4E92A

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with inhibitor bm4
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
140
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Effects of Two HIV-1 Capsid Assembly Inhibitor Families That Bind the Same Site within the N-Terminal Domain of the Viral CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Structural protein/inhibitor
molecule keywords Gag protein
total genus 48
structure length 140
sequence length 146
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4e92A00
2PWMA 2Y4ZA 2LF4A 4PH3A 4WYMA 4B4NA 1L6NA 2XDEA 2XGYA 1U7KA 5HGMA 1M9FC 1E6JP 2PWOA 2X2DD 1QRJA 4DGEC 4XRQA 2JPRA 4NX4C 1M9EC 4E91A 4LQWC 3H4EA 2XGVA 4U0DA 4PH0A 1G03A 2M8NA 2V4XA 2WLVA 1M9XC 2PXRC 3H47A 3MGEA 4XFZA 5HGNA 4E92A 2WLVB 5HGOA 4PH2A 3BP9A 2XGUA 4U0AA 4U0BA 4DGAC 1AFVA 4U0EA 1M9YC 2X83A 5JPAA 4INBA 4U0FA 2M8LA 4HTWA 1M9CC 1P7NA 4XFXA 5HGLA 1GWPA 4XFYA 2KGFA 1AK4C 4J93A 4U0CA 2EIAA 5HGKA 1D1DA 1M9DC 3P05A 3NTEA 4XROA 1EM9A 2GONA 4QNBA 2X82A 2GOLB 1EIAA 2M8PA
chains in the Genus database with same CATH superfamily
2PWMA 2Y4ZA 2LF4A 4PH3A 4WYMA 4B4NA 1L6NA 2XDEA 2XGYA 1U7KA 5HGMA 1M9FC 1E6JP 2PWOA 2X2DD 1QRJA 4DGEC 4XRQA 2JPRA 4NX4C 1M9EC 4E91A 4LQWC 3H4EA 2XGVA 4U0DA 4PH0A 1G03A 2M8NA 2V4XA 2WLVA 1M9XC 2PXRC 3H47A 3MGEA 4XFZA 5HGNA 4E92A 2WLVB 5HGOA 4PH2A 3BP9A 2XGUA 4U0AA 4U0BA 4DGAC 1AFVA 4U0EA 1M9YC 2X83A 5JPAA 4INBA 4U0FA 2M8LA 4HTWA 1M9CC 1P7NA 4XFXA 5HGLA 1GWPA 4XFYA 2KGFA 1AK4C 4J93A 4U0CA 2EIAA 5HGKA 1D1DA 1M9DC 3P05A 3NTEA 4XROA 1EM9A 2GONA 4QNBA 2X82A 2GOLB 1EIAA 2M8PA
chains in the Genus database with same CATH topology
2PWMA 2Y4ZA 2LF4A 4PH3A 4WYMA 4B4NA 1L6NA 2XDEA 2XGYA 1U7KA 5HGMA 1M9FC 1E6JP 2PWOA 2X2DD 1QRJA 4DGEC 4XRQA 2JPRA 4NX4C 1M9EC 4E91A 4LQWC 3H4EA 2XGVA 4U0DA 4PH0A 1G03A 2M8NA 2V4XA 2WLVA 1M9XC 2PXRC 3H47A 3MGEA 4XFZA 5HGNA 4E92A 2WLVB 5HGOA 4PH2A 3BP9A 2XGUA 4U0AA 4U0BA 4DGAC 1AFVA 4U0EA 1M9YC 2X83A 5JPAA 4INBA 4U0FA 2M8LA 4HTWA 1M9CC 1P7NA 4XFXA 5HGLA 1GWPA 4XFYA 2KGFA 1AK4C 4J93A 4U0CA 2EIAA 5HGKA 1D1DA 1M9DC 3P05A 3NTEA 4XROA 1EM9A 2GONA 4QNBA 2X82A 2GOLB 1EIAA 2M8PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PWM A;  2Y4Z A;  2LF4 A;  4PH3 A;  4WYM A;  4B4N A;  1L6N A;  2XDE A;  2XGY A;  1U7K A;  5HGM A;  1M9F C;  1E6J P;  2PWO A;  2X2D D;  1QRJ A;  4DGE C;  4XRQ A;  2JPR A;  4NX4 C;  1M9E C;  4E91 A;  4LQW C;  3H4E A;  2XGV A;  4U0D A;  4PH0 A;  1G03 A;  2M8N A;  2V4X A;  2WLV A;  1M9X C;  2PXR C;  3H47 A;  3MGE A;  4XFZ A;  5HGN A;  4E92 A;  2WLV B;  5HGO A;  4PH2 A;  3BP9 A;  2XGU A;  4U0A A;  4U0B A;  4DGA C;  1AFV A;  4U0E A;  1M9Y C;  2X83 A;  5JPA A;  4INB A;  4U0F A;  2M8L A;  4HTW A;  1M9C C;  1P7N A;  4XFX A;  5HGL A;  1GWP A;  4XFY A;  2KGF A;  1AK4 C;  4J93 A;  4U0C A;  2EIA A;  5HGK A;  1D1D A;  1M9D C;  3P05 A;  3NTE A;  4XRO A;  1EM9 A;  2GON A;  4QNB A;  2X82 A;  2GOL B;  1EIA A;  2M8P A; 
#chains in the Genus database with same CATH topology
 2PWM A;  2Y4Z A;  2LF4 A;  4PH3 A;  4WYM A;  4B4N A;  1L6N A;  2XDE A;  2XGY A;  1U7K A;  5HGM A;  1M9F C;  1E6J P;  2PWO A;  2X2D D;  1QRJ A;  4DGE C;  4XRQ A;  2JPR A;  4NX4 C;  1M9E C;  4E91 A;  4LQW C;  3H4E A;  2XGV A;  4U0D A;  4PH0 A;  1G03 A;  2M8N A;  2V4X A;  2WLV A;  1M9X C;  2PXR C;  3H47 A;  3MGE A;  4XFZ A;  5HGN A;  4E92 A;  2WLV B;  5HGO A;  4PH2 A;  3BP9 A;  2XGU A;  4U0A A;  4U0B A;  4DGA C;  1AFV A;  4U0E A;  1M9Y C;  2X83 A;  5JPA A;  4INB A;  4U0F A;  2M8L A;  4HTW A;  1M9C C;  1P7N A;  4XFX A;  5HGL A;  1GWP A;  4XFY A;  2KGF A;  1AK4 C;  4J93 A;  4U0C A;  2EIA A;  5HGK A;  1D1D A;  1M9D C;  3P05 A;  3NTE A;  4XRO A;  1EM9 A;  2GON A;  4QNB A;  2X82 A;  2GOL B;  1EIA A;  2M8P A; 
#chains in the Genus database with same CATH homology
 2PWM A;  2Y4Z A;  2LF4 A;  4PH3 A;  4WYM A;  4B4N A;  1L6N A;  2XDE A;  2XGY A;  1U7K A;  5HGM A;  1M9F C;  1E6J P;  2PWO A;  2X2D D;  1QRJ A;  4DGE C;  4XRQ A;  2JPR A;  4NX4 C;  1M9E C;  4E91 A;  4LQW C;  3H4E A;  2XGV A;  4U0D A;  4PH0 A;  1G03 A;  2M8N A;  2V4X A;  2WLV A;  1M9X C;  2PXR C;  3H47 A;  3MGE A;  4XFZ A;  5HGN A;  4E92 A;  2WLV B;  5HGO A;  4PH2 A;  3BP9 A;  2XGU A;  4U0A A;  4U0B A;  4DGA C;  1AFV A;  4U0E A;  1M9Y C;  2X83 A;  5JPA A;  4INB A;  4U0F A;  2M8L A;  4HTW A;  1M9C C;  1P7N A;  4XFX A;  5HGL A;  1GWP A;  4XFY A;  2KGF A;  1AK4 C;  4J93 A;  4U0C A;  2EIA A;  5HGK A;  1D1D A;  1M9D C;  3P05 A;  3NTE A;  4XRO A;  1EM9 A;  2GON A;  4QNB A;  2X82 A;  2GOL B;  1EIA A;  2M8P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...