4E92A

Crystal structure of the n-terminal domain of hiv-1 capsid in complex with inhibitor bm4
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
146
structure length
140
Chain Sequence
PIVQNLQGQMVHQAISPRTLNAWVKVVEEKAFSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRLHPVHGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein/inhibitor
molecule keywords Gag protein
publication title Distinct Effects of Two HIV-1 Capsid Assembly Inhibitor Families That Bind the Same Site within the N-Terminal Domain of the Viral CA Protein.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 48
structure length 140
sequence length 146
chains with identical sequence B
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2012-03-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.375.10 Mainly Alpha Orthogonal Bundle Human Immunodeficiency Virus Type 1 Capsid Protein Human Immunodeficiency Virus Type 1 Capsid Protein 4e92A00
4E91A 4U0FA 1E6JP 2M8NA 4E92A 2GOLB 4PH2A 4U0BA 1AK4C 1EM9A 4WYMA 2LF4A 1M9XC 5HGLA 2XGUA 5HGKA 4U0DA 4U0EA 1M9FC 4XFYA 1AFVA 4DGEC 2WLVB 2M8PA 3H47A 3NTEA 3P05A 4HTWA 2M8LA 5JPAA 5HGOA 1M9EC 4XFZA 3BP9A 1M9CC 3MGEA 2PXRC 4J93A 4U0CA 4LQWC 4PH3A 4XROA 4DGAC 3H4EA 4U0AA 4QNBA 2PWOA 2GONA 4NX4C 1M9DC 4XFXA 5HGNA 2KGFA 2X82A 1U7KA 5HGMA 2JPRA 1G03A 1QRJA 2PWMA 1EIAA 2V4XA 2Y4ZA 2XGYA 2X2DD 2XDEA 2XGVA 1D1DA 2EIAA 1GWPA 4INBA 4PH0A 1L6NA 4XRQA 1P7NA 2X83A 1M9YC 4B4NA 2WLVA
chains in the Genus database with same CATH superfamily
4E91A 4U0FA 1E6JP 2M8NA 4E92A 2GOLB 4PH2A 4U0BA 1AK4C 1EM9A 4WYMA 2LF4A 1M9XC 5HGLA 2XGUA 5HGKA 4U0DA 4U0EA 1M9FC 4XFYA 1AFVA 4DGEC 2WLVB 2M8PA 3H47A 3NTEA 3P05A 4HTWA 2M8LA 5JPAA 5HGOA 1M9EC 4XFZA 3BP9A 1M9CC 3MGEA 2PXRC 4J93A 4U0CA 4LQWC 4PH3A 4XROA 4DGAC 3H4EA 4U0AA 4QNBA 2PWOA 2GONA 4NX4C 1M9DC 4XFXA 5HGNA 2KGFA 2X82A 1U7KA 5HGMA 2JPRA 1G03A 1QRJA 2PWMA 1EIAA 2V4XA 2Y4ZA 2XGYA 2X2DD 2XDEA 2XGVA 1D1DA 2EIAA 1GWPA 4INBA 4PH0A 1L6NA 4XRQA 1P7NA 2X83A 1M9YC 4B4NA 2WLVA
chains in the Genus database with same CATH topology
4E91A 4U0FA 1E6JP 2M8NA 4E92A 2GOLB 4PH2A 4U0BA 1AK4C 1EM9A 4WYMA 2LF4A 1M9XC 5HGLA 2XGUA 5HGKA 4U0DA 4U0EA 1M9FC 4XFYA 1AFVA 4DGEC 2WLVB 2M8PA 3H47A 3NTEA 3P05A 4HTWA 2M8LA 5JPAA 5HGOA 1M9EC 4XFZA 3BP9A 1M9CC 3MGEA 2PXRC 4J93A 4U0CA 4LQWC 4PH3A 4XROA 4DGAC 3H4EA 4U0AA 4QNBA 2PWOA 2GONA 4NX4C 1M9DC 4XFXA 5HGNA 2KGFA 2X82A 1U7KA 5HGMA 2JPRA 1G03A 1QRJA 2PWMA 1EIAA 2V4XA 2Y4ZA 2XGYA 2X2DD 2XDEA 2XGVA 1D1DA 2EIAA 1GWPA 4INBA 4PH0A 1L6NA 4XRQA 1P7NA 2X83A 1M9YC 4B4NA 2WLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E91 A;  4U0F A;  1E6J P;  2M8N A;  4E92 A;  2GOL B;  4PH2 A;  4U0B A;  1AK4 C;  1EM9 A;  4WYM A;  2LF4 A;  1M9X C;  5HGL A;  2XGU A;  5HGK A;  4U0D A;  4U0E A;  1M9F C;  4XFY A;  1AFV A;  4DGE C;  2WLV B;  2M8P A;  3H47 A;  3NTE A;  3P05 A;  4HTW A;  2M8L A;  5JPA A;  5HGO A;  1M9E C;  4XFZ A;  3BP9 A;  1M9C C;  3MGE A;  2PXR C;  4J93 A;  4U0C A;  4LQW C;  4PH3 A;  4XRO A;  4DGA C;  3H4E A;  4U0A A;  4QNB A;  2PWO A;  2GON A;  4NX4 C;  1M9D C;  4XFX A;  5HGN A;  2KGF A;  2X82 A;  1U7K A;  5HGM A;  2JPR A;  1G03 A;  1QRJ A;  2PWM A;  1EIA A;  2V4X A;  2Y4Z A;  2XGY A;  2X2D D;  2XDE A;  2XGV A;  1D1D A;  2EIA A;  1GWP A;  4INB A;  4PH0 A;  1L6N A;  4XRQ A;  1P7N A;  2X83 A;  1M9Y C;  4B4N A;  2WLV A; 
#chains in the Genus database with same CATH topology
 4E91 A;  4U0F A;  1E6J P;  2M8N A;  4E92 A;  2GOL B;  4PH2 A;  4U0B A;  1AK4 C;  1EM9 A;  4WYM A;  2LF4 A;  1M9X C;  5HGL A;  2XGU A;  5HGK A;  4U0D A;  4U0E A;  1M9F C;  4XFY A;  1AFV A;  4DGE C;  2WLV B;  2M8P A;  3H47 A;  3NTE A;  3P05 A;  4HTW A;  2M8L A;  5JPA A;  5HGO A;  1M9E C;  4XFZ A;  3BP9 A;  1M9C C;  3MGE A;  2PXR C;  4J93 A;  4U0C A;  4LQW C;  4PH3 A;  4XRO A;  4DGA C;  3H4E A;  4U0A A;  4QNB A;  2PWO A;  2GON A;  4NX4 C;  1M9D C;  4XFX A;  5HGN A;  2KGF A;  2X82 A;  1U7K A;  5HGM A;  2JPR A;  1G03 A;  1QRJ A;  2PWM A;  1EIA A;  2V4X A;  2Y4Z A;  2XGY A;  2X2D D;  2XDE A;  2XGV A;  1D1D A;  2EIA A;  1GWP A;  4INB A;  4PH0 A;  1L6N A;  4XRQ A;  1P7N A;  2X83 A;  1M9Y C;  4B4N A;  2WLV A; 
#chains in the Genus database with same CATH homology
 4E91 A;  4U0F A;  1E6J P;  2M8N A;  4E92 A;  2GOL B;  4PH2 A;  4U0B A;  1AK4 C;  1EM9 A;  4WYM A;  2LF4 A;  1M9X C;  5HGL A;  2XGU A;  5HGK A;  4U0D A;  4U0E A;  1M9F C;  4XFY A;  1AFV A;  4DGE C;  2WLV B;  2M8P A;  3H47 A;  3NTE A;  3P05 A;  4HTW A;  2M8L A;  5JPA A;  5HGO A;  1M9E C;  4XFZ A;  3BP9 A;  1M9C C;  3MGE A;  2PXR C;  4J93 A;  4U0C A;  4LQW C;  4PH3 A;  4XRO A;  4DGA C;  3H4E A;  4U0A A;  4QNB A;  2PWO A;  2GON A;  4NX4 C;  1M9D C;  4XFX A;  5HGN A;  2KGF A;  2X82 A;  1U7K A;  5HGM A;  2JPR A;  1G03 A;  1QRJ A;  2PWM A;  1EIA A;  2V4X A;  2Y4Z A;  2XGY A;  2X2D D;  2XDE A;  2XGV A;  1D1D A;  2EIA A;  1GWP A;  4INB A;  4PH0 A;  1L6N A;  4XRQ A;  1P7N A;  2X83 A;  1M9Y C;  4B4N A;  2WLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...