  4B4N A;  1G03 A;  2PWO A;  1E6J P;  3NTE A;  4U0E A;  5HGM A;  5HGK A;  2WLV B;  2M8N A;  4U0C A;  3P05 A;  1P7N A;  4HTW A;  4WYM A;  1M9F C;  2M8P A;  1EM9 A; 
#chains in the Genus database with same CATH topology
 2GON A;  4XRO A;  1M9D C;  5JPA A;  4U0A A;  4INB A;  2M8L A;  5HGL A;  4PH3 A;  1M9Y C;  4XFZ A;  5HGO A;  1M9X C;  2X83 A;  3MGE A;  2PXR C;  5HGN A;  4U0F A;  1U7K A;  1GWP A;  1QRJ A;  2EIA A;  4XRQ A;  4QNB A;  3H4E A;  4LQW C;  2V4X A;  4U0D A;  4PH0 A;  4J93 A;  2X2D D;  2XGV A;  1M9E C;  2GOL B;  4PH2 A;  1AK4 C;  2XDE A;  4DGA C;  2WLV A;  4XFY A;  1M9C C;  4U0B A;  2PWM A;  4XFX A;  2JPR A;  1AFV A;  2X82 A;  3BP9 A;  2XGY A;  4NX4 C;  4E91 A;  3H47 A;  2XGU A;  1D1D A;  2LF4 A;  4E92 A;  1L6N A;  2KGF A;  1EIA A;  2Y4Z A;  4DGE C;  4B4N A;  1G03 A;  2PWO A;  1E6J P;  3NTE A;  4U0E A;  5HGM A;  5HGK A;  2WLV B;  2M8N A;  4U0C A;  3P05 A;  1P7N A;  4HTW A;  4WYM A;  1M9F C;  2M8P A;  1EM9 A; 
#chains in the Genus database with same CATH homology
 2GON A;  4XRO A;  1M9D C;  5JPA A;  4U0A A;  4INB A;  2M8L A;  5HGL A;  4PH3 A;  1M9Y C;  4XFZ A;  5HGO A;  1M9X C;  2X83 A;  3MGE A;  2PXR C;  5HGN A;  4U0F A;  1U7K A;  1GWP A;  1QRJ A;  2EIA A;  4XRQ A;  4QNB A;  3H4E A;  4LQW C;  2V4X A;  4U0D A;  4PH0 A;  4J93 A;  2X2D D;  2XGV A;  1M9E C;  2GOL B;  4PH2 A;  1AK4 C;  2XDE A;  4DGA C;  2WLV A;  4XFY A;  1M9C C;  4U0B A;  2PWM A;  4XFX A;  2JPR A;  1AFV A;  2X82 A;  3BP9 A;  2XGY A;  4NX4 C;  4E91 A;  3H47 A;  2XGU A;  1D1D A;  2LF4 A;  4E92 A;  1L6N A;  2KGF A;  1EIA A;  2Y4Z A;  4DGE C;  4B4N A;  1G03 A;  2PWO A;  1E6J P;  3NTE A;  4U0E A;  5HGM A;  5HGK A;  2WLV B;  2M8N A;  4U0C A;  3P05 A;  1P7N A;  4HTW A;  4WYM A;  1M9F C;  2M8P A;  1EM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...