4E92A

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with inhibitor bm4
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
140
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gag protein
publication title Distinct Effects of Two HIV-1 Capsid Assembly Inhibitor Families That Bind the Same Site within the N-Terminal Domain of the Viral CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Structural protein/inhibitor
total genus 48
structure length 140
sequence length 146
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4e92A00
4XROA 1M9DC 4XFZA 2GOLB 1G03A 5HGLA 4DGEC 2GONA 4XFXA 5HGKA 2V4XA 2M8NA 1L6NA 4XRQA 1GWPA 4DGAC 2LF4A 4HTWA 2Y4ZA 2XGUA 1AK4C 3MGEA 2M8PA 1E6JP 4PH0A 2JPRA 4U0CA 4QNBA 2XGYA 2KGFA 4XFYA 1U7KA 2M8LA 4U0FA 2X2DD 5HGNA 3H47A 1EIAA 1M9FC 2PWMA 2PXRC 4PH2A 2XDEA 4B4NA 3BP9A 5HGMA 3NTEA 4E91A 1P7NA 2X83A 4J93A 4LQWC 2EIAA 4U0BA 2XGVA 4U0EA 2WLVB 5JPAA 1AFVA 4NX4C 1EM9A 1M9EC 4WYMA 2X82A 4INBA 1D1DA 1QRJA 4E92A 2WLVA 2PWOA 1M9CC 4U0AA 1M9YC 5HGOA 3P05A 4PH3A 4U0DA 1M9XC 3H4EA
chains in the Genus database with same CATH superfamily
4XROA 1M9DC 4XFZA 2GOLB 1G03A 5HGLA 4DGEC 2GONA 4XFXA 5HGKA 2V4XA 2M8NA 1L6NA 4XRQA 1GWPA 4DGAC 2LF4A 4HTWA 2Y4ZA 2XGUA 1AK4C 3MGEA 2M8PA 1E6JP 4PH0A 2JPRA 4U0CA 4QNBA 2XGYA 2KGFA 4XFYA 1U7KA 2M8LA 4U0FA 2X2DD 5HGNA 3H47A 1EIAA 1M9FC 2PWMA 2PXRC 4PH2A 2XDEA 4B4NA 3BP9A 5HGMA 3NTEA 4E91A 1P7NA 2X83A 4J93A 4LQWC 2EIAA 4U0BA 2XGVA 4U0EA 2WLVB 5JPAA 1AFVA 4NX4C 1EM9A 1M9EC 4WYMA 2X82A 4INBA 1D1DA 1QRJA 4E92A 2WLVA 2PWOA 1M9CC 4U0AA 1M9YC 5HGOA 3P05A 4PH3A 4U0DA 1M9XC 3H4EA
chains in the Genus database with same CATH topology
4XROA 1M9DC 4XFZA 2GOLB 1G03A 5HGLA 4DGEC 2GONA 4XFXA 5HGKA 2V4XA 2M8NA 1L6NA 4XRQA 1GWPA 4DGAC 2LF4A 4HTWA 2Y4ZA 2XGUA 1AK4C 3MGEA 2M8PA 1E6JP 4PH0A 2JPRA 4U0CA 4QNBA 2XGYA 2KGFA 4XFYA 1U7KA 2M8LA 4U0FA 2X2DD 5HGNA 3H47A 1EIAA 1M9FC 2PWMA 2PXRC 4PH2A 2XDEA 4B4NA 3BP9A 5HGMA 3NTEA 4E91A 1P7NA 2X83A 4J93A 4LQWC 2EIAA 4U0BA 2XGVA 4U0EA 2WLVB 5JPAA 1AFVA 4NX4C 1EM9A 1M9EC 4WYMA 2X82A 4INBA 1D1DA 1QRJA 4E92A 2WLVA 2PWOA 1M9CC 4U0AA 1M9YC 5HGOA 3P05A 4PH3A 4U0DA 1M9XC 3H4EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XRO A;  1M9D C;  4XFZ A;  2GOL B;  1G03 A;  5HGL A;  4DGE C;  2GON A;  4XFX A;  5HGK A;  2V4X A;  2M8N A;  1L6N A;  4XRQ A;  1GWP A;  4DGA C;  2LF4 A;  4HTW A;  2Y4Z A;  2XGU A;  1AK4 C;  3MGE A;  2M8P A;  1E6J P;  4PH0 A;  2JPR A;  4U0C A;  4QNB A;  2XGY A;  2KGF A;  4XFY A;  1U7K A;  2M8L A;  4U0F A;  2X2D D;  5HGN A;  3H47 A;  1EIA A;  1M9F C;  2PWM A;  2PXR C;  4PH2 A;  2XDE A;  4B4N A;  3BP9 A;  5HGM A;  3NTE A;  4E91 A;  1P7N A;  2X83 A;  4J93 A;  4LQW C;  2EIA A;  4U0B A;  2XGV A;  4U0E A;  2WLV B;  5JPA A;  1AFV A;  4NX4 C;  1EM9 A;  1M9E C;  4WYM A;  2X82 A;  4INB A;  1D1D A;  1QRJ A;  4E92 A;  2WLV A;  2PWO A;  1M9C C;  4U0A A;  1M9Y C;  5HGO A;  3P05 A;  4PH3 A;  4U0D A;  1M9X C;  3H4E A; 
#chains in the Genus database with same CATH topology
 4XRO A;  1M9D C;  4XFZ A;  2GOL B;  1G03 A;  5HGL A;  4DGE C;  2GON A;  4XFX A;  5HGK A;  2V4X A;  2M8N A;  1L6N A;  4XRQ A;  1GWP A;  4DGA C;  2LF4 A;  4HTW A;  2Y4Z A;  2XGU A;  1AK4 C;  3MGE A;  2M8P A;  1E6J P;  4PH0 A;  2JPR A;  4U0C A;  4QNB A;  2XGY A;  2KGF A;  4XFY A;  1U7K A;  2M8L A;  4U0F A;  2X2D D;  5HGN A;  3H47 A;  1EIA A;  1M9F C;  2PWM A;  2PXR C;  4PH2 A;  2XDE A;  4B4N A;  3BP9 A;  5HGM A;  3NTE A;  4E91 A;  1P7N A;  2X83 A;  4J93 A;  4LQW C;  2EIA A;  4U0B A;  2XGV A;  4U0E A;  2WLV B;  5JPA A;  1AFV A;  4NX4 C;  1EM9 A;  1M9E C;  4WYM A;  2X82 A;  4INB A;  1D1D A;  1QRJ A;  4E92 A;  2WLV A;  2PWO A;  1M9C C;  4U0A A;  1M9Y C;  5HGO A;  3P05 A;  4PH3 A;  4U0D A;  1M9X C;  3H4E A; 
#chains in the Genus database with same CATH homology
 4XRO A;  1M9D C;  4XFZ A;  2GOL B;  1G03 A;  5HGL A;  4DGE C;  2GON A;  4XFX A;  5HGK A;  2V4X A;  2M8N A;  1L6N A;  4XRQ A;  1GWP A;  4DGA C;  2LF4 A;  4HTW A;  2Y4Z A;  2XGU A;  1AK4 C;  3MGE A;  2M8P A;  1E6J P;  4PH0 A;  2JPR A;  4U0C A;  4QNB A;  2XGY A;  2KGF A;  4XFY A;  1U7K A;  2M8L A;  4U0F A;  2X2D D;  5HGN A;  3H47 A;  1EIA A;  1M9F C;  2PWM A;  2PXR C;  4PH2 A;  2XDE A;  4B4N A;  3BP9 A;  5HGM A;  3NTE A;  4E91 A;  1P7N A;  2X83 A;  4J93 A;  4LQW C;  2EIA A;  4U0B A;  2XGV A;  4U0E A;  2WLV B;  5JPA A;  1AFV A;  4NX4 C;  1EM9 A;  1M9E C;  4WYM A;  2X82 A;  4INB A;  1D1D A;  1QRJ A;  4E92 A;  2WLV A;  2PWO A;  1M9C C;  4U0A A;  1M9Y C;  5HGO A;  3P05 A;  4PH3 A;  4U0D A;  1M9X C;  3H4E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...